Kentucky's Individualized Kindergartens: A State Network Design for Early Intervention.

Science.gov (United States)

Bright, B.; Cansler, D. P.

The KIK (Kentucky Individualized Kindergartens) project, a collaborative project between Kentucky's Department of Education and the Chapel Hill (NC) Training-Outreach project, is designed to serve high risk children. KIK provides early identification of high risk kindergarteners, development of individualized education programs, and implementation…

COCKROACHES, PESTICIDE USE, AND CHILDREN'S PULMONARY FUNCTION IN AN ARID COMMUNITY

Science.gov (United States)

Cockroaches, pesticide use, and children's pulmonary function in an arid communityErik Svendsen1, Mary Ross1, Melissa Gonzales2, Debra Walsh1, Scott Rhoney1, Gina Terrill1, Lucas Neas11US EPA, Chapel Hill, NC; 2University of New MexicoThe El Paso Children's He...

INHIBITION OF TOBACCO SMOKE-INDUCED LUNG INFLAMMATION BY A CATALYTIC ANTIOXIDANT

Science.gov (United States)

AMathematical Model for the Kinetics of the Male Reproductive Endocrine SystemLaura K. Potter1,2, H.A. Barton2 and R.W. Setzer21Curriculum in Toxicology, UNC-Chapel Hill, NC; 2US EPA, ORD, NHEERL, ETD, RTP, NCIn this presentation a model for the hormonal regul...

DETERMINATION OF URINARY TRIVALENT ARSENICALS (MMASIII AND DMASIII) IN INDIVIDUALS CHRONICALLY EXPOSED TO ARSENIC

Science.gov (United States)

DETERMINATION OF URINARY TRIVALENT ARSENICALS (MMAsIII and DMAsIII) IN INDIVIDUALS CHRONICALLY EXPOSED TO ARSENIC. L. M. Del Razo1, M. Styblo2, W. R. Cullen3, and D.J. Thomas4. 1Toxicology Section, Cinvestav-IPN, Mexico, D.F., 2Univ. North Carolina, Chapel Hill, NC; 3Uni...

Dorsal clitoral nerve injury following transobturator midurethral sling

Directory of Open Access Journals (Sweden)

Moss CF

2016-09-01

Full Text Available Chailee F Moss,1 Lynn A Damitz,2 Richard H Gracely,3 Alice C Mintz,3 Denniz A Zolnoun,2–4 A Lee Dellon5 1Department of Obstetrics and Gynecology, Ohio State University School of Medicine, Columbus, OH, USA; 2Department of Surgery, University of North Carolina at Chapel Hill, NC, USA; 3Department of Endodontics, University of North Carolina at Chapel Hill, NC, USA; 4Department of Obstetrics and Gynecology, University of North Carolina at Chapel Hill School of Medicine, Chapel Hill, NC, USA; 5Department of Plastic and Reconstructive Surgery, Johns Hopkins University School of Medicine, Baltimore, MD, USA Introduction: Transobturator slings can be successfully used to treat stress urinary incontinence and improve quality of life through a minimally invasive vaginal approach. Persistent postoperative pain can occur and pose diagnostic and therapeutic dilemmas. Following a sling procedure, a patient complained of pinching clitoral and perineal pain. Her symptoms of localized clitoral pinching and pain became generalized over the ensuing years, eventually encompassing the entire left vulvovaginal region.Aim: The aim of this study was to highlight the clinical utility of conventional pain management techniques used for the evaluation and management of patients with postoperative pain following pelvic surgery. Methods: We described a prototypical patient with persistent pain in and around the clitoral region complicating the clinical course of an otherwise successful sling procedure. We specifically discussed the utility of bedside sensory assessment techniques and selective nerve blocks in the evaluation and management of this prototypical patient. Results: Neurosensory assessments and a selective nerve block enabled us to trace the source of the patient’s pain to nerve entrapment along the dorsal nerve of the clitoris. We then utilized a nerve stimulator-guided hydrodissection technique to release the scar contracture Conclusion: This case

GESTATIONAL EXPOSURE TO ETHANE DIMETHANESULFONATE (EDS) ALTERS DEVELOPMENT OF THE MOUSE TESTIS

Science.gov (United States)

GESTATIONAL EXPOSURE TO ETHANE DIMETHANESULFONATE (EDS) ALTERS DEVELOPMENT OF THE MOUSE TESTIS. D.K. Tarka*1,2, J.D. Suarez*2, N.L. Roberts*2, J.M. Rogers*1,2, M.P. Hardy3, and G.R. Klinefelter1,2. 1University of North Carolina, Curriculum in Toxicology, Chapel Hill, NC; 2USEPA,...

TB/HIV integration at primary care level: A quantitative assessment ...

African Journals Online (AJOL)

2012-09-02

Sep 2, 2012 ... Public Health Leadership Program, University of North Carolina, Chapel Hill, NC, USA. L Evarts, MPH. WitkoppenHealth ..... for TB symptoms. • 10% of TB suspects assessed by smear microscopy. Percentage of new HIV-positive patients starting. IPT (indicator B.2.1). 100%. 124 059 (12%). • 0% at 2 clinics.

EFFECT OF DOSE ON THE EXCRETION AND METABOLISM OF MONOMETHYLARSONIC ACID IN THE MOUSE

Science.gov (United States)

EFFECT OF DOSE ON THE EXCRETION AND METABOLISM OF MONOMETHYLARSONIC ACID IN THE MOUSEM F Hughes1, V Devesa2, B C Edwards1, C T Mitchell1, E M Kenyon1, and D J Thomas1. 1US EPA, ORD, NHEERL, ETD, Research Triangle Park, NC; 2UNC-CH, CEMALB, Chapel Hill, NCMonomethylar...

Precursors to the Development of Anxiety Disorders in Young Children with Autism Spectrum Disorder

Science.gov (United States)

2017-12-01

graduate trainees. Undergraduate Training: Logan Beyer, a Duke University undergraduate student , received course credit as an Independent Study student ...Grace Baranek at UNC Chapel Hill, and Adrianne Harris, a graduate student under Drs. Geraldine Dawson, and Nancy Zucker at Duke University , have... Responsivity in Children with Autism.” Poster presented at the Visual Thinking Symposium at Duke University , Durham, NC. Baranek, G. T. (2015

Statistical Bias in Maximum Likelihood Estimators of Item Parameters.

Science.gov (United States)

1982-04-01

34 a> E r’r~e r ,C Ie I# ne,..,.rVi rnd Id.,flfv b1 - bindk numb.r) I; ,t-i i-cd I ’ tiie bias in the maximum likelihood ,st i- i;, ’ t iIeiIrs in...NTC, IL 60088 Psychometric Laboratory University of North Carolina I ERIC Facility-Acquisitions Davie Hall 013A 4833 Rugby Avenue Chapel Hill, NC

Bike Map Lines

Data.gov (United States)

Town of Chapel Hill, North Carolina — Chapel Hill Bike Map Lines from KMZ file.This data came from the wiki comment board for the public, not an “official map” showing the Town of Chapel Hill's plans or...

Circadian rhythm and sleep influences on digestive physiology and disorders

OpenAIRE

Vaughn, Bradley; Rotolo,Sean; Roth,Heidi

2014-01-01

Bradley V Vaughn, Sean Rotolo, Heidi L Roth Division of Sleep Medicine, Department of Neurology, University of North Carolina School of Medicine, Chapel Hill, NC, USA Abstract: Circadian rhythms and sleep influence a variety of physiological functions, including the digestive system. The digestive system also has intrinsic rhythms that interact dynamically with circadian rhythms. New advances in understanding the interaction of these rhythms and sleep provide the prospect of evaluating their...

Filipino Insurgencies (1899-1913): Failures to Incite Popular Support

Science.gov (United States)

2016-04-08

Wars of Peace, 6. 5 Richard E . Welch, Response to Imperialism: The United States and the Philippine- American War, 1899-1902 (Chapel Hill, NC...Muslim Filipinos, 1899-1920 (Quezon City, Philippines: New Day Publishing, 1983). 24 Carlos Quirino, Filipinos at War (Philippines: Vera -Reyes, Inc...Carlos. Filipinos at War. Philippines: Vera -Reyes, Inc, 1987. Ramsey, Robert D. Savage Wars of Peace: Case Studies of Pacification in the Philippines

Look What We Got! How Inherited Data Drives Decision-Making: UNC-Chapel Hill’s 19th-Century American Sheet Music Collection

Directory of Open Access Journals (Sweden)

Renée McBride

2011-04-01

Full Text Available Have you inherited a digital collection containing valuable, but inconsistent metadata? And wondered how to transform it into a usable, quality resource while accepting that it can’t meet your idea of perfection? This article describes such an experience at the University of North Carolina at Chapel Hill University Library with its CONTENTdm-based 19th-Century American Sheet Music Collection, addressing issues such as field construction, the use of controlled vocabularies, development of a project data dictionary, and metadata clean-up.

Evaluation and management of overactive bladder: strategies for optimizing care

Directory of Open Access Journals (Sweden)

Willis-Gray MG

2016-07-01

Full Text Available Marcella G Willis-Gray, Alexis A Dieter, Elizabeth J Geller Division of Female Pelvic Medicine and Reconstructive Surgery, Department of Obstetrics and Gynecology, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA Abstract: Overactive bladder (OAB is a common condition affecting millions of men and women worldwide. It is an embarrassing condition with far-reaching consequences. Although many treatment options exist, no single treatment has been proven to be most effective. Often a combination of therapy is required to successfully manage OAB symptoms. In this review, we provide an overview of OAB, including risk factors for development of OAB; keys to diagnosis; therapeutic options including conservative and medical management, as well as treatments for refractory OAB; when to consider referral to a specialist; and resources for clinicians and patients. The aim of this review is to inform clinicians regarding OAB management in order to improve patient counseling and care. Keywords: overactive bladder, urge incontinence, urinary incontinence, bladder training, lifestyle modifications

Traffic Signal Cycle Lengths

Data.gov (United States)

Town of Chapel Hill, North Carolina — Traffic signal location list for the town of Chapel Hill. This data set includes light cycle information as well as as intersection information.The Town of Chapel...

Nutrition in pregnancy: the argument for including a source of choline

OpenAIRE

Zeisel, Steven H

2013-01-01

Steven H Zeisel Nutrition Research Institute at Kannapolis, Department of Nutrition, University of North Carolina at Chapel Hill, Kannapolis, NC, USA Abstract: Women, during pregnancy and lactation, should eat foods that contain adequate amounts of choline. A mother delivers large amounts of choline across the placenta to the fetus, and after birth she delivers large amounts of choline in milk to the infant; this greatly increases the demand on the choline stores of the mother. Adequate inta...

Book Reviews

OpenAIRE

Redactie KITLV

2001-01-01

-Virginia R. Dominguez, Louis A. Pérez, Jr., On becoming Cuban: Identity, nationality, and culture. Chapel Hill: University of North Carolina Press, 1999. xiv + 579 pp. -Solimar Otero, Kali Argyriadis, La religión à la Havane: Actualités des représentations et des pratiques culturelles havanaises. Paris: Éditions des Archives Contemporaines,1999. 373 pp. -Jane Desmond, Jane Blocker, Where is Ana Mendieta?: Identity, performativity, and exile. Durham NC: Duke University Press, 1999. xvi + 166 ...

The paintings in the chapels of the Camaldolese church in Bielany and its significance for the Krakow art in the 1st half of the 17th century (the Royal Chapel and St Romuald's Chapel

Directory of Open Access Journals (Sweden)

Jerzy Żmudziński

2011-12-01

Full Text Available The enormous significance of the Bielany hermitage in the history of Polish art of the transition period between Mannerism and Baroque has long been rightly acknowledged. However, such appreciation concerns primarily architecture and decorations (stuccoes, and to a lesser extent paintings. Studies on the Polish art of the 1st half of the 17th century have repeatedly mentioned the paintings in the Bielany chapels, albeit they were mostly limited to the statement that some decorations are the work of Venetian painter Tommaso Dolabella and his followers (paintings in the Royal and St Romuald's Chapels and illustrate, as it were, the artist's 'decline', who, having arrived in Poland in the late 17th century, in time abandoned the glorious tradition of the grand Venetian school of the Mannerism epoch, lowered the standard of his artistic output and in a way became "Sarmatised", catering to the taste and expectations of the locals. The authorship of the paintings in the two most prominent chapels of the Bielany church was attributed to Dolabella, his students and followers. The thesis of "Sarmatisation" and the lowering of standards in his work has recently been critically analysed, as the artist's authenticated works from the Royal Chapel have been referred to and "vindicated".

Bicycle Crashes

Data.gov (United States)

Town of Chapel Hill, North Carolina — This data set maps the locations of crashes involving bicyclists in the Chapel Hill Region of North Carolina.The data comes from police-reported bicycle-motor...

Pedestrian Crashes

Data.gov (United States)

Town of Chapel Hill, North Carolina — This data set maps the locations of crashes involving pedestrians in the Chapel Hill Region of North Carolina.The data comes from police-reported bicycle-motor...

An active learning curriculum improves fellows' knowledge and faculty teaching skills: a medical student perspective

Directory of Open Access Journals (Sweden)

Ahmad M

2017-08-01

Full Text Available Mubariz Ahmad, Nourah AlHennawi, Maaham AhmedManchester Medical School, The University of Manchester, Manchester, UKWe read with great interest the article by Inra et al1 which discusses the benefits of using an active learning curriculum to improve faculty teaching skills and help fellows retain more knowledge compared to traditional teaching methods. As current medical students, we can vouch for the effectiveness of this approach in improving the way material can be taught, hence would like to offer our perspective on this.  Authors’ replyJennifer A Inra,1,2 Stephen Pelletier,2 Navin L Kumar,1,2 Edward L Barnes,3,4 Helen M Shields1,21Division of Gastroenterology, Hepatology and Endoscopy, Brigham and Women’s Hospital, 2Harvard Medical School, Boston, MA, 3Division of Gastroenterology and Hepatology, University of North Carolina, Chapel Hill, NC, 4University of North Carolina School of Medicine, Chapel Hill, NC, USAWe appreciate the thoughtful comments received from Ahmed et al regarding our article “An active learning curriculum improves fellows’ knowledge and faculty teaching”.1 The educational literature supports the recommendation that the optimal timing for a lecture is 10-15 minutes, as a student’s attention may wander or wane after that time.2 This ideal time limit stems from a paperby Hartley in 1978, which recommends this optimal time frame.3View the original paper by Inra and colleagues  

Greenways Pedestrian & Cyclist Counters

Data.gov (United States)

Town of Chapel Hill, North Carolina — Pedestrian and cyclist sensor data time stamped from sensors on the Bolin Creek Trail and Meadowmont Trail in Chapel Hill. Each sensor has four value points that...

Sampling Variances and Covariances of Parameter Estimates in Item Response Theory.

Science.gov (United States)

1982-08-01

substituting (15) into (16) and solving for k and K k = b b1 - o K , (17)k where b and b are means for m and r items, respectively. To find the variance...C5 , and C12 were treated as known. We find that the standard errors of B1 to B5 are increased drastically by ignorance of C 1 to C5 ; all...ERIC Facilltv-Acquisitlons Davie Hall 013A 4833 Rugby Avenue Chapel Hill, NC 27514 Bethesda, MD 20014 -7- Dr. A. J. Eschenbrenner 1 Dr. John R

Community Survey Q2: What to emphasize in Q1

Data.gov (United States)

Town of Chapel Hill, North Carolina — This question is from the 2015 Chapel Hill Community Survey.Which THREE of these items do you think should receive the most emphasis from Town leaders over the next...

Community Survey Q7: Nature of police interactions with respondents

Data.gov (United States)

Town of Chapel Hill, North Carolina — This question is from the 2015 Chapel Hill Community Survey.Have you interacted with the Town’s Police Department in any of the following ways within the past 2...

Community Survey Q5: Public safety - Police services

Data.gov (United States)

Town of Chapel Hill, North Carolina — This question is from the 2015 Chapel Hill Community Survey.Using a scale of 1 to 5 where 5 means “Very Satisfied” and 1 means “Very Dissatisfied,” residents were...

Unmet Need for Contraception among Clients of FP/HIV Integrated ...

African Journals Online (AJOL)

AJRH Managing Editor

1 Department of Maternal and Child Health, Gillings School of Global Public Health, University of North Carolina at Chapel Hill,. Chapel Hill ... Keywords: Partner opposition, contraceptive use, HIV/FP service integration, Nigeria ..... new programs/policies that consider gender and cultural influence on family planning service.

Chapel of cemetery church of all saints in Sedlec - Long-term analysis of hygrothermal conditions

Science.gov (United States)

Pavlík, Zbyšek; Balík, Lukáš; Kudrnáčová, Lucie; Maděra, Jiří; Černý, Robert

2017-07-01

In this paper, long-term monitoring of hygrothermal conditions of the chapel of the cemetery church of All Saints in Sedlec, Czech Republic is presented as a practical tool for evaluation of functional problems of the researched structure. Within the performed experimental tests, interior and exterior climatic conditions were monitored over one year period. Herewith, surface temperature of the chapel wall was measured. Exterior climatic data were collected using weather station Vantage Pro2 placed in church tower. In interior, precise combined relative humidity/temperature sensors were installed. Based on the accessed hygrothermal state of the inspected chapel and identified periods of possible surface condensation, service conditions of the chapel will be optimized in order to prevent extensive damage of historically valuable finishing and furnishing materials, paintings, plasters, and architectural ornaments.

Fostering Under-represented Minority Student Success and Interest in the Geosciences: Outcomes of the UNC-Chapel Hill Increasing Diversity and Enhancing Academia (IDEA) Program

Science.gov (United States)

Hughes, M. H.; Gray, K.; Drostin, M.

2016-12-01

For under-represented minority (URM) students, opportunities to meaningfully participate in academic communities and develop supportive relationships with faculty and peers influence persistence in STEM majors (Figueroa, Hurtado, & Wilkins, 2015; PCAST, 2012; Tsui, 2007). Creating such opportunities is even more important in the geosciences, where a lower percentage of post-secondary degrees are awarded to URM students than in other STEM fields (NSF, 2015; O'Connell & Holmes, 2011; NSF, 2011). Since 2011, Increasing Diversity and Enhancing Academia (IDEA), a program of the UNC-Chapel Hill Institute for the Environment (UNC-IE), has provided 39 undergraduates (predominantly URM and female students) with career-relevant research experiences and professional development opportunities, including a culminating experience of presenting their research at a campus-wide research symposium. External evaluation data have helped to characterize the effectiveness of the IDEA program. These data included pre- and post-surveys assessing students' interest in geosciences, knowledge of career pathways, and perceptions of their abilities related to a specific set of scientific research skills. Additionally, progress towards degrees and dissemination outcomes were tracked. In this presentation, we will share quantitative and qualitative data that demonstrate that participation in the IDEA program has influenced students' interest and persistence in geosciences research and careers. These data range from self-reported competencies in a variety of scientific skills (such as organizing and interpreting data and reading and interpreting science literature) to documentation of student participation in geoscience study and professions. About 69% of participants continued research begun during their internships beyond the internship; and about 38% pursued graduate degrees and secured jobs in geoscience and other STEM fields. (Nearly half are still in school.) Overall, these evaluation data

PHOTOGRAMMETRIC AND LIDAR DOCUMENTATION OF THE ROYAL CHAPEL (CATHEDRAL-MOSQUE OF CORDOBA, SPAIN

Directory of Open Access Journals (Sweden)

J. Cardenal

2012-07-01

Full Text Available At present, cultural heritage documentation projects use a variety of spatial data acquisition techniques such as conventional surveying, photogrammetry and terrestrial laser scanning. This paper deals with a full documentation project based on all those techniques in the Royal Chapel located in the Cathedral-Mosque of Cordoba in Spain, declared World Heritage Site by UNESCO. At present, the Royal Chapel is under study for a detailed diagnostic analysis in order to evaluate the actual state of the chapel, pathologies, construction phases, previous restoration works, material analysis, etc. So in order to assist the evaluation, a documentation project with photogrammetric and laser scanner techniques (TLS has been carried out. With this purpose, accurate cartographic and 3D products, by means of the integration of both image and laser based techniques, were needed to register all data collected during the diagnostic analysis.

A true politician Rebecca Browning Rankin, municipal reference librarian of the City of New York, 1920-1952

CERN Document Server

Seaver, Barry W

2014-01-01

"Truly fascinating...highly recommended"--Library Journal; "meticulously documented"--Libraries & Culture; "recommended"--The Australian Library Journal. "Iluminates the history of New York City at a time of dramatic political change."--William E. Leuchtenburg, William Rand Kenan Professor Emeritus, University of North Carolina at Chapel Hill. "must reading"--Roger W. Lotchin, Professor of History, University of North Carolina at Chapel Hill.

Older adults’ preferences for colorectal cancer-screening test attributes and test choice

Directory of Open Access Journals (Sweden)

Kistler CE

2015-07-01

Full Text Available Christine E Kistler,1–3 Thomas M Hess,4 Kirsten Howard,5,6 Michael P Pignone,2,3,7 Trisha M Crutchfield,2,3,8 Sarah T Hawley,9 Alison T Brenner,2 Kimberly T Ward,2 Carmen L Lewis10 1Department of Family Medicine, School of Medicine, 2Cecil G Sheps Center for Health Services Research, 3Lineberger Comprehensive Cancer Center, University of North Carolina at Chapel Hill, Chapel Hill, 4Department of Psychology, North Carolina State University, Raleigh, NC, USA; 5Institute for Choice, University of South Australia, Sydney, NSW, Australia; 6School of Public Health, University of Sydney, Sydney, NSW, Australia; 7Division of General Internal Medicine, School of Medicine, 8Center for Health Promotion and Disease Prevention, University of North Carolina at Chapel Hill, Chapel Hill, NC, 9Department of Medicine, University of Michigan, Ann Arbor, MI, 10Division of General Internal Medicine, Department of Medicine, University of Colorado School of Medicine, Aurora, CO, USA Background: Understanding which attributes of colorectal cancer (CRC screening tests drive older adults’ test preferences and choices may help improve decision making surrounding CRC screening in older adults.Materials and methods: To explore older adults’ preferences for CRC-screening test attributes and screening tests, we conducted a survey with a discrete choice experiment (DCE, a directly selected preferred attribute question, and an unlabeled screening test-choice question in 116 cognitively intact adults aged 70–90 years, without a history of CRC or inflammatory bowel disease. Each participant answered ten discrete choice questions presenting two hypothetical tests comprised of four attributes: testing procedure, mortality reduction, test frequency, and complications. DCE responses were used to estimate each participant’s most important attribute and to simulate their preferred test among three existing CRC-screening tests. For each individual, we compared the DCE

Archaeological Investigations at the Upper Chapel, Norfolk Street, Sheffield, UK

Directory of Open Access Journals (Sweden)

Katherine Baker

2011-02-01

Full Text Available Sheffield, in the north of England, grew rapidly in the 19th century and gained an international reputation for its cutlery, tableware, and steel products. The material legacy of this age of industrialisation is extensive, and archaeological work in the modern city over the last 20 years has, for the most part, focused on the above and below ground industrial archaeology relating to metals trades' production sites spanning the 19th and 20th centuries. This article describes recent archaeological work around the Upper Chapel, a Unitarian Meeting House in the city centre where archaeological work recovered a possible buried medieval soil deposit, which contained an assemblage of medieval pottery dating from the 12th to 15th centuries. The presence of waster sherds and fragments of kiln furniture within this assemblage suggests that pottery production may have taken place on or near the site, making this the first putative evidence for pottery production in medieval Sheffield. The archaeological investigations also recovered four human burials from the 18th- to 19th-century burial ground associated with the Upper Chapel. The Upper Chapel burial ground differs from other recently excavated cemeteries in Sheffield as it potentially contained graves of high-status individuals, with at least a proportion of the skeletons and coffins well-preserved owing to waterlogged ground conditions. Detailed studies of the human remains, coffins, and incorporated material, including brass shroud pins are also discussed.

The artistic endowment of the Incarnation chapel in the Cathedral of Seville

Directory of Open Access Journals (Sweden)

Lina Malo Lara

2016-12-01

Full Text Available The author documents and studies the artistic endowment of a chapel that belonged to knight Twenty-Four, Juan Serón Olarte, and his wife, Antonia de Verástegui, members of the Sevillian social elite, enriched thanks to the American trade. Between 1636 and 1638 several prominent artists such as Martín Moreno, Francisco de Ocampo and Baltasar Quintero, as well as the lesser known Juan de Palacios, took part in this project. The altarpiece in this chapel reflects the continuing influence of Italian Mannerism in Sevillian art of the early seventeenth century, a circumstance largely determined by the assimilation of diverse engraved sources.

Genetics and epigenetics of eating disorders

Directory of Open Access Journals (Sweden)

Yilmaz Z

2015-03-01

Full Text Available Zeynep Yilmaz,1 J Andrew Hardaway,1 Cynthia M Bulik1–3 1Department of Psychiatry, 2Department of Nutrition, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 3Department of Medical Epidemiology and Biostatistics, Karolinska Institutet, Stockholm, Sweden Abstract: Eating disorders (EDs are serious psychiatric conditions influenced by biological, psychological, and sociocultural factors. A better understanding of the genetics of these complex traits and the development of more sophisticated molecular biology tools have advanced our understanding of the etiology of EDs. The aim of this review is to critically evaluate the literature on the genetic research conducted on three major EDs: anorexia nervosa, bulimia nervosa, and binge eating disorder. We will first review the diagnostic criteria, clinical features, prevalence, and prognosis of anorexia nervosa, bulimia nervosa, and binge eating disorder, followed by a review of family, twin, and adoption studies. We then review the history of genetic studies of EDs covering linkage analysis, candidate-gene association studies, genome-wide association studies, and the study of rare variants in EDs. Our review also incorporates a translational perspective by covering animal models of ED-related phenotypes. Finally, we review the nascent field of epigenetics of EDs and a look forward to future directions for ED genetic research. Keywords: anorexia nervosa, binge eating disorder, bulimia nervosa, animal models, genome-wide association studies, high-throughput sequencing

Keratouveitis from Euphorbia cyparissias exposure is a temporal phenomenon

Directory of Open Access Journals (Sweden)

Fleischman D

2012-06-01

Full Text Available David Fleischman, Jay J Meyer, W Craig FowlerDepartment of Ophthalmology, University of North Carolina Hospitals, Chapel Hill, NC, USAAbstract: We present the case of an 82-year-old woman with severe keratouveitis secondary to exposure to the plant Euphorbia cyparissias during the month of August. Despite copious irrigation of both eyes, she developed a case of Euphorbia keratouveitis that was typical in its course. Exposure to plant sap from this species should be treated much like an alkaline chemical injury as the pH of the ocular surface may be elevated. E. cyparissias should be carefully handled as it may result in keratouveitis, especially in early autumn.Keywords: Euphorbia cyparissias, sap, keratitis, uveitis

Treatment of pediatric Clostridium difficile infection: a review on treatment efficacy and economic value

Directory of Open Access Journals (Sweden)

D'Ostroph AR

2017-10-01

Full Text Available Amanda R D’Ostroph,1 Tsz-Yin So2 1UNC Eshelman School of Pharmacy, University of North Carolina at Chapel Hill, Chapel Hill, 2Department of Pharmacy, Moses H Cone Memorial Hospital, Greensboro, NC, USA Abstract: The incidence of Clostridium difficile infection (CDI in pediatric patients continues to rise. Most of the pediatric recommendations for CDI treatment are extrapolated from the literature and guidelines for adults. The American Academy of Pediatrics recommends oral metronidazole as the first-line treatment option for an initial CDI and the first recurrence if they are mild to moderate in severity. Oral vancomycin is recommended to be used for severe CDI and the second recurrent infection. Additional pulsed regimen of oral vancomycin, which is tapered, may increase efficacy in refractory patients. However, there is lack of large studies evaluating the use of fidaxomicin in pediatrics to know whether it could be a safe and effective treatment option for difficult-to-treat patients. Fidaxomicin is associated with higher total drug costs compared to metronidazole and vancomycin, but the literature supports its use due to a lower rate of CDI recurrence, which may result in cost savings. Further studies are warranted to evaluate the use of fidaxomicin in patients <18 years old and to understand its role in the standard of care for pediatric patients with CDI. Keywords: Clostridium difficile, diarrhea, fidaxomicin, vancomycin, metronidazole, pediatrics 

The Rosslyn Code: Can Physics Explain a 500-Year Old Melody Etched in the Walls of a Scottish Chapel?

Energy Technology Data Exchange (ETDEWEB)

Wilson, Chris [State Magazine

2011-10-19

For centuries, historians have puzzled over a series of 213 symbols carved into the stone of Scotland’s Rosslyn Chapel. (Disclaimer: You may recognize this chapel from The Da Vinci Code, but this is real and unrelated!) Several years ago, a composer and science enthusiast noticed that the symbols bore a striking similarity to Chladni patterns, the elegant images that form on a two- dimensional surface when it vibrates at certain frequencies. This man’s theory: A 500-year-old melody was inscribed in the chapel using the language of physics. But not everyone is convinced. Slate senior editor Chris Wilson travelled to Scotland to investigate the claims and listen to this mysterious melody, whatever it is. Come find out what he discovered, including images of the patterns and audio of the music they inspired.

Estimating active transportation behaviors to support health impact assessment in the United States

Directory of Open Access Journals (Sweden)

Theodore J Mansfield

2016-05-01

Full Text Available Health impact assessment (HIA has been promoted as a means to encourage transportation and city planners to incorporate health considerations into their decision-making. Ideally, HIAs would include quantitative estimates of the population health effects of alternative planning scenarios, such as scenarios with and without infrastructure to support walking and cycling. However, the lack of baseline estimates of time spent walking or biking for transportation (together known as active transportation, which are critically related to health, often prevents planners from developing such quantitative estimates. To address this gap, we use data from the 2009 US National Household Travel Survey to develop a statistical model that estimates baseline time spent walking and biking as a function of the type of transportation used to commute to work along with demographic and built environment variables. We validate the model using survey data from the Raleigh-Durham-Chapel Hill, NC, metropolitan area. We illustrate how the validated model could be used to support transportation-related HIAs by estimating the potential health benefits of built environment modifications that support walking and cycling. Our statistical model estimates that on average, individuals who commute on foot spend an additional 19.8 (95% CI 16.9–23.2 minutes per day walking compared to automobile commuters. Public transit riders walk an additional 5.0 (95% CI 3.5–6.4 minutes per day compared to automobile commuters. Bicycle commuters cycle for an additional 28.0 (95% CI 17.5–38.1 minutes per day compared to automobile commuters. The statistical model was able to predict observed transportation physical activity in the Raleigh-Durham-Chapel Hill region to within 0.5 MET-hours per day (equivalent to about 9 minutes of daily walking time for 83% of observations. Across the Raleigh-Durham-Chapel Hill region, an estimated 38 (95% CI 15–59 premature deaths potentially could be

Estimating Active Transportation Behaviors to Support Health Impact Assessment in the United States.

Science.gov (United States)

Mansfield, Theodore J; Gibson, Jacqueline MacDonald

2016-01-01

Health impact assessment (HIA) has been promoted as a means to encourage transportation and city planners to incorporate health considerations into their decision-making. Ideally, HIAs would include quantitative estimates of the population health effects of alternative planning scenarios, such as scenarios with and without infrastructure to support walking and cycling. However, the lack of baseline estimates of time spent walking or biking for transportation (together known as "active transportation"), which are critically related to health, often prevents planners from developing such quantitative estimates. To address this gap, we use data from the 2009 US National Household Travel Survey to develop a statistical model that estimates baseline time spent walking and biking as a function of the type of transportation used to commute to work along with demographic and built environment variables. We validate the model using survey data from the Raleigh-Durham-Chapel Hill, NC, USA, metropolitan area. We illustrate how the validated model could be used to support transportation-related HIAs by estimating the potential health benefits of built environment modifications that support walking and cycling. Our statistical model estimates that on average, individuals who commute on foot spend an additional 19.8 (95% CI 16.9-23.2) minutes per day walking compared to automobile commuters. Public transit riders walk an additional 5.0 (95% CI 3.5-6.4) minutes per day compared to automobile commuters. Bicycle commuters cycle for an additional 28.0 (95% CI 17.5-38.1) minutes per day compared to automobile commuters. The statistical model was able to predict observed transportation physical activity in the Raleigh-Durham-Chapel Hill region to within 0.5 MET-hours per day (equivalent to about 9 min of daily walking time) for 83% of observations. Across the Raleigh-Durham-Chapel Hill region, an estimated 38 (95% CI 15-59) premature deaths potentially could be avoided if the entire

Emerging role of rasburicase in the management of increased plasma uric acid levels in patients with hematologic malignancies

Directory of Open Access Journals (Sweden)

LeAnne D Kennedy

2011-02-01

Full Text Available LeAnne D Kennedy1 Susannah Koontz2 Kamakshi Rao31Wake Forest University Baptist Medical Center, Winston Salem, NC, USA; 2Koontz Oncology Consulting LLC, Houston, TX, USA; 3UNC Hospitals, Chapel Hill, NC, USAAbstract: Tumor lysis syndrome (TLS is defined as a group of metabolic derangements that result from the massive and abrupt release of cellular components into the bloodstream after rapid lysis of tumor cells. Breakdown of released materials leads to a number of electrolyte abnormalities, including elevated uric acid concentrations in the blood (hyperuricemia, which carries potentially serious consequences. The diagnosis, prevention, and management of TLS is complicated by variability in definitions, differences in risk factors based on patient- and tumor-specific characteristics, and practitioner preferences in terms of pharmaceutical management strategies. The best prevention and management option for a particular patient depends on the patient’s baseline risk for TLS development, the severity of symptoms in the event of TLS development, practical management considerations, and financial implications of treatment.Keywords: tumor lysis syndrome, uric acid, rasburicase

Geometrical analysis of Palesch family chapel in Kľačno, former Gaidel in Western Slovakia.

Directory of Open Access Journals (Sweden)

Grúňová Zuzana

2017-01-01

Full Text Available Oval and elliptic spaces are one group of central plans, used mainly in sacral architecture and palaces. Paper deals with geometrical analysis of one of the smaller representatives of the neoclassical sacral architecture with oval plan - Palesch family chapel of Virgin Mary in village Kľačno in Western Slovakia. Oval and elliptic forms are not so often used in Slovak historical architecture and they are almost always connected with foreign influence and knowledge brought form Vienna, Paris, Pest, Eger and other education and praxis localities of the builder or architect. This uncommon oval form used in the small chapel is therefore certainly of interest from the point of view of architecture and geometry.

Practicing management and leadership: creating the information network for public health officials.

Science.gov (United States)

Baker, Edward L; Porter, Janet

2005-01-01

The Management Moment" is a regular column within the Journal of Public Health Management and Practice. Janet Porter, PhD, and Edward Baker, MD, MPH, MSc, are serving as The Management Moment Editors. Dr Porter is Associate Dean for Executive Education, The North Carolina Institute for Public Health, School of Public Health, at the University of North Carolina at Chapel Hill, and Dr Baker is Director of The North Carolina Institute for Public Health, School of Public Health, at the University of North Carolina at Chapel Hill. This column provides commentary and guidance on timely management issues commonly encountered in public health practice.

Lamb's Chapel Revisited: A Mixed Message on Establishment of Religion, Forum and Free Speech.

Science.gov (United States)

Mawdsley, Ralph D.

1995-01-01

The Supreme Court in "Lamb's Chapel" unanimously reversed federal district and court of appeals decisions that had upheld school district rules prohibiting use of school district property "by any group for religious purposes." Discusses three issues within the context of religious speech: establishment of religion, free speech,…

Mindfulness training applied to addiction therapy: insights into the neural mechanisms of positive behavioral change

Directory of Open Access Journals (Sweden)

Garl

2016-07-01

Full Text Available Eric L Garland,1,2 Matthew O Howard,3 Sarah E Priddy,1 Patrick A McConnell,4 Michael R Riquino,1 Brett Froeliger4 1College of Social Work, 2Hunstsman Cancer Institute, University of Utah, Salt Lake City, UT, USA; 3School of Social Work, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 4Department of Neuroscience, Medical University of South Carolina, Charleston, SC, USA Abstract: Dual-process models from neuroscience suggest that addiction is driven by dysregulated interactions between bottom-up neural processes underpinning reward learning and top-down neural functions subserving executive function. Over time, drug use causes atrophy in prefrontally mediated cognitive control networks and hijacks striatal circuits devoted to processing natural rewards in service of compulsive seeking of drug-related reward. In essence, mindfulness-based interventions (MBIs can be conceptualized as mental training programs for exercising, strengthening, and remediating these functional brain networks. This review describes how MBIs may remediate addiction by regulating frontostriatal circuits, thereby restoring an adaptive balance between these top-down and bottom-up processes. Empirical evidence is presented suggesting that MBIs facilitate cognitive control over drug-related automaticity, attentional bias, and drug cue reactivity, while enhancing responsiveness to natural rewards. Findings from the literature are incorporated into an integrative account of the neural mechanisms of mindfulness-based therapies for effecting positive behavior change in the context of addiction recovery. Implications of our theoretical framework are presented with respect to how these insights can inform the addiction therapy process. Keywords: mindfulness, frontostriatal, savoring, cue reactivity, hedonic dysregulation, reward, addiction

Estimating Active Transportation Behaviors to Support Health Impact Assessment in the United States

Science.gov (United States)

Mansfield, Theodore J.; Gibson, Jacqueline MacDonald

2016-01-01

Health impact assessment (HIA) has been promoted as a means to encourage transportation and city planners to incorporate health considerations into their decision-making. Ideally, HIAs would include quantitative estimates of the population health effects of alternative planning scenarios, such as scenarios with and without infrastructure to support walking and cycling. However, the lack of baseline estimates of time spent walking or biking for transportation (together known as “active transportation”), which are critically related to health, often prevents planners from developing such quantitative estimates. To address this gap, we use data from the 2009 US National Household Travel Survey to develop a statistical model that estimates baseline time spent walking and biking as a function of the type of transportation used to commute to work along with demographic and built environment variables. We validate the model using survey data from the Raleigh–Durham–Chapel Hill, NC, USA, metropolitan area. We illustrate how the validated model could be used to support transportation-related HIAs by estimating the potential health benefits of built environment modifications that support walking and cycling. Our statistical model estimates that on average, individuals who commute on foot spend an additional 19.8 (95% CI 16.9–23.2) minutes per day walking compared to automobile commuters. Public transit riders walk an additional 5.0 (95% CI 3.5–6.4) minutes per day compared to automobile commuters. Bicycle commuters cycle for an additional 28.0 (95% CI 17.5–38.1) minutes per day compared to automobile commuters. The statistical model was able to predict observed transportation physical activity in the Raleigh–Durham–Chapel Hill region to within 0.5 MET-hours per day (equivalent to about 9 min of daily walking time) for 83% of observations. Across the Raleigh–Durham–Chapel Hill region, an estimated 38 (95% CI 15–59) premature deaths potentially could

Patterns of 6-mercaptopurine and azathioprine maintenance therapy among a cohort of commercially insured individuals diagnosed with Crohn's disease in the United States

Directory of Open Access Journals (Sweden)

Lund JL

2013-12-01

Full Text Available Jennifer L Lund,1 Suzanne F Cook,2 Jeffery K Allen,2 Charlotte F Carroll,2 Michael D Kappelman3 1Department of Clinical Epidemiology, Aarhus University, Aarhus, Denmark; 2Worldwide Epidemiology, GlaxoSmithKline, Research Triangle Park, NC, USA; 3Department of Pediatrics, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA Background and aims: Thiopurines, including 6-mercaptopurine (6-MP and azathioprine (AZA, are the mainstay of maintenance therapy for Crohn's disease (CD. However, studies examining their effectiveness in routine practice among diverse patient populations are lacking. Among a cohort of new users of 6MP/AZA, we described treatment patterns and changes in subsequent therapy. Methods: Using the Truven Health Analytics databases, we identified all individuals diagnosed with CD and initiating 6-MP/AZA monotherapy from 2001–2008 (n=3,657. We estimated the proportion of CD patients remaining on 6-MP/AZA monotherapy, using Kaplan–Meier methods, and identified predictors of treatment noncontinuation, using multivariable Cox regression. Among the “noncontinuers,” we described subsequent patterns of maintenance therapy and summarized the diagnosis and procedure codes and prescription drug claims preceding treatment discontinuation. Results: The 1-year 6-MP/AZA treatment continuation rate was 42%. Children (age ≤18 years and individuals with no prior anti-tumor necrosis factor (TNF use were more likely to continue 6-MP/AZA, while those dispensed more (>4 outpatient prescriptions for any drug before initiation of 6-MP/AZA were less likely to continue maintenance treatment. Overall, 1,128 (39% and 105 (4% individuals experienced a clinical event potentially indicating active disease or 6-MP/AZA-intolerance prior to discontinuation, respectively. Most patients discontinued therapy; among the remaining patients who failed to continue 6-MP/AZA, most augmented with an anti-TNF. Conclusion: Most patients initiating 6-MP

The links between agriculture, Anopheles mosquitoes, and malaria risk in children younger than 5 years in the Democratic Republic of the Congo: a population-based, cross-sectional, spatial study

Directory of Open Access Journals (Sweden)

Mark M Janko, PhD

2018-02-01

Funding: National Institutes of Health, National Science Foundation, Bill & Melinda Gates Foundation, President's Malaria Initiative, and Royster Society of Fellows at the University of North Carolina at Chapel Hill.

Kinematic analysis of the flight phase of the Nordic combined and ski jump on a large hill (HS-134 m) during the 2009 Nordic World Ski Championships.

Science.gov (United States)

Svoboda, Zdenek; Janura, Miroslav; Cabell, Lee; Janurová, Eva

2011-01-01

The purpose of this study was to assess the execution of the flight phase in the Nordic combined (NC) among three groups of competitors, representing different skill levels, and to compare them with three groups of ski jumpers (SJs). Thirty NC and thirty SJ competitors, who performed ski jumps on an HS-134 m jumping hill, were divided into three subgroups based on jump length execution. Two-dimensional (2-D) kinematic data were collected from the lower extremities, trunks, and skis of the competitors. The SJ group had a smaller lower extremity angle ( p jump lengths comparable to those of the SJ competitors by having significantly higher in-run velocities.

Olanzapine approved for the acute treatment of schizophrenia or manic/mixed episodes associated with bipolar I disorder in adolescent patients

Directory of Open Access Journals (Sweden)

Ann E Maloney

2010-11-01

Full Text Available Ann E Maloney1,2, Linmarie Sikich31Maine Medical Center Research Institute, Scarborough, ME, USA; 2Department of Psychiatry, Tufts University School of Medicine, Boston, MA, USA; 3Department of Psychiatry, University of North Carolina at Chapel Hill, Chapel Hill, NC, USABackground: Severe and persistent mental illnesses in children and adolescents, such as early-onset schizophrenia spectrum (EOSS disorders and pediatric bipolar disorder (pedBP, are increasingly recognized. Few treatments have demonstrated efficacy in rigorous clinical trials. Enduring response to current medications appears limited. Recently, olanzapine was approved for the treatment of adolescents with schizophrenia or acute manic/mixed episodes in pedBP.Methods: PubMed searches were conducted for olanzapine combined with pharmacology, schizophrenia, or bipolar disorder. Searches related to schizophrenia and bipolar disorder were limited to children and adolescents. The bibliographies of the retrieved articles were hand-checked for additional relevant studies. The epidemiology, phenomenology, and treatment of EOSS and pedBP, and olanzapine’s pharmacology are reviewed. Studies of olanzapine treatment in youth with EOSS and pedBP are examined.Results: Olanzapine is efficacious for EOSS and pedBP. However, olanzapine is not more efficacious than risperidone, molindone, or haloperidol in EOSS and is less efficacious than clozapine in treatment-resistant EOSS. No comparative trials have been done in pedBP. Olanzapine is associated with weight gain, dyslipidemia, and transaminase elevations in youth. Extrapyramidal symptoms, neuroleptic malignant syndrome, and blood dyscrasias have also been reported but appear rare.Conclusions: The authors conclude that olanzapine should be considered a second-line agent in EOSS and pedBP due to its risks for significant weight gain and lipid dysregulation. Awareness of the consistent weight and metabolic changes observed in olanzapine

A tetraethylene glycol coat gives gold nanoparticles long in vivo half-lives with minimal increase in size

Directory of Open Access Journals (Sweden)

Willett JDS

2017-03-01

Full Text Available Julian DS Willett, Marlon G Lawrence, Jennifer C Wilder, Oliver Smithies† Department of Pathology and Laboratory Medicine, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA †Dr Oliver Smithies passed away on January 10, 2017 Abstract: In this study, we describe the experiments determining whether coating gold nanoparticles with tetraethylene glycol (TEG provides pharmacologically relevant advantages, such as increased serum half-life and resistance to protein adsorption. Monodisperse TEG-coated, NaBH4-reduced gold nanoparticles with a hydrodynamic size comparable to albumin were synthesized by reducing gold chloride with NaBH4 under alkaline conditions in the presence of TEG-SH. The particles were characterized by gel electrophoresis, column chromatography, and transmission electron microscopy. The nanoparticles were subsequently injected intravenously into mice, and their half-lives and final destinations were determined via photometric analysis, light microscopy (LM, and transmission electron microscopy. The TEG particles had a long half-life (~400 minutes that was not influenced by splenectomy. After 500 minutes of injection, TEG particles were found in kidney proximal tubule cell vesicles and in spleen red and white pulp. The particles induced apoptosis in the spleen red pulp but not in white pulp or the kidney. Some of the TEG particles appeared to have undergone ligand exchange reactions that increased their charge. The TEG particles were shown to be resistant to nonspecific protein adsorption, as judged by gel electrophoresis and column chromatography. These results demonstrate that naturally monodisperse, small-sized gold nanoparticles coated with TEG have long in vivo plasma half-lives, are minimally toxic, and are resistant to protein adsorption. This suggests that a TEG coating should be considered as an alternative to a polyethylene glycol coating, which is polydisperse and of much larger size. Keywords

Downtown Tenants

Data.gov (United States)

Town of Chapel Hill, North Carolina — Downtown City Tenant Information: Includes tenant name, address, Business open date, close date, years in business, and independent vs. chain. Data provided by the...

Visualising the Guild Chapel, Stratford-upon-Avon: digital models as research tools in buildings archaeology

Directory of Open Access Journals (Sweden)

Kate Giles

2012-07-01

Full Text Available This article disseminates the results of a programme of detailed archaeological survey and archive research on one of Europe's most important surviving late-medieval Guild Chapels — that of the Holy Cross Guild, Stratford-upon-Avon (Warwickshire. Today the building is part of Stratford-upon-Avon's tourist trail, located directly opposite William Shakespeare's home, 'New Place', and visited by thousands of tourists every year. However, its archaeological and historical significance has been overlooked owing to the extensive restoration of the building in the 19th and 20th centuries. This destroyed evidence for an internationally significant scheme of wall paintings within the Chapel, paid for by the London Mayor and Stratford-upon-Avon merchant, Hugh Clopton, an important member of the Holy Cross Guild and the original builder of 'New Place'. The paintings also have an important connection with Stratford-upon-Avon's most famous son, William Shakespeare, whose father may have been involved in their destruction and removal during the 16th century. Research by a team of historical archaeologists and digital heritage specialists at the Department of Archaeology, University of York, has revealed the significance of the Guild Chapel through the creation of a digital model and textual paradata, which form the focus of this article. The project is ground-breaking in that it moves beyond the traditional use of digital models as virtual reconstructions of past buildings to use the model itself as a research tool through which the user can explore and validate the evidence for the scheme directly. This is achieved through the creation of a palimpsest of antiquarian drawings of the paintings, made as they were revealed during restoration works in the 19th and 20th centuries, and set within their 3-dimensional architectural context. The model allows the user to compare and contrast differences in the recording methods, iconographies and interpretations of

Jordan Lake Watershed Protection District

Data.gov (United States)

Town of Chapel Hill, North Carolina — Polygon representing the area of the Jordan Lake Watershed Protection District. The Watershed Protection District (PDF) is a sensitive area of land that drains to...

33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

Circadian rhythm and sleep influences on digestive physiology and disorders

Directory of Open Access Journals (Sweden)

Vaughn BV

2014-09-01

Full Text Available Bradley V Vaughn, Sean Rotolo, Heidi L Roth Division of Sleep Medicine, Department of Neurology, University of North Carolina School of Medicine, Chapel Hill, NC, USA Abstract: Circadian rhythms and sleep influence a variety of physiological functions, including the digestive system. The digestive system also has intrinsic rhythms that interact dynamically with circadian rhythms. New advances in understanding the interaction of these rhythms and sleep provide the prospect of evaluating their role in normal physiology and the link of their disruption to pathological conditions. Recent work has demonstrated that sleep and circadian factors influence appetite, nutrient absorption, and metabolism. Disruption of sleep and circadian rhythms may increase vulnerability to digestive disorders, including reflux, ulcers, inflammatory bowel issues, irritable bowel disease, and gastrointestinal cancer. As our knowledge of the link between circadian timing and gastrointestinal physiology grows, so do our opportunities to provide promising diagnostic and therapeutic approaches for gastrointestinal disorders. Keywords: digestion, digestive diseases, gastrointestinal reflux, sleep, circadian rhythm 

Diversity Index

Data.gov (United States)

Town of Chapel Hill, North Carolina — This map service summarizes racial and ethnic diversity in the United States in 2012.The Diversity Index shows the likelihood that two persons chosen at random from...

Clinical potential of mechlorethamine gel for the topical treatment of mycosis fungoides-type cutaneous T-cell lymphoma: a review on current efficacy and safety data

Directory of Open Access Journals (Sweden)

Liner K

2018-01-01

Full Text Available Kendall Liner,1 Celeste Brown,2 Laura Y McGirt3 1Division of Dermatology, Medical College of Georgia at Augusta Health, Augusta, GA, USA; 2School of Medicine, University of North Carolina at Chapel Hill, Carolinas Medical Center, Charlotte, NC, USA; 3Department of Hematology/Oncology, Levine Cancer Institute, Carolinas Medical Center, Charlotte, NC, USA Abstract: Nitrogen mustard is a chemotherapeutic agent that has a well-documented safety and efficacy profile in the treatment of cutaneous T-cell lymphoma. Development of nitrogen mustard formulations and treatment regimens has been studied extensively over the last 40 years. In the last 5 years, a new gel formulation has been developed that is associated with a decrease in delayed hypersensitivity reactions. The authors in this review found that while the gel formulation may result in a decrease of allergic contact dermatitis, this advantage has been replaced by a higher number of irritant contact reactions and a decrease in complete response rate. The gel formulation has a complete response rate of 13.8%, which is a decrease in efficacy when compared to aqueous-based preparations of similar concentrations. Keywords: mycosis fungoides, nitrogen mustard, mechlorethamine gel, cutaneous T-cell lymphoma, CTCL, Valchlor®

Ergonomics and cultural heritage: the Palatina chapel in Palermo, Italy

Directory of Open Access Journals (Sweden)

Salvatore Barbaro

2007-07-01

Full Text Available The present article presents results of a study that aims at the assessment of ergonomic safety conditions inside the Palatina chapel of Palermo. To reach this object, an informative questionnaire was established so as to collect visitors’ subjective judgments regarding overall ergonomic conditions in terms of accessibility, availability, safety or else environmental conditions (thermo-hygrometry; air, sound and visual quality; this stage was carried out, bearing in mind the Museum Visitors’ Rights Card that is currently under creation by the “Legambiente” group. An automatic instrument was bought to daily count the numbers of visitors; the latter element shall then be related to indoor environmental data registered thanks to a monitoring system of thermohygrometry, illuminating engineering and environmental aggressiveness.

IMPLEMENTASI SANDI HILL UNTUK PENYANDIAN CITRA

Directory of Open Access Journals (Sweden)

JJ Siang

2002-01-01

Full Text Available Hill's code is one of text encoding technique. In this research, Hill's code is extended to image encoding. The image used is BMP 24 bit format. 2x2 and 3x3 matrices is used as a key. The results show that Hill's code is suitable for image whose RGB values vary highly. On the contrary, it is not suitable for less varied RGB images since its original pattern is still persisted in encrypted image. Hill's code for image encoding has also disadvantage in the case that the key matrix is not unique. However, for daily application, with good key matrix, Hill's code can be applied to encode image since it's process only deals with simple matrix operation so it become fast. Abstract in Bahasa Indonesia : Sandi Hill merupakan salah satu teknik penyandian teks. Dalam penelitian ini, pemakaian sandi Hill diperluas dari teks ke citra bertipe BMP 24 bit. Matriks yang dipakai berordo 2x2 dan 3x3. Hasil percobaan menunjukkan bahwa sandi Hill cocok untuk enkripsi citra dengan variasi nilai RGB antar piksel berdekatan yang tinggi (seperti foto, tapi tidak cocok untuk citra dengan variasi nilai RGB yang rendah (seperti gambar kartun karena pola citra asli masih tampak dalam citra sandi. Sandi Hill juga memiliki kelemahan dalam hal tidak tunggalnya matriks kunci yang dapat dipakai. Akan tetapi untuk pemakaian biasa, dengan pemilihan matriks kunci yang baik, sandi Hill dapat dipakai untuk penyandian karena hanya melibatkan operasi matriks biasa sehingga prosesnya relatif cepat. Kata kunci: Sandi Hill, Citra, Relatif Prima.

2015 Community Survey Data

Data.gov (United States)

Town of Chapel Hill, North Carolina — These are the answers to the 2015 Community Survey.A comprehensive summary of the survey results can be found here.The survey asked town members to address their...

Hill's formula

Energy Technology Data Exchange (ETDEWEB)

Bolotin, Sergey V [Steklov Mathematical Institute, Russian Academy of Sciences, Moscow (Russian Federation); Treschev, Dmitrii V [M. V. Lomonosov Moscow State University, Moscow (Russian Federation)

2010-07-27

In his study of periodic orbits of the three-body problem, Hill obtained a formula connecting the characteristic polynomial of the monodromy matrix of a periodic orbit with the infinite determinant of the Hessian of the action functional. A mathematically rigorous definition of the Hill determinant and a proof of Hill's formula were obtained later by Poincare. Here two multidimensional generalizations of Hill's formula are given: for discrete Lagrangian systems (symplectic twist maps) and for continuous Lagrangian systems. Additional aspects appearing in the presence of symmetries or reversibility are discussed. Also studied is the change of the Morse index of a periodic trajectory upon reduction of order in a system with symmetries. Applications are given to the problem of stability of periodic orbits. Bibliography: 34 titles.

Early Brain changes May Help Predict Autism Among High-Risk Infants

Science.gov (United States)

... NICHD Research Information Find a Study More Information Pharmacology Condition Information NICHD Research Information Find a Study ... the University of North Carolina, Chapel Hill, used magnetic resonance imaging (MRI) to look for differences in brain development ...

The Origin of the Columbia Hills

Science.gov (United States)

Rice, J. W.

2005-12-01

The Columbia Hills form a rugged ridge complex comprised of 7 peaks spanning some 3.5 km in length and reaching a maximum height of 106 m (Husband Hill) above the plains of Spirit's landing site. As of this writing Spirit has been exploring the Columbia Hills for over 440 sols (since sol 156 on June 11, 2004). Thus far the origin of the Columbia Hills has remained elusive despite detailed analysis of numerous rock and soil targets, including outcrops. The chemical differences among the 6 distinct rock classes attest to the lithologic diversity and geologic complexity of the Hills. Origin of the Columbia Hills Several hypothesis have been put forth to explain the origin of the Columbia Hills: Old eroded partially buried impact crater rim(s), central peak, residual intracrater fill material, volcanic construct, wrinkle ridge, delta and or combinations of the above. Observations that support various aspects of these multiple hypotheses will be discussed. Numerous buried craters are observed on the floor of Gusev lending credence to the idea that the Columbia Hills are the remains of an ancient impact crater rim or possibly a central peak. Morphologic evidence of the rim of Thira crater and the Columbia Hills appears to support this hypothesis. The Aeolis region contains numerous craters that contain layered materials in the absence of any major fluvial systems. This could imply that the Columbia Hills are the remnants of a formerly extensive unit(s). Gusev contains many hills scattered across its floor such as Grissom, White, Chaffee and numerous other buttes and mesas that may be remnants of a former extensive intracrater deposit. Another possibility is that the Columbia Hills are composed of volcanic materials (cinder cones and associated ash and lava flows) derived either locally or from Apollinaris Patera located 300 km to the north. Several depressions are located in the Columbia Hills. These features could be calderas but are most likely impact craters. The most

The Hill Chart Calculation for Pelton Runner Models using the HydroHillChart - Pelton Module Software

Directory of Open Access Journals (Sweden)

Adelina Bostan

2015-07-01

Full Text Available The Pelton turbines industrial design is based on the hill chart characteristics obtained by measuring the models. Primary data measurements used to obtain the hill chart can be processed graphically, by hand or by using graphic programs respectively CAD programs; the HydroHillChart - Pelton module software is a specialized tool in achieving the hill chart, using interpolation cubic spline functions. Thereby, based on measurements of several models of Pelton turbines, a computerized library, used to design industrial Pelton turbines can be created. The paper presents the universal characteristics calculated by using the HydroHillChart - Pelton module software for a series of Pelton runners.

Loess Hills of Iowa

Data.gov (United States)

Iowa State University GIS Support and Research Facility — This coverage outlines the boundary of the Loess Hills in Iowa at 1:100,000 scale. Criteria applied to the delineation of the Loess Hills included drainage density,...

About Nation, Race, and Ethnicity in Latin America in the 19th and 20th centuries

Directory of Open Access Journals (Sweden)

Hanni Jalil Paier

2013-12-01

Full Text Available Bibliographic outline of the following book:APPELBAUM, Nancy P., Anne S. Macpherson and Karin A. Rosemblatt (Eds. (2003. Race and Nation in Modern Latin America. Chapel Hill: University of North Carolina Press, 329 pp.

Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

Science.gov (United States)

Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

2017-11-01

TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

Budget and Actuals

Data.gov (United States)

Town of Chapel Hill, North Carolina — This dataset contains the Town's Year-to-Date Budget and Actuals for Fiscal Years 2016, 2017, and 2018. Fiscal years run from July 1 to June 30. The data comes from...

Ethanol suppression of peripheral blood mononuclear cell trafficking across brain endothelial cells in immunodeficiency virus infection

Directory of Open Access Journals (Sweden)

Lola C Hudson

2010-01-01

Full Text Available Lola C Hudson1, Brenda A Colby1, Rick B Meeker21Department of Molecular Biosciences, College of Veterinary Medicine, North Carolina State University, Raleigh, NC, USA; 2Department of Neurology, School of Medicine, University of North Carolina at Chapel Hill, Chapel Hill, NC, USAAbstract: Earlier studies suggested that the combination of alcohol use and immunodeficiency virus infection resulted in more severe neurologic disease than either condition individually. These deleterious interactions could be due to increased immune cell and virus trafficking or may result from interactions between ethanol and human immunodeficiency virus (HIV-associated toxicity within the brain. To determine the extent to which increased trafficking played a role, we examined the effect of ethanol on the migration of different peripheral blood mononuclear cell (PBMCs subsets across a brain endothelial cell monolayer. We utilized combinations of feline brain endothelial cells with astrocytes, and/or microglia with either acute exposure to 0.08 g/dL ethanol, a combination of ethanol and feline immunodeficiency virus (FIV, or FIV alone. Adherence of PBMCs to endothelium was increased in all combinations of cells with the addition of ethanol. Despite increased PBMC adhesion with ethanol treatment, transmigration of B cells, monocytes, CD4 T cells and CD8 T cells was not increased and was actually decreased in the presence of astrocytes. Expression of three common adhesion molecules, intercellular adhesion molecule-1 (ICAM1, ICAM2, and vascular cell adhesion molecule, was unchanged or slightly decreased by ethanol. This indicated that although adherence is increased by ethanol it is not due to an increased expression of adhesion molecules. RANTES, MIP1α, MIP1β, and MCP-1 mRNA expression was also studied in brain endothelial cells, astrocytes and microglia by reverse transcriptase-polymerase chain reaction. Ethanol treatment of astrocytes resulted in modest changes of

Antigravity hills are visual illusions.

Science.gov (United States)

Bressan, Paola; Garlaschelli, Luigi; Barracano, Monica

2003-09-01

Antigravity hills, also known as spook hills or magnetic hills, are natural places where cars put into neutral are seen to move uphill on a slightly sloping road, apparently defying the law of gravity. We show that these effects, popularly attributed to gravitational anomalies, are in fact visual illusions. We re-created all the known types of antigravity spots in our laboratory using tabletop models; the number of visible stretches of road, their slant, and the height of the visible horizon were systematically varied in four experiments. We conclude that antigravity-hill effects follow from a misperception of the eye level relative to gravity, caused by the presence of either contextual inclines or a false horizon line.

76 FR 20293 - Approval and Promulgation of Implementation Plans and Designations of Areas for Air Quality...

Science.gov (United States)

2011-04-12

... Co. ( 37-119-1009). Rowan County (NC) 301 West St. & Gold 0.084 0.071 0.077 0.077 Hill Ave. (37-159...). Rowan County (NC) 301 West St & Gold 93 91 95 93 Hill Ave. (37-159- 0021). Rowan County (NC) 925 N... 40 CFR Part 52 Environmental protection, Air pollution control, Intergovernmental relations, Oxides...

Acoustics Characterization of the Open Chapel´s St. Nicholas of Tolentino Ancient Monastery at Actopan [Hidalgo], Mexico. An example of regional heritage resignification

Directory of Open Access Journals (Sweden)

Eduardo Javier García Alonso

2014-04-01

Full Text Available This paper summarizes the study of the acoustic behavior of the opened chapel from the “ex convento de San Nicolás de Tolentino”, located in the municipality of Actopan, state of Hidalgo, in Mexico. Such behavior is explained through the acoustic modeling; how at the time, a higher sound pressure level could be attained to cover a longer distance enabling to transmit the religious message to a multitude of parishioners. A collateral and brief historiographic analysis is made about the main function of the opened chapel, and has been complemented with this acustic analysis allowing us to pose new research horizons for this type of heritage buildings at the region.

Rainfall-runoff modeling of the Chapel Branch Creek Watershed using GIS-based rational and SCS-CN methods

Science.gov (United States)

Elizabeth N. Mihalik; Norm S. Levine; Devendra M. Amatya

2008-01-01

Chapel Branch Creek (CBC), located within the Town of Santee adjacent to Lake Marion in Orangeburg County, SC, is listed on the SC 2004 303(d) list of impaired waterbodies due to elevated levels of nitrogen (N), phosphorus (P), chlorophyll-a, and pH. In this study, using a GIS-based approach, two runoff modeling methods, the Rational and SCS-CN methods, have been...

CLONING, EXPRESSION, AND MUTATIONAL ANALYSIS OF RAT S-ADENOSYL-1-METHIONINE: ARSENIC (III) METHYLTRANSFERASE

Science.gov (United States)

CLONING, EXPRESSION, AND MUTATIONAL ANALYSIS OF RAT S-ADENOSYL-L-METHIONINE: ARSENIC(III) METHYLTRANSFERASEStephen B. Waters, Ph.D., Miroslav Styblo, Ph.D., Melinda A. Beck, Ph.D., University of North Carolina at Chapel Hill; David J. Thomas, Ph.D., U.S. Environmental...

Human and animal studies: portals into the whole body and whole population response

Science.gov (United States)

Human and animal studies: portals into the whole body and whole population response Michael C. Madden1 and Brett Winters21US Environmental Protection Agency and 2University of North Carolina Human Studies Facility, Chapel Hill, North Carolina, USA Studies involving collection and...

Prevention and management of postoperative urinary retention after urogynecologic surgery

Directory of Open Access Journals (Sweden)

Geller EJ

2014-08-01

Full Text Available Elizabeth J Geller Division of Female Pelvic Medicine and Reconstructive Surgery, Department of Obstetrics and Gynecology, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA Abstract: Postoperative urinary retention (POUR is a frequent consequence of gynecologic surgery, especially with surgical correction of urinary incontinence and pelvic organ prolapse. Estimates of retention rates after pelvic surgery range from 2.5%–43%. While there is no standard definition for POUR, it is characterized by impaired bladder emptying, with an elevation in the volume of retained urine. The key to management of POUR is early identification. All patients undergoing pelvic surgery, especially for the correction of incontinence or prolapse, should have an assessment of voiding function prior to discharge. There are several ways to assess voiding function – the gold standard is by measuring a postvoid residual. Management of POUR is fairly straightforward. The goal is to decompress the bladder to avoid long-term damage to bladder integrity and function. The decision regarding when to discontinue catheter-assisted bladder drainage in the postoperative period can be assessed in an ongoing fashion by measurement of postvoid residual. The rate of prolonged POUR beyond 4 weeks is low, and therefore most retention can be expected to resolve spontaneously within 4–6 weeks. When POUR does not resolve spontaneously, more active management may be required. Techniques include urethral dilation, sling stretching, sling incision, partial sling resection, and urethrolysis. While some risk of POUR is inevitable, there are risk factors that are modifiable. Patients that are at higher risk – either due to the procedures being performed or their clinical risk factors – should be counseled regarding the risks and management options for POUR prior to their surgery. Although POUR is a serious condition that can have serious consequences if left untreated, it

Factors that influence exercise activity among women post hip fracture participating in the Exercise Plus Program

Directory of Open Access Journals (Sweden)

Barbara Resnick

2007-10-01

Full Text Available Barbara Resnick1, Denise Orwig2, Christopher D’Adamo2, Janet Yu-Yahiro3, William Hawkes2, Michelle Shardell2, Justine Golden2, Sheryl Zimmerman4, Jay Magaziner21University of Maryland School of Nursing, 655 West Lombard Street, Baltimore, MD,21201, USA; 2University of Maryland School of Medicine, Howard Hall, Redwood Street, Baltimore MD 21201, USA; 3Department of Orthopaedic Surgery, Union Memorial Hospital, Baltimore, USA; 4University of North Carolina Chapel Hill, 301 Pittsboro St., CB#3550, Chapel Hill, NC 27599-3550, USAAbstract: Using a social ecological model, this paper describes selected intra- and interpersonal factors that influence exercise behavior in women post hip fracture who participated in the Exercise Plus Program. Model testing of factors that influence exercise behavior at 2, 6 and 12 months post hip fracture was done. The full model hypothesized that demographic variables; cognitive, affective, physical and functional status; pain; fear of falling; social support for exercise, and exposure to the Exercise Plus Program would influence self-efficacy, outcome expectations, and stage of change both directly and indirectly influencing total time spent exercising. Two hundred and nine female hip fracture patients (age 81.0 ± 6.9, the majority of whom were Caucasian (97%, participated in this study. The three predictive models tested across the 12 month recovery trajectory suggest that somewhat different factors may influence exercise over the recovery period and the models explained 8 to 21% of the variance in time spent exercising. To optimize exercise activity post hip fracture, older adults should be helped to realistically assess their self-efficacy and outcome expectations related to exercise, health care providers and friends/peers should be encouraged to reinforce the positive benefits of exercise post hip fracture, and fear of falling should be addressed throughout the entire hip fracture recovery trajectory

Efficacy and safety of anakinra for the treatment of rheumatoid arthritis: an update of the Oregon Drug  Effectiveness Review Project

Directory of Open Access Journals (Sweden)

Kylie Thaler

2009-11-01

Full Text Available Kylie Thaler1, Divya V Chandiramani2, Richard A Hansen2, Gerald Gartlehner11Department for Evidence-based Medicine and Clinical Epidemiology, Danube University Krems, Krems, Austria; 2UNC Eshelman School of Pharmacy, University of North Carolina at Chapel Hill, Chapel Hill, NC, USAObjective: To systematically review the general and comparative efficacy and safety of anakinra for rheumatoid arthritis.Methods: We searched MEDLINE®, Embase, The Cochrane Library, and the International Pharmaceutical Abstracts from 1980 to April 2009. We manually searched reference lists of pertinent review articles and explored the Center for Drug Evaluation and Research database. For efficacy we included randomized controlled trials (RCTs comparing anakinra with placebo or other biologics. For safety both experimental and observational studies were eligible. Two persons independently reviewed abstracts and full text articles and extracted relevant data.Results: We included data from 3 RCTs comparing anakinra with placebo for rheumatoid arthritis (RA. The pooled relative risk (RR of an ACR50 (American College of Rheumatology response for anakinra compared with placebo is 2.28 (95% CI 1.41 to 3.67. Adjusted indirect comparisons of ACR50 response rates of anakinra and anti-TNF agents showed a RR of 0.67 (95% CI 0.38 to 1.17 favoring the anti-TNF drugs. This result did not reach statistical significance. For safety, we included 9 experimental and observational studies of 24 weeks to 3 years duration. Up to 30% of patients withdrew from the studies due to adverse events. 67.2% (95% CI 38.7 to 95.7 of patients experienced an injection site reaction.Conclusions: Anakinra is an effective drug for treating RA. Indirect comparisons with adalimumab, etanercept and infliximab, however, showed a trend towards greater efficacy for the anti-TNF drugs. Anakinra also seems to be associated with comparably high rates of injection site reactions. These results should be taken into

Developing a discrete choice experiment in Malawi: eliciting preferences for breast cancer early detection services

Directory of Open Access Journals (Sweden)

Kohler RE

2015-10-01

Full Text Available Racquel E Kohler,1 Clara N Lee,2 Satish Gopal,3 Bryce B Reeve,1 Bryan J Weiner,1 Stephanie B Wheeler11Department of Health Policy and Management, Gillings School of Global Public Health, 2Lineberger Comprehensive Cancer Center, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 3UNC Project-Malawi, Tidziwe Center, Lilongwe, MalawiBackground: In Malawi, routine breast cancer screening is not available and little is known about women’s preferences regarding early detection services. Discrete choice experiments are increasingly used to reveal preferences about new health services; however, selecting appropriate attributes that describe a new health service is imperative to ensure validity of the choice experiment.Objective: To identify important factors that are relevant to Malawian women’s preferences for breast cancer detection services and to select attributes and levels for a discrete choice experiment in a setting where both breast cancer early detection and choice experiments are rare.Methods: We reviewed the literature to establish an initial list of potential attributes and levels for a discrete choice experiment and conducted qualitative interviews with health workers and community women to explore relevant local factors affecting decisions to use cancer detection services. We tested the design through cognitive interviews and refined the levels, descriptions, and designs.Results: Themes that emerged from interviews provided critical information about breast cancer detection services, specifically, that breast cancer interventions should be integrated into other health services because asymptomatic screening may not be practical as an individual service. Based on participants’ responses, the final attributes of the choice experiment included travel time, health encounter, health worker type and sex, and breast cancer early detection strategy. Cognitive testing confirmed the acceptability of the final attributes

[Primary childhood vasculitis new classification criteria

DEFF Research Database (Denmark)

Herlin, T.; Nielsen, Susan

2008-01-01

Primary vasculitis is seen in both adults and children, but some of the diseases like Kawasaki disease occur primarily in children. The Chapel Hill Classification Criteria for primary vasculitis refers to the size of vessels but has not been validated in children. Recently, new criteria...

Primær vaskulitis i barnealderen - nye klassifikationskriterier

DEFF Research Database (Denmark)

Herlin, Troels; Nielsen, Susan

2008-01-01

Primary vasculitis is seen in both adults and children, but some of the diseases like Kawasaki disease occur primarily in children. The Chapel Hill Classification Criteria for primary vasculitis refers to the size of vessels but has not been validated in children. Recently, new criteria...

Detection of antibodies against Turkey astrovirus in humans.

Science.gov (United States)

Meliopoulos, Victoria A; Kayali, Ghazi; Burnham, Andrew; Oshansky, Christine M; Thomas, Paul G; Gray, Gregory C; Beck, Melinda A; Schultz-Cherry, Stacey

2014-01-01

Astroviruses are a leading cause of gastroenteritis in mammals and birds worldwide. Although historically thought to be species-specific, increasing evidence suggests that astroviruses may cross species barriers. In this report, we used enzyme-linked immunosorbent assays to screen sera from three distinct human cohorts involved in influenza studies in Memphis, TN or Chapel Hill, NC, and Midwestern poultry abattoir workers for antibodies to turkey astrovirus type 2 (TAstV-2). Surprisingly, 26% of one cohort's population was TAstV-2 positive as compared to 0 and 8.9% in the other cohorts. This cohort was composed of people with exposure to turkeys in the Midwestern United States including abattoir workers, turkey growers, and non-occupationally exposed participants. The odds of testing positive for antibodies against turkey astrovirus among abattoir workers were approximately 3 times higher than the other groups. These studies suggest that people with contact to turkeys can develop serological responses to turkey astrovirus. Further work is needed to determine if these exposures result in virus replication and/or clinical disease.

Detection of antibodies against Turkey astrovirus in humans.

Directory of Open Access Journals (Sweden)

Victoria A Meliopoulos

Full Text Available Astroviruses are a leading cause of gastroenteritis in mammals and birds worldwide. Although historically thought to be species-specific, increasing evidence suggests that astroviruses may cross species barriers. In this report, we used enzyme-linked immunosorbent assays to screen sera from three distinct human cohorts involved in influenza studies in Memphis, TN or Chapel Hill, NC, and Midwestern poultry abattoir workers for antibodies to turkey astrovirus type 2 (TAstV-2. Surprisingly, 26% of one cohort's population was TAstV-2 positive as compared to 0 and 8.9% in the other cohorts. This cohort was composed of people with exposure to turkeys in the Midwestern United States including abattoir workers, turkey growers, and non-occupationally exposed participants. The odds of testing positive for antibodies against turkey astrovirus among abattoir workers were approximately 3 times higher than the other groups. These studies suggest that people with contact to turkeys can develop serological responses to turkey astrovirus. Further work is needed to determine if these exposures result in virus replication and/or clinical disease.

PREGNANCY LOSS IN THE F344 RAT CAUSED BY BROMODICHLOROMETHANE: EFFECTS ON SERUM LUTEINIZING HORMONE LEVELS

Science.gov (United States)

PREGNANCY LOSS IN THE F344 RAT CAUSED BY BROMODICHLOROMETHANE: EFFECTS ON SERUM LUTEINIZING HORMONE LEVELS Bielmeier1, S.R., D.S. Best2, and M.G. Narotsky2; 1University of North Carolina at Chapel Hill, Curriculum in Toxicology, 2Reproductive Toxicology Division, U.S. Enviro...

Mariological paintings in the Chapel of Our Lady's Tomb in the Kalwaria Zebrzydowska compound. From studies on the reception of graphics in Polish 17th century painting

Directory of Open Access Journals (Sweden)

Janina Dzik

2008-12-01

Full Text Available The Chapel of Our Lady's Tomb in Brody, complete with valuable interior furnishing, in terms of history and territory belongs to the architectural landscape concept of the Marian- and Passion-themed compound in Kalwaria Zebrzydowska. In the fields of the late-Renaissance choir parapet and the galleries of the chapel there are a series of paintings showing hitherto unspecified Marian themes. The items have never been referred to in literature on Kalwaria or mentioned in guidebooks or maintenance records. The article analyses, in a broad context, the symbolism of 37 Marian scenes presenting Mary and symbolic objects (e.g. a heart, a building, a garden.

PRESENTED AT TRIANGLE CONSORTIUM FOR REPRODUCTIVE BIOLOGY MEETING IN CHAPEL HILL, NC ON 2/11/2006: SPERM COUNT DISTRIBUTIONS IN FERTILE MEN

Science.gov (United States)

Sperm concentration and count are often used as indicators of environmental impacts on male reproductive health. Existing clinical databases may be biased towards sub-fertile men with low sperm counts and less is known about expected sperm count distributions in cohorts of ferti...

Melanocortin and Opioid Peptide Interactions in the Modulation of Binge Alcohol Drinking

Science.gov (United States)

2013-04-01

Spain (June, 2010). Talk titled A Role for Central Neuropeptides in Binge Alcohol Drinking. 4. Departamento de Neurociencia y Ciencias de la Salud...Hill, Chapel Hill, North Carolina; Department of Neurociencia y Ciencias de la Salud (JML-C, FC, IC), University of Almerı́a, Almerı́a, Spain. Received...Low, 2008). From the Department of Neurociencia y Ciencias de la Salud (IC, FC, JML-C), University of Almerı́a, Almerı́a, Spain; and Department of

Pagan symbols associated with the female anatomy in the Medici Chapel by Michelangelo Buonarroti.

Science.gov (United States)

De Campos, Deivis; Oxley Da Rocha, Andrea; De Oliveira Lemos, Rodrigo; Malysz, Tais; Antonio Bonatto-Costa, João; Pereira Jotz, Geraldo; Pinto De Oliveira Junior, Lino; Da Costa Oliveira, Miriam

2017-07-01

Numerous studies have shown that many works of art from the Renaissance period contain hidden symbols and codes that could have religious, mathematical and/or pagan significance and even anatomical allusions. In this context, the present manuscript offers new evidence that the great genius of anatomy, Michelangelo Buonarroti (1475-1564), included pagan symbols associated with female anatomy in the funerary monuments found in the Sagrestia Nuova/Medici Chapel (1519-1533) in Florence, Italy. The interpretation of the symbols provided in this study will interest those with a passion for the history of anatomy. Clin. Anat. 30:572-577, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Marine Hydrokinetic Power Take-Off Using Magnetic Gearing

OpenAIRE

Bird, Jonathan Z.

2014-01-01

This paper reviews different power take-off approaches for rotary based marine hydrokinetic power generation. The technology for wind power generation is used as a guide. A discussion on the potential benefits of utilizing magnetic gearing is presented. University of North Carolina at Chapel Hill. Coastal Studies Institute

"Making Connections" at the University of North Carolina: Moving toward a Global Curriculum at a Flagship Research University

Science.gov (United States)

Smith, Jay M.; Kruse, Julia

2009-01-01

The University of North Carolina at Chapel Hill has reformed its undergraduate curriculum to create connections across disciplines and advance efforts to internationalize its campus. As a result, global issues, experiential learning, study abroad, and international course clusters have become an integral part of a curriculum that emphasizes…

Managing Knowledge Performance: Testing the Components of a Knowledge Management System on Organizational Performance

Science.gov (United States)

Cho, Taejun; Korte, Russell

2014-01-01

The main purpose of the current study is to validate the framework of knowledge management (KM) capabilities created by Gold ("Towards a theory of organizational knowledge management capabilities." Doctoral dissertation, University of North Carolina, Chapel Hill) 2001) in a study of South Korean companies. However, the original framework…

Current and Past Research on Autistic Children and Their Families. Conducted by Division TEACCH (Treatment and Education of Autistic and Related Communication Handicapped Children). TEACCH Research Report.

Science.gov (United States)

Schopler, Eric

This report summarizes research conducted by, or in collaboration with, the Division TEACCH (Treatment and Education of Autistic and related Communication handicapped CHildren) of the Department of Psychiatry in the University of North Carolina School of Medicine at Chapel Hill. The summaries contain bibliographic citations for published papers…

Guide to the NITRD Program FY 2004-FY 2005. Supplement to the President’s Budget for FY 2005

Science.gov (United States)

2004-12-01

and Professor University of California, Berkeley J. Carter Beese , Jr. President Riggs Capital Partners Pedro Celis, Ph.D. Software Architect Microsoft...University of North Carolina at Chapel Hill William J. Hannigan President AT&T Jonathan C. Javitt, M.D., M.P.H. Senior Fellow Potomac Institute for Policy

SEASONAL VARIATIONS IN AIR POLLUTION PARTICLE-INDUCED INFLAMMATORY MEDIATOR RELEASE AND OXIDATIVE STRESS

Science.gov (United States)

Normal human bronchial epithelial (NHBE) cells and alveolar macrophages (AMs) were exposed to equal mass of coarse [PM with aerodynamic diameter of 2.510 �m (PM2.510)], fine (PM2.5), and ultrafine (PM < 0.1) ambient PM from Chapel Hill, North Carolina, during October 2001 (f...

Information Needs and Bibliographic Problems of the Anthropology Departments at U. N. C. and Duke University.

Science.gov (United States)

Spurling, Norman Kent

Research was conducted on information needs and bibliographic problems of anthropologists at Duke University and the University of North Carolina at Chapel Hill. Sixty-four faculty members and graduate students were surveyed, and twenty faculty members were interviewed. Many areas of information retrieval problems and the different ways…

MICROTIA AND HEARING DEFICITS IN CD-1 MICE FOLLOWING GESTATIONAL EXPOSURE TO ETHANE DIMETHANESULFONATE (EDS)

Science.gov (United States)

TARKA1,2, D.K., G.R. KLINEFELTER1,2, D.W. HERR3, and J.M. ROGERS 1,2. 1University of North Carolina, School of Medicine, Curriculum in Toxicology, Chapel Hill, North Carolina; and USEPA, NHEERL, 2Reproductive Toxicology Division and 3Neurotoxicology Division, Research Triangle Pa...

27 CFR 9.214 - Haw River Valley.

Science.gov (United States)

2010-04-01

... significance. (b) Approved maps. The two United States Geological Survey 1:100,000-scale metric topographic...) Greensboro, North Carolina, 1984; and (2) Chapel Hill, North Carolina, 1984. (c) Boundary. The Haw River... line southeast 2 miles to the intersection of North Carolina State Highway 49 and an unnamed, light...

Factors influencing publication choice: why faculty choose open access.

Science.gov (United States)

Warlick, Stefanie E; Vaughan, Ktl

2007-03-09

In an attempt to identify motivating factors involved in decisions to publish in open access and open archives (OA) journals, individual interviews with biomedical faculty members at the University of North Carolina at Chapel Hill (UNC-Chapel Hill) and Duke University, two major research universities, were conducted. The interviews focused on faculty identified as early adopters of OA/free full-text publishing. Searches conducted in PubMed and PubMed Central identified faculty from the two institutions who have published works in OA/free full-text journals. The searches targeted authors with multiple OA citations during a specified 18 month period. Semi-structured interviews were conducted with the most prolific OA authors at each university. Individual interviews attempted to determine whether the authors were aware they published in OA journals, why they chose to publish in OA journals, what factors influenced their publishing decisions, and their general attitude towards OA publishing models. Fourteen interviews were granted and completed. Respondents included a fairly even mix of Assistant, Associate and Full professors. Results indicate that when targeting biomedical faculty at UNC-Chapel Hill and Duke, speed of publication and copyright retention are unlikely motivating factors or incentives for the promotion of OA publishing. In addition, author fees required by some open access journals are unlikely barriers or disincentives. It appears that publication quality is of utmost importance when choosing publication venues in general, while free access and visibility are specifically noted incentives for selection of OA journals. Therefore, free public availability and increased exposure may not be strong enough incentives for authors to choose open access over more traditional and respected subscription based publications, unless the quality issue is also addressed.

A conversão do sertão capelas e a governamentalidade nas Minas Gerais The conversion of the hinterland chapels and governamentalidade in the Minas Gerais

Directory of Open Access Journals (Sweden)

Francisco Eduardo de Andrade

2007-06-01

Full Text Available O artigo trata da instituição das capelas no território das Minas Gerais, considerando a sua significação política e a sua relação com o enquadramento social da população. Procura-se avaliar essa prática de poder, desde a fundação pelos patronos coloniais até o reconhecimento eclesiástico e régio. Observando-se os laços políticos na segunda metade do século XVIII, verifica-se ainda que as capelas, mecanismos de poder senhorial e de normalização dos súditos, tinham um papel fundamental na governamentalidade do Estado, especialmente nas fronteiras.This paper is concerned with the establishment of chapels in Minas Gerais, taking into account its political meaning and its relationship with the social fitting of the population. Power practices are evaluated, since foundations of the chapels by colonial sponsors to their ecclesiastical and royal admissions. Considering political bonds on the second half of the eighteen century, one verifies that chapels - a way of power of owners and subject regulation - had a fundamental role in the government, mainly at frontiers.

Mucosal versus muscle pain sensitivity in provoked vestibulodynia

Directory of Open Access Journals (Sweden)

Witzeman K

2015-08-01

Full Text Available Kathryn Witzeman,1 Ruby HN Nguyen,2 Alisa Eanes,3 Sawsan As-Sanie,4 Denniz Zolnoun51Department of Obstetrics and Gynecology, Denver Health Medical Center, Denver, CO, 2Division of Epidemiology and Community Health, University of Minnesota, Minneapolis, MN, 3Pelvic Pain Research Unit, Division of Advanced Laparoscopy and Pelvic Pain, Department of Obstetrics and Gynecology, University of North Carolina School of Medicine, Chapel Hill, NC, 4Department of Obstetrics and Gynecology, Division of Minimally Invasive Gynecologic Surgery, University of Michigan, Ann Arbor, MI, 5Department of Obstetrics and Gynecology and Center for Neurosensory Disorders, University of North Carolina, Chapel Hill, NC, USABackground: An estimated 8.3%–16% of women experience vulvovaginal discomfort during their lifetime. Frequently these patients report provoked pain on contact or with attempted intercourse, commonly referred to as provoked vestibulodynia (PVD. Despite the burden of this condition, little is known about its potential etiologies including pelvic floor muscular dysfunction and mucosal components. This knowledge would be beneficial in developing targeted therapies including physical therapy.Objective: To explore the relative contribution of mucosal versus muscle pain sensitivity on pain report from intercourse among women with PVD.Design: In this proof of concept study, 54 women with PVD underwent a structured examination assessing mucosal and pelvic muscle sensitivity.Methods: We examined three mucosal sites in the upper and lower vestibule. Patients were asked to rate their pain on cotton swab palpation of the mucosa using a 10-point visual analog scale. Muscle pain was assessed using transvaginal application of pressure on right and left puborectalis, and the perineal muscle complex. The Gracely pain scale (0–100 was used to assess the severity of pain with intercourse, with women rating the lowest, average, and highest pain levels; a 100 rating the

HydroHillChart – Francis module. Software used to Calculate the Hill Chart of the Francis Hydraulic Turbines

Directory of Open Access Journals (Sweden)

Dorian Nedelcu

2015-07-01

Full Text Available The paper presents the Hydro Hill Chart - Francis module application, used to calculate the hill chart of the Pelton, Francis and Kaplan hydraulic turbine models, by processing the data measured on the stand. After describing the interface and menu, the input data is graphically presented and the universal characteristic for measuring scenarios ao=const. and n11=const is calculated. Finally, the two calculated hill charts are compared through a graphical superimposition of the isolines.

Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

Science.gov (United States)

Das, Debajyoti; Kar, Debjit

2017-12-01

A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

27 CFR 9.190 - Red Hill Douglas County, Oregon.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Red Hill Douglas County... Areas § 9.190 Red Hill Douglas County, Oregon. (a) Name. The name of the viticultural area described in this section is “Red Hill Douglas County, Oregon”. For purposes of part 4 of this chapter, “Red Hill...

Children's knowledge about medicines

DEFF Research Database (Denmark)

Almarsdóttir, Anna B.; Zimmer, Catherine

1998-01-01

of the path analytic model analyzed. Children, aged 7 and 10 years, and their primary caregivers were interviewed during 1992 and 1993. Recruiting was done at summer camps in Chapel Hill, North Carolina and environs, resulting in a convenience sample of 101 children, all white and middle class. Ordinary least...

40 CFR 81.308 - Delaware.

Science.gov (United States)

2010-07-01

...: College Avenue, CONRAIL tracks, South Chapel Street and Chestnut Hill Road X Remainder of New Castle County X Kent County X Sussex County X Delaware—SO2 Designated area Does not meet primary standards Does... Kent County X Sussex County X Delaware—Carbon Monoxide Designated Area Designation Date 1 Type...

Early Learning Visual Impairment Services Training and Advancement (EL VISTA) Project: Leading the Way for a New Profession within a Profession

Science.gov (United States)

Landa-Vialard, Olaya; Ely, Mindy S.; Lartz, Maribeth Nelson

2018-01-01

The Frank Porter Graham (FPG) Child Development Institute, Early Intervention Training Center for Infants and Toddlers with Visual Impairments and Their Families, University of North Carolina at Chapel Hill, was a national project that developed resources with the goal of building the capacity of colleges and universities to prepare personnel to…

Non-leptonic kaon decays at large Nc

Science.gov (United States)

Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

2018-03-01

We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

How 4 Colleges Take on Veterans' Issues, in Research and Real Life

Science.gov (United States)

Sander, Libby

2012-01-01

This article features four colleges and how they take on veterans' issues in research and real life. These colleges are (1) Syracuse University; (2) Purdue University; (3) University of Southern California; and (4) University of North Carolina at Chapel Hill. Last year Syracuse established the Institute for Veterans and Military Families to focus…

Offering Distance Education in Health Informatics: The State of the Web Sites.

Science.gov (United States)

Lazinger, Susan; Handzel, Ruth

2003-01-01

Within the framework of a bi-national project, between the University of North Carolina at Chapel Hill and four Israeli universities, a prototype database of programs and courses in health informatics was implemented. Examined Web sites particularly for courses offered via distance education and discusses results of a content analysis. (Author/LRW)

A COMPARISON OF THE METABOLISM OF METHOXYRESORUFIN, ACETANILIDE AND CAFFIENE IN RAT AND HUMAN CYP1A2 SUPERSOMES AND THEIR INHIBITION BY 2, 3, 7, 8-TETRACHLORODIBENZO-P-DIOXIN (TCDD)

Science.gov (United States)

A COMPARISON OF THE METABOLISM OF METHOXYRESORUFIN, ACETANILIDE AND CAFFIENE IN RAT AND HUMAN CYP1A2 SUPERSOMES AND THEIR INHIBITION BY 2,3,7,8-TETRACHLORODIBENZO-P-DIOXIN (TCDD). DF Staskal1, DG Ross2, LS Birnbaum2 and MJ DeVito2 1Curriculum In Toxicology, UNC-CH, Chapel Hill ...

Do Parents and Clinicians Agree on Ratings of Autism-Related Behaviors at 12 Months of Age? A Study of Infants at High and Low Risk for ASD

Science.gov (United States)

Macari, Suzanne L.; Wu, Grace C.; Powell, Kelly K.; Fontenelle, Scuddy, IV; Macris, Deanna M.; Chawarska, Katarzyna

2018-01-01

Given the emphasis on early screening for ASD, it is crucial to examine the concordance between parent report and clinician observation of autism-related behaviors. Similar items were compared from the First Year Inventory (Baranek et al. "First-Year Inventory (FYI) 2.0." University of North Carolina, Chapel Hill, 2003), a parent…

TADS: Technical Assistance Development System.

Science.gov (United States)

Epting, Rosemary, Ed.

Described is the Technical Assistance Development System (TADS), a component of the Frank Porter Graham Child Development Center of the University of North Carolina at Chapel Hill which offers support services to preschool demonstration centers for handicapped children in the First Chance Network. Discussed are the four types of services offered:…

A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

Science.gov (United States)

Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

2015-01-30

Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

Les peintures murales de la chapelle du château de Montreuil-Bellay / The Murals of the Chapel of Montreuil-Bellay Castle

Directory of Open Access Journals (Sweden)

Samuel Gras

2015-05-01

Full Text Available The castle of Montreuil-Bellay was rebuilt by Guillaume d’Harcourt († 1487 and his wife Yolande de Laval († 1487. It contains in one of the chapels a rare testimony of murals dating from the last quarter of the fifteenth century in the Loire Valley, in France. Based on a widespread iconography, images however respond to specific expectations of the owners. Several complementary readings can be made in the representation of the six saints painted in the chapel. Individual devotions combine collective concerns of several members of the Harcourt and Laval families. Also, this short introduction on the murals also leads us to take a new look at the painter in charge of it. The artist, who was familiar with Flemish painting innovations during the fifteenth century. He probably can be identified with Coppin Delf. From an artistic standpoint, the murals of Montreuil-Bellay put on display an entanglement of different influences and iconographic sources. Indeed, they emphasize the extent and complexity in artistic transfers away from political divisions or distant geographical areas.

NC10 bacteria in marine oxygen minimum zones

DEFF Research Database (Denmark)

Padilla, Cory C; Bristow, Laura A; Sarode, Neha

2016-01-01

Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

Virtual NC machine model with integrated knowledge data

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2002-01-01

The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

Wanted: Low-Income High Achievers

Science.gov (United States)

Fischer, Karin

2007-01-01

This article deals with issues of community-college transfers of students from Alamance Community College to the University of North Carolina at Chapel Hill. This article discusses the involvement of the Jack Kent Cooke Foundation in the issue of community-college transfer. The Jack Kent Cooke Foundation, based in Lansdowne, Va., near Washington,…

Hanoi and the American War: Two International Histories

Directory of Open Access Journals (Sweden)

Geoffrey C. Stewart

2014-03-01

Full Text Available Pierre Asselin, Hanoi’s Road to the Vietnam War, 1954-1965. Berkeley: University of California Press, 2013. 319 pp. $55 (cloth Lien-Hang T. Nguyen, Hanoi’s War: An International History of the War for Peace in Vietnam. Chapel Hill: The University of North Carolina Press, 2012. 444 pp. $34.95 (cloth.

METABOLISM AND TISSUE DOSIMETRY OF PENTAVALENT AND TRIVALENT MONOMETHYLATED ARSENIC AFTER ORAL

Science.gov (United States)

METABOLISM AND TISSUE DOSIMETRY OF PENTAVALENT AND TRIVALENT MONOMETHYLATED ARSENIC AFTER ORAL ADMINISTRATION IN MICEM F Hughes1, V Devesa2, B M Adair1, M Styblo2, E M Kenyon1, and D J Thomas1. 1US EPA, ORD, NHEERL, ETD, Research Triangle Park, NC; 2UNC-CH, CEMALB, Chapel Hi...

HydroHillChart – Pelton module. Software used to Calculate the Hill Chart of the Pelton Hydraulic Turbines

OpenAIRE

Dorian Nedelcu; Adelina Bostan; Florin Peris-Bendu

2015-01-01

The paper presents the HydroHillChart - Pelton module application, used to calculate the hill chart of the Pelton hydraulic turbine models, by processing the data measured on the stand. In addition, the tools offered by the application such as: interface, menu, input data, numerical and graphical results, etc. are described.

The Role of Sanctuary in an Insurgency

Science.gov (United States)

2008-05-22

42 Gearoid O Tuathail, “De- Territorialised Threats and Global Dangers: Geopolitics and...Dictionary definition of “law,” http://www.merriam- webster.com/dictionary/law, accessed April 16, 2008. 44 Tuathail, “De- Territorialised Threats and...Chapel Hill: The University of North Carolina Press, 1994. Tuathail, Geroid O., “De- Territorialised Threats and Global Dangers: Geopolitics and Risk

Paper for Colloquium on "Teaching of Woman's History."

Science.gov (United States)

Schnorrenberg, Barbara

This paper is a report on a course to be offered by the author at the University of North Carolina, Chapel Hill entitled "Woman's History in the West." The author describes the difficulties she had in procuring information to present to her class. The course is outlined as follows: (1) the problems of studying woman's history; (2) the medieval…

Q&A: Lead Pipe on Professional Development

Directory of Open Access Journals (Sweden)

Editorial Board

2012-02-01

Full Text Available This week, In the Library with Lead Pipe fields professional development and career questions from library school students at the University of North Carolina at Chapel Hill. The questions they asked ranged from committee work to composing cover letters to conference attendance. Here is the complete list (so you can jump around if you like: [...

Science, art, and mistery in the statues and in the anatomical machines of the prince of sansevero: the masterpieces of the "Sansevero Chapel".

Science.gov (United States)

Della Monica, Matteo; Galzerano, Domenico; Di Michele, Sara; Acquaviva, Fabio; Gregorio, Giovanni; Lonardo, Fortunato; Sguazzo, Francesca; Scarano, Francesca; Lama, Diana; Scarano, Gioacchino

2013-11-01

During the 18th century in Naples, Raimondo di Sangro, Prince of Sansevero, completed works on the family chapel, the so-called "Cappella Sansevero." The chapel houses statues of extraordinary beauty and spectacularly detailed but also, in the basement, two human skeletons known as the "Anatomical Machines" ("Macchine Anatomiche"). These two skeletons, a man and a pregnant woman, are entirely surrounded by their circulatory systems, just as if these were suddenly fixed. Legend, believed as truth until few years ago, says that Prince Raimondo had prepared and injected an unknown embalming substance in the blood vessels of two of his servants convicting them to eternal fixity. Recent investigations have demonstrated that, while the bones are authentic, the blood vessels are actually extraordinary artifacts that also reproduce some congenital malformations. The dreadful aspect of these two skeletons appears to be in strident contrast with the classic beauty of the statues which glorify and celebrate the ideal of morphology. Conversely, the two Anatomical Machines, protagonists of legends and superstitions since centuries, represent a marvelous example of science mixed with art. © 2013 Wiley Periodicals, Inc.

Michelangelo Buonarroti: Restoration of the Frescoes on the Vaulted Ceiling and the Last Judgment in the Sistine Chapel

Directory of Open Access Journals (Sweden)

Gianluigi Colalucci

2017-07-01

Full Text Available The last restoration of Michelangelo’s frescoes in the Sistine Chapel was directed and conducted by the internal staff of the Vatican Museums, in the period from June 1980 to April 1994. The historical importance of this restoration is found in the recovery of the unexpected chromatic tones used by Michelangelo and hidden for centuries by the dust, black smoke and grease produced by candles and braziers, and by the animal glue, gum resin and ox bile used by restorers in the past to revive the colors. The important result was obtained without any risk, thanks to developments in the field of methods and materials, the progress made in diagnostics, and the elaboration of a theory of restoration (Brandi C. 1950 which still acts as a support to the scientific and technical guidelines used in restoration today. The good preservation of the frescoes in the Chapel is entrusted to a filter and air conditioning system which was renewed and upgraded in 2015, and to modern LED lighting installed in the same year. The cleaning of the frescoes, which were almost perfectly preserved thanks to Michelangelo’s technique, allowed us to study the artist’s painting technique and to learn that some of the techniques he employed in marble sculpting were applied to his painting, and that he introduced novel methods, such as the technique used to give three-dimensionality to figures or his particular brushstrokes, which anticipated divisionism and pointillism.

Confidence Hills Mineralogy and Chemin Results from Base of Mt. Sharp, Pahrump Hills, Gale Crater, Mars

Science.gov (United States)

Cavanagh, P. D.; Bish, D. L.; Blake, D. F.; Vaniman, D. T.; Morris, R. V.; Ming, D. W.; Rampe, E. B.; Achilles, C. N.; Chipera, S. J.; Treiman, A. H.;

The Bradford Hill considerations on causality: a counterfactual perspective

Directory of Open Access Journals (Sweden)

Höfler Michael

2005-11-01

Full Text Available Abstract Bradford Hill's considerations published in 1965 had an enormous influence on attempts to separate causal from non-causal explanations of observed associations. These considerations were often applied as a checklist of criteria, although they were by no means intended to be used in this way by Hill himself. Hill, however, avoided defining explicitly what he meant by "causal effect". This paper provides a fresh point of view on Hill's considerations from the perspective of counterfactual causality. I argue that counterfactual arguments strongly contribute to the question of when to apply the Hill considerations. Some of the considerations, however, involve many counterfactuals in a broader causal system, and their heuristic value decreases as the complexity of a system increases; the danger of misapplying them can be high. The impacts of these insights for study design and data analysis are discussed. The key analysis tool to assess the applicability of Hill's considerations is multiple bias modelling (Bayesian methods and Monte Carlo sensitivity analysis; these methods should be used much more frequently.

HydroHillChart – Pelton module. Software used to Calculate the Hill Chart of the Pelton Hydraulic Turbines

Directory of Open Access Journals (Sweden)

Dorian Nedelcu

2015-07-01

Full Text Available The paper presents the HydroHillChart - Pelton module application, used to calculate the hill chart of the Pelton hydraulic turbine models, by processing the data measured on the stand. In addition, the tools offered by the application such as: interface, menu, input data, numerical and graphical results, etc. are described.

The Camp Hill Project: Objectives and Design

Science.gov (United States)

Mattingly, John B.

1976-01-01

Available from: EC 090 474. Outlined are the problems and objectives of Pennsylvania's Camp Hill Project--a program designed to complete psychological needs assessments for juveniles incarcerated at Camp Hill, to develop project policies and guidelines in preparation for meeting with juvenile court judges, and to hire staff. (SBH)

The importance of preventive dental visits from a young age: systematic review and current perspectives

Directory of Open Access Journals (Sweden)

Bhaskar V

2014-03-01

Full Text Available Vaishnavi Bhaskar,1 Kathleen A McGraw,2 Kimon Divaris3 1Department of Health Policy and Management, Gillings School of Global Public Health, 2Health Sciences Library, 3Department of Pediatric Dentistry, School of Dentistry, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA Background: Dental caries, the most common childhood chronic disease, disproportionately affects vulnerable parts of the population and confers substantial impacts to children, families, and health systems. Because efforts directed toward oral health promotion and disease prevention are fundamentally superior to dental rehabilitation secondary to disease development, early preventive dental visits (EPDVs are widely advocated by professional and academic stakeholders. The aim of this comprehensive review was to critically review and summarize available evidence regarding the effectiveness of EPDVs in improving children's oral health outcomes. Materials and methods: A systematic literature search of the PubMed and Embase electronic databases was undertaken to identify peer-reviewed publications investigating the effectiveness of EPDVs on oral health outcomes, including clinical, behavioral, and cost end points up to October 30, 2013. Outcomes of the identified studies were abstracted and summarized independently by two investigators. Results: Four manuscripts met the inclusion criteria and were included in the review. All studies were conducted in the US and employed a retrospective cohort study design using public insurance-claims data, whereas one study matched claims files with kindergarten state dental surveillance data. That study found no benefit of EPDVs in future clinically determined dental caries levels in kindergarten. The other three studies found mixed support for an association of EPDVs with subsequent more preventive and fewer nonpreventive visits and lower nonpreventive service-related expenditures. Selection bias and a problem-driven dental care

After runaway: The trans-Hill stage of planetesimal growth

International Nuclear Information System (INIS)

Lithwick, Yoram

2014-01-01

When planetesimals begin to grow by coagulation, they first enter an epoch of runaway, during which the biggest bodies grow faster than all the others. The questions of how runaway ends and what comes next have not been answered satisfactorily. We show that runaway is followed by a new stage—the 'trans-Hill stage'—that commences when the bodies that dominate viscous stirring ('big bodies') become trans-Hill, i.e., when their Hill velocity matches the random speed of the small bodies they accrete. Subsequently, the small bodies' random speed grows in lockstep with the big bodies' sizes, such that the system remains in the trans-Hill state. Trans-Hill growth is crucial for determining the efficiency of growing big bodies, as well as their growth timescale and size spectrum. Trans-Hill growth has two sub-stages. In the earlier one, which occurs while the stirring bodies remain sufficiently small, the evolution is collisionless, i.e., collisional cooling among all bodies is irrelevant. The efficiency of forming big bodies in this collisionless sub-stage is very low, ∼10α << 1, where α ∼ 0.005(a/AU) –1 is the ratio between the physical size of a body and its Hill radius. Furthermore, the size spectrum is flat (equal mass per size decade, i.e., q = 4). This collisionless trans-Hill solution explains results from previous coagulation simulations for both the Kuiper Belt and the asteroid belt. The second trans-Hill sub-stage commences once the stirring bodies grow big enough (>α –1 × the size of the accreted small bodies). After that time, collisional cooling among small bodies controls the evolution. The efficiency of forming big bodies rises and the size spectrum becomes more top heavy. Trans-Hill growth can terminate in one of two ways, depending on the sizes of the small bodies. First, mutual accretion of big bodies can become significant and conglomeration proceeds until half of the total mass is converted into big bodies

Extent and reasons for nonadherence to antihypertensive, cholesterol, and diabetes medications: the association with depressive symptom burden in a sample of American veterans

Directory of Open Access Journals (Sweden)

Weidenbacher HJ

2015-02-01

Full Text Available Hollis J Weidenbacher,1 Christopher A Beadles,1,2 Matthew L Maciejewski,1,3 Bryce B Reeve,2 Corrine I Voils1,3 1Center for Health Services Research in Primary Care, Durham Veterans Affairs Medical Center, Durham, NC, USA; 2Department of Health Policy and Management, Gillings School of Global Public Health, University of North Carolina at Chapel Hill, NC, USA; 3Division of General Internal Medicine, Department of Medicine, Duke University Medical Center, Durham, NC, USA Objective: Persons with depressive symptoms generally have higher rates of medication nonadherence than persons without depressive symptoms. However, little is known about whether this association differs by comorbid medical condition or whether reasons for nonadherence differ by depressive symptoms or comorbid medical condition. Methods: Self-reported extent of nonadherence, reasons for nonadherence, and depressive symptoms among 1,026 veterans prescribed medications for hypertension, dyslipidemia, and/or type 2 diabetes were assessed. Results: In multivariable logistic regression adjusted for clinical and demographic factors, the odds of nonadherence were higher among participants with high depressive symptom burden for dyslipidemia (n=848; odds ratio [OR]: 1.42, P=0.03 but not hypertension (n=916; OR: 1.24, P=0.15, or type 2 diabetes (n=447; OR: 1.15, P=0.51. Among participants reporting nonadherence to antihypertensive and antilipemic medications, those with greater depressive symptom burden had greater odds of endorsing medication nonadherence reasons related to negative expectations and excessive economic burden. Neither extent of nonadherence nor reasons for nonadherence differed by depressive symptom burden among patients with diabetes. Conclusion: These findings suggest that clinicians may consider tailoring interventions to improve adherence to antihypertensive and antilipemic medications to specific medication concerns of participants with depressive symptoms

The Relationship Between Cognitive and Non-Cognitive Variables and Academic Performance of Students in the Science Enrichment Preparation (S.E.P.) Program

Science.gov (United States)

Borden, Paula D.

This dissertation study concerned the lack of underrepresented minority students matriculating through the health professions pipeline. The term pipeline is "the educational avenue by which one must travel to successfully enter a profession" (Sullivan Alliance, 2004). There are a significant number of health professional pipeline programs based across the United States and, for the purposes of this study, a focus was placed on the Science Enrichment Preparation (S.E.P.) Program which is based at The University of North Carolina at Chapel Hill. The S.E.P. Program, is an eight-week residential summer experience, designed to support underrepresented minority pre-health students develop the competitive edge for successful admission into health professional school programs. The bedrock of this dissertation study concerned itself with the relationships between cognitive variables and non-cognitive variables and academic performance of students in the S.E.P. Program from 2005-2013. The study was undertaken to provide a clearer understanding for the NC Health Careers Access Program's (NC-HCAP) leadership with regard to variables associated with the students' academic performance in the S.E.P. Program. The data outcomes were informative for NC-HCAP in identifying cognitive and non-cognitive variables associated with student academic performance. Additionally, these findings provided direction as to what infrastructures may be put into place to more effectively support the S.E.P. participants. It is the researcher's hope this study may serve as an educational model and resource to pipeline programs and others with similar educational missions. The consequences and implications of a non-diverse healthcare workforce are high and far reaching. Without parity representation in the healthcare workforce, health disparities between racial and economic groups will likely continue to grow.

Accounting for imperfect detection in Hill numbers for biodiversity studies

Science.gov (United States)

Broms, Kristin M.; Hooten, Mevin B.; Fitzpatrick, Ryan M.

2015-01-01

Hill numbers unify biodiversity metrics by combining several into one expression. For example, species richness, Shannon's diversity index and the Gini–Simpson index are a few of the most used diversity measures, and they can be expressed as Hill numbers. Traditionally, Hill numbers have been calculated from relative abundance data, but the expression has been modified to use incidence data as well. We demonstrate an approach for estimating Hill numbers using an occupancy modelling framework that accounts for imperfect detection.

A language for image processing HILLS and its supporting system SDIP

International Nuclear Information System (INIS)

Suzuki, H.; Toriwaki, J.

1984-01-01

This paper presents a language HILLS and its supporting system SDIP for image processing. HILLS is a key-word type language for describing image processing procedures by using subroutine packages SLIP and SPIDER. SDIP, written in FORTRAN to keep portability, supports programming by HILLS in interactive mode including functions such as editing, translating HILLS into FORTRAN, error detection, and providing manual information. Results of preliminary experiments suggest that HILLS and SDIP are very useful tools for beginners and researchers in application fields of image processing to develop desired image analysis procedures

The experience of the National Historical and Artistic Heritage Service in São Paulo: the restoration of the Santo Antônio ranch and chapel, 1940-1947

Directory of Open Access Journals (Sweden)

Cristiane Souza Gonçalves

2007-06-01

Full Text Available Among the pioneer examples of architectural heritage preservation works, the restoration of the Santo Antônio ranch and chapel, in São Roque, represents a significant case of the activities held by architect Luis Saia, while leading the São Paulo´s regional office of the federal organ then called National Historical and Artistic Heritage Service (Sphan in portuguese, from 1945 to 1975. The architectural set, which consisted of a 17th century house and chapel and the ruins of a 19th century building, was an impressive discovery which delighted Mario de Andrade by the end of the 1930´s. However its poor conservation condition demanded urgent repair to restore its physical integrity. It presented, then, to the architects of Sphan a bigger and more complex restoration and conservation challenge whose phases and results will be subject of analysis in the present article.

27 CFR 9.162 - Sta. Rita Hills.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Sta. Rita Hills. 9.162.... Rita Hills. (a) Name. The name of the viticultural area described in this section is “Sta. Rita Hills”. For purposes of part 4 of this chapter, “Sta. Rita Hills” is a term of viticultural significance. (b...

Biogeography of the Shimba Hills ecosystem herpetofauna in Kenya.

Science.gov (United States)

Malonza, Patrick K; Mulwa, David M; Nyamache, Joash O; Jones, Georgina

2018-03-18

The Shimba Hills ecosystem along the south coast of Kenya is a key East African biodiversity hotspot. Historically, it is biogeographically assignable to the East African coastal biome. We examined the current Shimba Hills herpetofauna and their zoogeographical affinities to the coastal forests and nearby Eastern Arc Mountains biodiversity hotspots. The key studied sites included the Shimba Hills National Reserve, forest reserves, Kaya forests, and adjacent private land. Data on herpetofaunal richness were obtained from recent field surveys, literature, and specimens held at the National Museums of Kenya, Herpetology Section Collection, Nairobi. The Makadara, Mwele, and Longo-Mwagandi forests within the Shimba Hills National Reserve hosted the highest number of unique and rare species. Generally, the forest reserves and Kaya forests were important refuges for forest-associated species. On private land, Mukurumudzi Dam riparian areas were the best amphibian habitat and were host to three IUCN (Red List) Endangered-EN amphibian species, namely, Boulengerula changamwensis, Hyperolius rubrovermiculatus, and Afrixalus sylvaticus, as well as one snake species Elapsoidea nigra. Using herpetofauna as zoogeographic indicators, the Shimba Hills were determined to be at a crossroads between the coastal forests (13 endemic species) and the Eastern Arc Mountains (seven endemic species). Most of the Eastern Arc Mountains endemic species were from recent records, and thus more are likely to be found in the future. This 'hybrid' species richness pattern is attributable to the hilly topography of the Shimba Hills and their proximity to the Indian Ocean. This has contributed to the Shimba Hills being the richest herpetofauna area in Kenya, with a total of 89 and 36 reptile and amphibian species, respectively. Because of its unique zoogeography, the Shimba Hills ecosystem is undoubtedly a key biodiversity area for conservation investment.

Audio-magnetotelluric (AMT) study to investigate the genesis of Mujil hill

Science.gov (United States)

Rahmania, Suryanto, Wiwit

2017-07-01

Gunung Mujil is an isolated hill located near Pondoworejo village, Kalibawang sub-district, Kulon Progo district, and Special Province of Yogyakarta. The hill is part of the eastern Kulon Progo mountain range extended relatively in the North-South direction. The lithology of the hill consists of andesite breccia and it's similar with the Old Andesite Formation that built the Kulon Progo Mountains. There are at least two hypothesis about the genesis and the formation mechanism of this hill, (1) it was formed by debris mass from Kulon Progo Mountains, and (2) ) it was formed by an intrusion. Our study intended to determine the subsurface resistivity below the hill and to relating those results to with the scenario of the genesis of the Mujil hill. We conducted Audio-magnetotellurics (AMT) measurements along two lines survey crossing the Mujil hill consisting of 20 measurements. Since the measurements are located near the villages, most of the data has a fair to bad quality and only one station yielded an excellent data. A 1D Forward modeling was then applied to find best-fit model of the AMT data. The results shows that the Mujil hill was built by debris mass of the Old Andesite Formation from Kulon Progo mountain which is represented by a lower resistivity value under the Mujil hill.

ncRNA consensus secondary structure derivation using grammar strings.

Science.gov (United States)

Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

2011-04-01

Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

Inherent and antigen-induced airway hyperreactivity in NC mice

Directory of Open Access Journals (Sweden)

Tetsuto Kobayashi

1999-01-01

Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

Hume, Mill, Hill, and the sui generis epidemiologic approach to causal inference.

Science.gov (United States)

Morabia, Alfredo

2013-11-15

The epidemiologic approach to causal inference (i.e., Hill's viewpoints) consists of evaluating potential causes from the following 2, noncumulative angles: 1) established results from comparative, observational, or experimental epidemiologic studies; and 2) reviews of nonepidemiologic evidence. It does not involve statements of statistical significance. The philosophical roots of Hill's viewpoints are unknown. Superficially, they seem to descend from the ideas of Hume and Mill. Hill's viewpoints, however, use a different kind of evidence and have different purposes than do Hume's rules or Mill's system of logic. In a nutshell, Hume ignores comparative evidence central to Hill's viewpoints. Mill's logic disqualifies as invalid nonexperimental evidence, which forms the bulk of epidemiologic findings reviewed from Hill's viewpoints. The approaches by Hume and Mill cannot corroborate successful implementations of Hill's viewpoints. Besides Hume and Mill, the epidemiologic literature is clueless about a plausible, pre-1965 philosophical origin of Hill's viewpoints. Thus, Hill's viewpoints may be philosophically novel, sui generis, still waiting to be validated and justified.

Weak Properties and Robustness of t-Hill Estimators

Czech Academy of Sciences Publication Activity Database

Jordanova, P.; Fabián, Zdeněk; Hermann, P.; Střelec, L.; Rivera, A.; Girard, S.; Torres, S.; Stehlík, M.

2016-01-01

Roč. 19, č. 4 (2016), s. 591-626 ISSN 1386-1999 Institutional support: RVO:67985807 Keywords : asymptotic properties of estimators * point estimation * t-Hill estimator * t-lgHill estimator Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.679, year: 2016

Factors affecting the pharmacokinetics and pharmacodynamics of PEGylated liposomal irinotecan (IHL-305 in patients with advanced solid tumors

Directory of Open Access Journals (Sweden)

Wu H

2015-02-01

Full Text Available Huali Wu,1 Jeffrey R Infante,2 Vicki L Keedy,3 Suzanne F Jones,2 Emily Chan,3 Johanna C Bendell,2 Wooin Lee,4 Whitney P Kirschbrown,1 Beth A Zamboni,5 Satoshi Ikeda,6 Hiroshi Kodaira,6 Mace L Rothenberg,3 Howard A Burris III,2 William C Zamboni1,7–9 1UNC Eshelman School of Pharmacy, University of North Carolina, Chapel Hill, NC, 2Sarah Cannon Research Institute/Tennessee Oncology, PLLC, 3Vanderbilt University, Nashville, TN, 4Department of Pharmaceutical Sciences, College of Pharmacy, University of Kentucky, Lexington, KY, 5Department of Mathematics, Carlow University, Pittsburgh, PA, USA; 6Yakult Honsha Co., Ltd., Medical Development Department, Tokyo, Japan; 7UNC Lineberger Comprehensive Cancer Center, 8UNC Institute for Pharmacogenomics and Individualized Therapy, 9Carolina Center for Cancer Nanotechology Excellence, University of North Carolina, Chapel Hill, NC, USA Abstract: IHL-305 is a PEGylated liposomal formulation of irinotecan (CPT-11. The objective of this study was to evaluate the factors associated with interpatient variability in the pharmacokinetics and pharmacodynamics of IHL-305 in patients with advanced solid tumors. IHL-305 was administered intravenously once every 4 weeks as part of a Phase I study. Pharmacokinetic studies of the liposomal sum total CPT-11, released CPT-11, SN-38, SN-38G, 7-ethyl-10-[4-N-(5-aminopentanoic acid-1-piperidino]-carbonyloxycamptothecin, and 7-ethyl-10-[4-amino-1-piperidino]-carbonyloxycamptothecin in plasma were performed. Noncompartmental and compartmental pharmacokinetic analyses were conducted using pharmacokinetic data for sum total CPT-11. The pharmacokinetic variability of IHL-305 is associated with linear and nonlinear clearance. Patients whose age and body composition (ratio of total body weight to ideal body weight [TBW/IBW] were greater than the median age and TBW/IBW of the study had a 1.7-fold to 2.6-fold higher ratio of released CPT-11 area under the concentration versus time

Non-destructive EDXRF-analysis of the golden haloes of Giotto's frescos in the Chapel of the Scrovegni in Padua

International Nuclear Information System (INIS)

Cesareo, Roberto

2003-01-01

The famous frescos by Giotto in the 'Chapel of the Scrovegni in Padua' were systematically analysed in more than 300 points with various types of portable equipments based on energy dispersive X-ray fluorescence. A large number of golden haloes in particular were analysed, several black haloes where a golden leaf had come off, as well as several black haloes with no gold. From the measurements it could be deduced that the golden leaf is composed of pure gold, with a mean thickness of about 1.6 μm

The man and the hill

Science.gov (United States)

Leopold, Luna Bergere

1962-01-01

He was sitting on a large slab of rock. As he looked at the cloud of dust hanging hazily on the horizon, the piece of antler and the block of flint he held in his hand hung as if they were suspended from their previous rapid motion. The man gazed intently across the swaying grass which rose in wave-like billows across the distant hills. What was that dust - a herd of buffalo, a band of hunters, or were coyotes chasing the antelope again? After watching for a while he started again to chip the flint with a rapid twisting motion of the bone in his right hand. The little chips of flint fell in the grass before him. It is the same hill but the scene has changed. Seated on the same rock, holding the reins of a saddle horse, a man dressed in buckskin took the fur cap off his head and wiped his brow. He was looking intently across a brown and desolate landscape at a cloud of dust on the far horizon. Was it the hostile tribe of Indians? It could be buffalo. Nervously he kicked at the ground with the deerhide moccasin, pushing the flint chips out of the way. He wiped the dust from his long rifle. What a terrible place - no water, practically no grass, everything bare and brown. Now at sunset, slanting across the hills green with springtime, a cowman sits on a big rock, pushes his sombrero back on his head, and looks across the valley at a large but quiet herd of stock, moving slowly as each steer walks from one lush patch of grass to another, nibbling. Suddenly he stood up. Far on the horizon some dark objects were moving. Is it the sheepmen? Could it be the stage coach from Baggs to the Sweetwater Crossing?Same hill - a gray truck was grinding slowly toward the summit. It pulled up near a small fenced enclosure where there were some instruments painted a bright silver color. A man stepped out of the truck and turned to his younger companion, "You've never found an arrowhead? Maybe you have never thought about it correctly. If you want to find where an Indian camped long

Improving Earth Science Metadata: Modernizing ncISO

Science.gov (United States)

O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

2016-12-01

ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

Explorations of the extended ncKP hierarchy

International Nuclear Information System (INIS)

Dimakis, Aristophanes; Mueller-Hoissen, Folkert

2004-01-01

A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

Penyelesaian Masalah 8-Puzzle dengan Algoritma Steepest-Ascent Hill Climbing

Directory of Open Access Journals (Sweden)

David Abraham

2016-03-01

Full Text Available 8 puzzle merupakan salah satu implementasi dari Artificial Intelegence. Dalam proses penyelesaiannya banyak terdapat algoritma-algoritma pencarian yang dapat diterapkan. Solusi 8 puzzle akan lebih cepat diperoleh jika digunakan prinsip array dengan variasi algoritma Steepest-Ascent Hill Climbing (Hill Climbing dengan memilih kemiringan yang paling tajam / curam dengan parameter heuristik posisi yang benar dan heuristik jarak serta dikombinasikan dengan LogList sebagai penyimpanan state state yang pernah dilalui untuk menanggulangi permasalah pada algoritma hill climbing itu sendiri dan terhindar dari looping state yang pernah dilalui. Metode-metode yang termasuk ke dalam teknik pencarian yang berdasarkan pada fungsi heuristik salah satu diantaranya adalah Hill Climbing, Best First Search, A* (A Bintang. Loglist merupakan tempat penyimpanan setiap kunjungan dari state-state puzzle yang telah dilakukan untuk menghindari looping atau pengulangan terhadap state yang pernah dilalui. Untuk menanggulangi permasalahan pada SteepestAscent Hill Climbing.

Newtonian and pseudo-Newtonian Hill problem

International Nuclear Information System (INIS)

Steklain, A.F.; Letelier, P.S.

2006-01-01

A pseudo-Newtonian Hill problem based on the Paczynski-Wiita pseudo-Newtonian potential that reproduces general relativistic effects is presented and compared with the usual Newtonian Hill problem. Poincare maps, Lyapunov exponents and fractal escape techniques are employed to study bounded and unbounded orbits. In particular we consider the systems composed by Sun, Earth and Moon and composed by the Milky Way, the M2 cluster and a star. We find that some pseudo-Newtonian systems-including the M2 system-are more stable than their Newtonian equivalent

The Institute for Sustained Performance, Energy, and Resilience, University of North Carolina, Final Technical Report

Energy Technology Data Exchange (ETDEWEB)

Fowler, Robert [Univ. of North Carolina, Chapel Hill, NC (United States)

2018-01-20

This is the final report for the UNC component of the SciDAD Institute for Sustained Performance, Energy, and Resilience. In this report, we describe activities on the SUPER project at RENCI at the University of North Carolina at Chapel Hill. While we focus particularly on UNC, we touch on project-wide activities as well as, on interactions with, and impacts on, other projects.

Spectral parameter power series representation for Hill's discriminant

International Nuclear Information System (INIS)

Khmelnytskaya, K.V.; Rosu, H.C.

2010-01-01

We establish a series representation of the Hill discriminant based on the spectral parameter power series (SPPS) recently introduced by Kravchenko. We also show the invariance of the Hill discriminant under a Darboux transformation and employing the Mathieu case the feasibility of this type of series for numerical calculations of the eigenspectrum.

Plants profile of Malakand Pass Hills, District Malakand, Pakistan

African Journals Online (AJOL)

use

2011-11-21

Nov 21, 2011 ... famous Malakand fort guards the road on both sides of the pass. Malakand is a ... Underneath Malakand Hills, the waters of the River Swat ... southern sloping faces of the hills. They speak ...... Pinus roxburghii Sarg. Antidote ...

77 FR 27742 - Notice of Public Meetings for the Draft Environmental Impact Statement/Overseas Environmental...

Science.gov (United States)

2012-05-11

..., VA; 5. June 12, 2012 (Tuesday) at Hampton Inn and Suites Swansboro, 215 Old Hammock Road, Swansboro... 32202. 14. Kill Devil Hills Branch Library, Main Library, 400 Mustian Street, Kill Devil Hills, NC 27948...

Experimental investigation of flow over two-dimensional multiple hill models.

Science.gov (United States)

Li, Qing'an; Maeda, Takao; Kamada, Yasunari; Yamada, Keisuke

2017-12-31

The aim of this study is to investigate the flow field characteristics in ABL (Atmospheric Boundary Layer) flow over multiple hills and valleys in two-dimensional models under neutral conditions. Active turbulence grids and boundary layer generation frame were used to simulate the natural winds in wind tunnel experiments. As a result, the mean wind velocity, the velocity vector diagram and turbulence intensity around the hills were investigated by using a PIV (Particle Image Velocimetry) system. From the measurement results, it was known that the average velocity was increased along the upstream slope of upside hill, and then separated at the top of the hills, the acceleration region of U/U ref >1 was generated at the downstream of the hill. Meanwhile, a large clockwise circulation flow was generated between the two hill models. Moreover, the turbulence intensity showed small value in the circulation flow regions. Compared to 1H model, the turbulence intensity in the mainstream direction showed larger value than that in the vertical direction. This paper provided a better understanding of the wind energy distribution on the terrain for proper selection of suitable sites for installing wind farms in the ABL. Copyright © 2017 Elsevier B.V. All rights reserved.

Phosphorus forms in soils of Oban Hills, Akamkpa, Cross River State ...

African Journals Online (AJOL)

Oban Hills is located at Akamkpa in the Southern Senatorial District of Cross River, State, Nigeria. Phosphorus (P)-rich soil from the Hills is expected to have an effect on retention and distribution in the highly acidic soils surrounding the area inundated for several years. Phosphorus forms in the soils of the Hills varied with ...

Photovoltaics - 10 years after Cherry Hill

Science.gov (United States)

Ralph, E. L.

The status of R&D programs connected with photovoltaic (PV) systems 10 years after the Cherry Hill workshop on 'Photovoltaic Conversion of Solar Energy for Terrestrial Applications' is assessed. The five categories of research recommended by the Cherry Hill Workshop are listed in a table together with their recommended research budget allocations. The workshop categories include: single-crystal Si cells; poly-Si cells; systems and diagnostics. Categories for thin film CdS/Cu2S and CuInSe2 cells are also included. The roles of government and private utility companies in providing adequate financial support for PV research programs is emphasized.

Brick durability and conservation treatment (Santa María de Jesús chapel portal, Seville, Spain

Directory of Open Access Journals (Sweden)

Villegas, R.

2009-03-01

Full Text Available Durability differences of 2 types of brick from Santa María de Jesús Chapel (Sevilla and 2 treatments for its restoration have been studied. They have been characterizad using XRD and SEM, as well as their physical, hydric and mechanical properties. Samples prepared with bricks from the chapel have been submitted to salt crystallization test, to identify decay causes and mechanisms.The red brick present the lowest firing temperature, lower porosity and a great proportion of micropores. Physical and mechanical properties don’t change significantly with the treatments, only hygric properties vary with the water repellent. The accelerated aging test revealed significant improvement in the behaviour of yellow brick, but no change in the decay mechanism of red brick (Typical of microporous materials or its durability is observed.Se ha estudiado la alteración diferencial de los 2 tipos de ladrillo de la iglesia de Santa María de Jesús (Sevilla y 2 tratamientos para su restauración. Se han caracterizado por DRX y SEM, así como sus propiedades físicas, hídricas y mecánicas. Probetas preparadas de ladrillos de la iglesia se han sometido a ensayo de cristalización de sales para determinar las causas y los mecanismos de alteración.El ladrillo rojo es el que presenta menor temperatura de cocción, menor porosidad y mayor proporción de microporos. Las propiedades físicas y mecánicas de ambos ladrillos no varían significativamente con los tratamientos, sólo las propiedades hídricas cambian con el hidrófugo. En el ensayo de alteración mejora mucho el comportamiento del ladrillo amarillo, mientras que en el rojo no varía la morfología de alteración (características de materiales con microporos ni la durabilidad.

78 FR 73187 - Black Hills National Forest Advisory Board

Science.gov (United States)

2013-12-05

... DEPARTMENT OF AGRICULTURE Forest Service Black Hills National Forest Advisory Board AGENCY: Forest Service, USDA. ACTION: Notice of meeting. SUMMARY: The Black Hills National Forest Advisory Board (Board... all members of the Advisory Board; (2) provide orientation to Board Members on Basic Laws governing...

Funny hills in pion spectra from heavy-ion collisions

International Nuclear Information System (INIS)

Rasmussen, J.O.

1982-03-01

A discussion of some of the systematic features of the pion spectra in heavy-ions reactions is given. A discussion of the hills and valleys in heavy ion pion spectra that show up at the lower pion energies is given. The following topics are discussed: (1) three kinds of funny hills; (2) π - / + ratios near center of mass; (3) new Monte Carlo studies of charged pion spectra; and (4) pion orbiting about fireballs and Bose-Einstein behavior as explanation for the mid-rapidity P/sub perpendicular to/ approx. = 0.4 to 0.5 m/sub π/c hill

An overview on STEP-NC compliant controller development

Science.gov (United States)

Othman, M. A.; Minhat, M.; Jamaludin, Z.

2017-10-01

The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

78 FR 72009 - Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-12-02

...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

Air Quality and Heart Health: An Emerging Topic for Heart ...

Science.gov (United States)

Air Quality and Heart Health: An Emerging Topic for Heart Month: Ambient air particle pollution increases short- and long-term cardiovascular morbidity and mortality. Older-people, those with pre-existing heart disease and lung disease and diabetes are at higher risk. Mechanisms are under investigation and are likely related to oxidative stress, inflammation and effects on autonomic control. Improvements in air pollution levels reduce health impacts and increase life expectancy. Reductions of short-term exposure in those at highest risk are predicted to mitigate adverse health effects. EPA regularly evaluates the standards, health risks and issues improved standards when needed. Public health action is needed along with EPA standards to reduce the public health burden of short- and long-term adverse health effects of air pollution. Health risks remain and need to be addressed through integrated efforts of public health, health care, environmental health, individuals and communities. Presented at Webinar for the National Association of Clean Air Agencies, February 2, 2017, Chapel Hill, NC- This webinar provided an update of environmental health information related to the effects of air pollution and heart and blood vessel disease. Such information is critically important for the Clean Air Agencies to understand as it provides the justification of their actions.

Cyber Security: A Crisis of Prioritization

Science.gov (United States)

2005-02-01

Society (CITRIS) and Professor University of California, Berkeley J. Carter Beese , Jr. President Riggs Capital Partners Pedro Celis, Ph.D. Software...Science University of North Carolina at Chapel Hill William J. Hannigan President AT&T Jonathan C. Javitt, M.D., M.P.H. Senior Fellow Potomac Institute...CHAIR F. Thomson Leighton MEMBERS J. Carter Beese , Jr. Patricia Thomas Evans Luis E. Fiallo Harold Mortazavian David A. Patterson Alice G

Advanced Technology for Portable Personal Visualization

Science.gov (United States)

1991-12-01

Tracker to make design decisions, and another using the Virtus WalkThrough modelling program to carry them out. • Add real-time, interactive radiosity ...with radiosity illumination, lights that can be switched on or off with only 100 msec delays, textured surfaces, and near- real-time display from...Graphics. [Varshney9l] Varshney, Amitabh. "Parallel Radiosity Techniques for Mesh-Connected SIMD Computers," University of North Carolina at Chapel Hill

EMG activities and plantar pressures during ski jumping take-off on three different sized hills.

Science.gov (United States)

Virmavirta, M; Perttunen, J; Komi, P V

2001-04-01

Different profiles of ski jumping hills have been assumed to make the initiation of take-off difficult especially when moving from one hill to another. Neuromuscular adaptation of ski jumpers to the different jumping hills was examined by measuring muscle activation and plantar pressure of the primary take-off muscles on three different sized hills. Two young ski jumpers volunteered as subjects and they performed several trials from each hill (K-35 m, K-65 m and K-90 m) with the same electromyographic (EMG) electrode and insole pressure transducer set-up. The results showed that the differences in plantar pressure and EMGs between the jumping hills were smaller than expected for both jumpers. The small changes in EMG amplitudes between the hills support the assumption that the take-off was performed with the same intensity on different jumping hills and the timing of the gluteus EMG demonstrates well the similarity of the muscle activation on different hills. On the basis of the results obtained it seems that ski jumping training on small hills does not disturb the movement patterns for bigger hills and can also be helpful for special take-off training with low speed.

78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

Science.gov (United States)

2013-04-24

... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

Software module for geometric product modeling and NC tool path generation

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2003-01-01

The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

Science.gov (United States)

Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

2018-03-01

Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

Hill, Prof. Archibald Vivian

Indian Academy of Sciences (India)

Home; Fellowship. Fellow Profile. Elected: 1935 Honorary. Hill, Prof. Archibald Vivian Nobel Laureate (Medicine) - 1922. Date of birth: 26 September 1886. Date of death: 3 June 1977. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

The montane forest associated amphibian species of the Taita Hills ...

African Journals Online (AJOL)

The montane forest associated amphibian species of the Taita Hills, Kenya. ... They are surrounded by the dry Tsavo plains. ... The biodiversity importance of the Taita Hills lies with the number of endemics per unit of area of remaining forest, ...

Studies of nuclear processes. Progress report, June 1, 1975--May 31, 1976

International Nuclear Information System (INIS)

Cleqq, T.B.; Ludwig, E.J.; Merzbacher, E.; Shafroth, S.M.; Thompson, W.J.

1976-01-01

The UNC Chapel Hill group, affiliated with the Triangle Universities Nuclear Laboratory (TUNL), has emphasized in its recent research the following topics: nuclear interactions induced by polarized beams of protons and deuterons; developments in equipment and techniques for the measurement and interpretation of these interactions; the design and analysis of nuclear and atomic scattering experiments for protons, deuterons and heavier projectiles; the theory of ion-atom collisions; atomic effects in nuclear bombardment. The particle beams used were obtained primarily from the TUNL Cyclo-Graaff, the FN-tandem Van de Graaff and Lamb-shift polarized-ion source, and the 4-MeV Van de Graaff accelerators. Computations were performed using the computers at TUNL, at the Triangle Universities Computation Center, and at UNC, Chapel Hill. Collaborative experiments were undertaken primarily with the research groups from Duke University and North Carolina State University. Extensive participation of our graduate students in all aspects of the research has assured them a broad training in the fundamental and technical aspects of physics. Our research efforts have produced a deeper understanding of the spin dependence of nuclear interactions through measurements with polarized beams. Inner-shell ionization phenomena have been revealed in our detailed experimental and theoretical studies of atomic effects in nuclear bombardment

Are hills like white elephants?

Directory of Open Access Journals (Sweden)

Sunil Sharma

2016-11-01

Full Text Available 'Are Hills Like White Elephants?' is, of course, inspired by Hemingway; the tribute reflects on the abiding relevance of serious art in a changed world and extends the boundaries of his message to other human situations.

Efficacy and safety of talimogene laherparepvec versus granulocyte-macrophage colony-stimulating factor in patients with stage IIIB/C and IVM1a melanoma: subanalysis of the Phase III OPTiM trial

Directory of Open Access Journals (Sweden)

Harrington KJ

2016-11-01

Full Text Available Kevin J Harrington,1 Robert HI Andtbacka,2 Frances Collichio,3 Gerald Downey,4 Lisa Chen,5 Zsolt Szabo,6 Howard L Kaufman7 1The Institute of Cancer Research/The Royal Marsden Hospital NIHR Biomedical Research Centre, London, UK; 2Huntsman Cancer Institute, University of Utah, Salt Lake City, UT, USA; 3Division of Hematology and Oncology, The University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 4Amgen Ltd, Cambridge, UK; 5Amgen Inc, Thousand Oaks, CA, USA; 6Amgen GmbH, Zug, Switzerland; 7Rutgers Cancer Institute of New Jersey, New Brunswick, NJ, USA Objectives: Talimogene laherparepvec is the first oncolytic immunotherapy to receive approval in Europe, the USA and Australia. In the randomized, open-label Phase III OPTiM trial (NCT00769704, talimogene laherparepvec significantly improved durable response rate (DRR versus granulocyte-macrophage colony-stimulating factor (GM-CSF in 436 patients with unresectable stage IIIB–IVM1c melanoma. The median overall survival (OS was longer versus GM-CSF in patients with earlier-stage melanoma (IIIB–IVM1a. Here, we report a detailed subgroup analysis of the OPTiM study in patients with IIIB–IVM1a disease. Patients and methods: The patients were randomized (2:1 ratio to intralesional talimogene laherparepvec or subcutaneous GM-CSF and were evaluated for DRR, overall response rate (ORR, OS, safety, benefit–risk and numbers needed to treat. Descriptive statistics were used for subgroup comparisons. Results: Among 249 evaluated patients with stage IIIB–IVM1a melanoma, DRR was higher with talimogene laherparepvec compared with GM-CSF (25.2% versus 1.2%; P<0.0001. ORR was also higher in the talimogene laherparepvec arm (40.5% versus 2.3%; P<0.0001, and 27 patients in the talimogene laherparepvec arm had a complete response, compared with none in GM-CSF-treated patients. The incidence rates of exposure-adjusted adverse events (AE and serious AEs were similar with both treatments. Conclusion

What puts heart failure patients at risk for poor medication adherence?

Directory of Open Access Journals (Sweden)

Knafl GJ

2014-07-01

Full Text Available George J Knafl,1 Barbara Riegel2,31School of Nursing, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 2School of Nursing, University of Pennsylvania, Philadelphia, PA, USA; 3Leonard Davis Institute, University of Pennsylvania, Philadelphia, PA, USABackground: Medication nonadherence is a major cause of hospitalization in patients with heart failure (HF, which contributes enormously to health care costs. We previously found, using the World Health Organization adherence dimensions, that condition and patient level factors predicted nonadherence in HF. In this study, we assessed a wider variety of condition and patient factors and interactions to improve our ability to identify those at risk for hospitalization. Materials and methods: Medication adherence was measured electronically over the course of 6 months, using the Medication Event Monitoring System (MEMS. A total of 242 HF patients completed the study, and usable MEMS data were available for 218 (90.1%. Participants were primarily white (68.3%, male (64.2%, and retired (44.5%. Education ranged from 8–29 years (mean, 14.0 years; standard deviation, 2.9 years. Ages ranged from 30–89 years (mean, 62.8 years; standard deviation, 11.6 years. Analyses used adaptive methods based on heuristic searches controlled by cross-validation scores. First, individual patient adherence patterns over time were used to categorize patients in poor versus better adherence types. Then, risk factors for poor adherence were identified. Finally, an effective model for predicting poor adherence was identified based on identified risk factors and possible pairwise interactions between them. Results: A total of 63 (28.9% patients had poor adherence. Three interaction risk factors for poor adherence were identified: a higher number of comorbid conditions with a higher total number of daily medicines, older age with poorer global sleep quality, and fewer months since diagnosis of HF with poorer

A novel paradigm to evaluate conditioned pain modulation in fibromyalgia

Directory of Open Access Journals (Sweden)

Schoen CJ

2016-09-01

Full Text Available Cynthia J Schoen,1,* Jacob N Ablin,2,* Eric Ichesco,1 Rupal J Bhavsar,3 Laura Kochlefl,1 Richard E Harris,1 Daniel J Clauw,1 Richard H Gracely,4 Steven E Harte1 1Department of Anesthesiology, Chronic Pain and Fatigue Research Center, University of Michigan, Ann Arbor, MI, USA; 2Institute of Rheumatology, Tel Aviv Suorasky Medical Center, and Sackler Faculty of Medicine, Tel Aviv University, Tel Aviv, Israel; 3Department of Neurology, University of Pennsylvania, Philadelphia, PA, 4Department of Endodontics, University of North Carolina – Chapel Hill, Chapel Hill, NC, USA *These authors contributed equally to this work Introduction: Application of noxious stimulation to one body area reduces pain sensitivity in a remote body area through activation of an endogenous pain-inhibitory network, a behavioral phenomenon referred to as conditioned pain modulation (CPM. The efficiency of CPM is predictive of a variety of health outcomes, while impaired CPM has been associated with various chronic pain conditions. Current methods used to assess CPM vary widely, and interest in CPM method development remains strong. Here, we evaluated a novel method for assessing CPM in healthy controls and fibromyalgia (FM patients using thumb pressure as both a test and conditioning stimulus.Methods: Sixteen female FM patients and 14 matched healthy controls underwent CPM testing with thumbnail pressure as the test stimulus, and either cold water or noxious pressure as the conditioning stimulus. CPM magnitude was evaluated as the difference in pain rating of the test stimulus applied before and during the conditioning stimulus.Results: In healthy controls, application of either pressure or cold water conditioning stimulation induced CPM as evidenced by a significant reduction in test stimulus pain rating during conditioning (P=0.007 and P=0.021, respectively. In contrast, in FM patients, neither conditioning stimulus induced a significant CPM effect P-values >0

Late Devonian spermatophyte diversity and paleoecology at Red Hill, north-central Pennsylvania, USA

Energy Technology Data Exchange (ETDEWEB)

Cressler, Walter L. III. [Francis Harvey Green Library, 29 West Rosedale Avenue, West Chester University, West Chester, PA, 19383 (United States); Prestianni, Cyrille [Universite de Liege, Boulevard du Rectorat B18, Liege 4000 (Belgium); LePage, Ben A. [The Academy of Natural Sciences, 1900 Benjamin Franklin Parkway, Philadelphia, PA, 19103 and PECO Energy Company, 2301 Market Avenue, S9-1, Philadelphia, PA 19103 (United States)

2010-08-01

Early spermatophytes have been discovered at Red Hill, a Late Devonian (Famennian) fossil locality in north-central Pennsylvania, USA. The Red Hill locality contains an Archaeopteris-dominated flora within an outcrop of the Duncannon Member of the Catskill Formation. Palynological analyses of the plant fossil-bearing horizons within the Red Hill outcrop indicate deposition within the VCo palynozone. This is the earliest time horizon known to contain evidence for spermatophytes, and is contemporaneous with well-known spermatophyte-bearing deposits in West Virginia and Belgium. Some of the spermatophyte material from Red Hill compares well with Aglosperma sp., previously known as isolated ovules from the latest Devonian of South Wales and England, thus extending its geographic and stratigraphic range. Red Hill specimens of Aglosperma sp. occur both as isolated ovules and attached to dichotomously forking axes. Additional spermatophyte cupules discovered at Red Hill are morphologically similar to those of the previously described Late Devonian spermatophytes Elkinsia Rothwell, Scheckler, et Gillespie, Moresnetia Stockmans, and Xenotheca Arber et Goode. Some of the Red Hill cupule complexes are distinct from the aforementioned taxa in consisting of slender dichotomously forking axes terminating in paired cupules with highly fused and symmetric cupule quadrant lobes. The distinctive nature of these Red Hill specimens warrants the creation of Duodimidia pfefferkornii Cressler, Prestianni, et LePage gen. et sp. nov. Plant fossil remains with sphenopteroid foliage are also present at Red Hill, possibly attributable to the spermatophytes. Previous systematic sampling of the rich plant-fossil bearing layer at Red Hill and analysis of its floristic diversity and abundance as well as the presence and absence of charcoal suggests a pattern of floral turnover from a local-scale Rhacophyton-dominated community to spermatophyte colonization following disturbance by wildfires

Development of STEP-NC Adaptor for Advanced Web Manufacturing System

Science.gov (United States)

Ajay Konapala, Mr.; Koona, Ramji, Dr.

2017-08-01

Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

The hidden symbols of the female anatomy in Michelangelo Buonarroti's ceiling in the Sistine Chapel.

Science.gov (United States)

de Campos, Deivis; Malysz, Tais; Bonatto-Costa, João Antonio; Jotz, Geraldo Pereira; de Oliveira Junior, Lino Pinto; Wichmann, Jéssica Francine; Goulart, Guilherme Reghelin; Stefani, Marco Antonio; da Rocha, Andrea Oxley

2016-10-01

A number of published articles have suggested that each element of Renaissance art contains an inner meaning. Some of these elements include the choice of theme and protagonists, faces selected for the characters, colors used, species of flowers and trees chosen, animals depicted, positions of the elements, posture of the characters and their gestures, juxtapositions in the scenes, and even the very scenario or landscape. All of these elements are thought to have hidden meanings. In this context, this manuscript presents a new hypothesis suggesting that Michelangelo Buonarroti (1475-1564) may have concealed symbols associated with female anatomy in the ceiling of the Sistine Chapel (painted 1508-1512) in Rome. Thus, this paper is useful to better understand the history of anatomy and corroborates recent descriptions that have suggested the possible existence of anatomic figures concealed in many of Michelangelo's works. Clin. Anat. 29:911-916, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Computational Science: Ensuring America’s Competitiveness

Science.gov (United States)

2005-06-01

Interest of Society (CITRIS) and Professor University of California, Berkeley J. Carter Beese , Jr. President Riggs Capital Partners Pedro Celis, Ph.D...and Library Science University of North Carolina at Chapel Hill William J. Hannigan President AT&T Jonathan C. Javitt, M.D., M.P.H. Senior Fellow...Vannier, Ph.D., Professor of Radiology, University of Chicago • Jonathan C. Silverstein, M.D., M.S., FACS, Assistant Professor of Surgery, University of

The History of the Nigerian Army and the Implications for the Future of Nigeria

Science.gov (United States)

2002-05-31

those in power were clinging to a past that supported their agenda. In his book, The Military Franchise , Akin Akindele makes the assertion that his...29Ibid., 23. 30Akin O. Akindele, The Military Franchise (Chapel Hill: Professional Press, 1993), 68. 31Ibid., 68. 32Ibid., 65. 17 CHAPTER 2 MILITARY...restrictions on entrepreneurship the nation remains in a perpetual loop of resource exploitation. 13 They can never make the leap to productive

The Infrastructure of Command Information Systems

Science.gov (United States)

1991-11-01

polygons -quite realistic radiosity lighting -textured polygons The user also hears sounds appropriate to the virtual space he is in. " Handier-We...This would be a result of collaboration with our Cornell colleagues, who have pioneered these " radiosity " lighting techniques. UNC-CH point of...Refinement Outperform the Traditional Radiosity Algorithm," TR89-020, Department of Computer Science, UNC at Chapel Hill, Aug. 1989. Airey, John M. and F

An Investigation of the Crystalchemistry and Thermochemistry of Selected Mineral Systems.

Science.gov (United States)

1987-10-29

PURPOSES AD-A 189 7581OCUMENTATION PAGE Is. REPOW Mb. RESTRICTIVE MARINGS iJf FL ui 3.DITRIDUTION /AVAILABIUTY OF REPOR 2b. DECLASSIFICATIONIOOWNGRAOiNG...Continuous Observation of Phase Transformations ", Journal of Metals Abstract April 1986. 5. Reeber, R.R. and Tesche, B. (1987) "Synchrotron...RD-AIlS ?59 AN INYESTIGATION OF THE CRYSTALCHENISTRY AND THERMNOCENISTRY OF SELECTED..(U) NORTH CAROLINA UNIV AT CHAPEL HILL DEPT OF GEOLOGY R R

Electrochemistry and Spectroelectrochemistry of Polynuclear Zinc Phthalocyanines: Formation of Mixed Valence Cation Radical Species.

Science.gov (United States)

1988-02-25

No. No. Copies Cpe Office of Naval Research 2 Dr. David You.)g Attn: Code 1113 Code 334 800 N. Quinc’ Street NORDA Arlington, Virginia 22217-5000 NSTL...Naval Surface Weapons Center Chapel Hill, North Carolina 27514 Silver Spring, Maryland 20910 Or. R. A. Marcus Dr. Michael J. Weaver Department of...Microprocessor model 340 spectrometer. Cyclic and dif, rential pulse voltammetry were performed with a Princeton Applied Research (PARC) model 174A

The origin of Mauna Loa's Nīnole Hills: Evidence of rift zone reorganization

Science.gov (United States)

Zurek, Jeffrey; Williams-Jones, Glyn; Trusdell, Frank A.; Martin, Simon

2015-01-01

In order to identify the origin of Mauna Loa volcano's Nīnole Hills, Bouguer gravity was used to delineate density contrasts within the edifice. Our survey identified two residual anomalies beneath the Southwest Rift Zone (SWRZ) and the Nīnole Hills. The Nīnole Hills anomaly is elongated, striking northeast, and in inversions both anomalies merge at approximately −7 km above sea level. The positive anomaly, modeled as a rock volume of ~1200 km3 beneath the Nīnole Hills, is associated with old eruptive vents. Based on the geologic and geophysical data, we propose that the gravity anomaly under the Nīnole Hills records an early SWRZ orientation, now abandoned due to geologically rapid rift-zone reorganization. Catastrophic submarine landslides from Mauna Loa's western flank are the most likely cause for the concurrent abandonment of the Nīnole Hills section of the SWRZ. Rift zone reorganization induced by mass wasting is likely more common than currently recognized.

Inherent and antigen-induced airway hyperreactivity in NC mice

OpenAIRE

Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

1999-01-01

In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

On pseudorandom generators in NC⁰

DEFF Research Database (Denmark)

Cryan, Mary; Miltersen, Peter Bro

2001-01-01

In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

Wine Industry Competitiveness: A survey of the Shawnee Hills American Viticultural Area

Directory of Open Access Journals (Sweden)

C. Matthew Rendleman

2016-06-01

Shawnee Hill׳s AVA winery owner/operators regard increases in regional tourism, growth in the US wine market continuous innovation, unique services and processes, and flow of information from customers to have the most enhancing effects on their businesses, and that confidence/trust in Illinois state political systems, tax systems, and administrative/bureaucratic regulations were the most constraining factors. Furthermore the Shawnee Hills AVA has growing competition, yet consists of innovative winery owners. It may currently lack external financial support, but with a community focus on product differentiation, the Shawnee Hills AVA has a chance, owners believe, to capture a portion of the growing market for regional products.

Theory of synergistic effects: Hill-type response surfaces as 'null-interaction' models for mixtures.

Science.gov (United States)

Schindler, Michael

2017-08-02

The classification of effects caused by mixtures of agents as synergistic, antagonistic or additive depends critically on the reference model of 'null interaction'. Two main approaches are currently in use, the Additive Dose (ADM) or concentration addition (CA) and the Multiplicative Survival (MSM) or independent action (IA) models. We compare several response surface models to a newly developed Hill response surface, obtained by solving a logistic partial differential equation (PDE). Assuming that a mixture of chemicals with individual Hill-type dose-response curves can be described by an n-dimensional logistic function, Hill's differential equation for pure agents is replaced by a PDE for mixtures whose solution provides Hill surfaces as 'null-interaction' models and relies neither on Bliss independence or Loewe additivity nor uses Chou's unified general theory. An n-dimensional logistic PDE decribing the Hill-type response of n-component mixtures is solved. Appropriate boundary conditions ensure the correct asymptotic behaviour. Mathematica 11 (Wolfram, Mathematica Version 11.0, 2016) is used for the mathematics and graphics presented in this article. The Hill response surface ansatz can be applied to mixtures of compounds with arbitrary Hill parameters. Restrictions which are required when deriving analytical expressions for response surfaces from other principles, are unnecessary. Many approaches based on Loewe additivity turn out be special cases of the Hill approach whose increased flexibility permits a better description of 'null-effect' responses. Missing sham-compliance of Bliss IA, known as Colby's model in agrochemistry, leads to incompatibility with the Hill surface ansatz. Examples of binary and ternary mixtures illustrate the differences between the approaches. For Hill-slopes close to one and doses below the half-maximum effect doses MSM (Colby, Bliss, Finney, Abbott) predicts synergistic effects where the Hill model indicates 'null

Diversity and biogeography of land snails (Mollusca, Gastropoda) in the limestone hills of Perak, Peninsular Malaysia

Science.gov (United States)

Foon, Junn Kitt; Clements, Gopalasamy Reuben; Liew, Thor-Seng

2017-01-01

Abstract Limestone hills are now gaining global conservation attention as hotspots for short-range endemic species. Levels of land snail endemism can be high at limestone hills, especially at hill clusters that are geographically isolated. In the State of Perak, Peninsular Malaysia, limestone hills have been opportunistically surveyed for land snails in the past, but the majority have yet to be surveyed. To address this knowledge gap, we systematically surveyed the terrestrial malacofauna of 12 limestone hills that, based on our opinion, are a representation of the limestone land snail assemblages within the State. Our inventory yielded high sampling completeness (>85%). We found 122 species of land snails, of which 34 species were unique to one of the surveyed hills. We identified 30 species that are potentially new to science. The number of land snail species recorded at each hill ranged between 39 and 63 species. Four of the sampled limestone hills namely, Prk 01 G. Tempurung, Prk 55 G. Pondok, Prk 47 Kanthan, and Prk 64 Bt Kepala Gajah, have high levels of species richness and unique species, representing 91% of the total species recorded in this study. We identified two clusters of limestone hills in central Perak with distinct differences in land snail species composition – a northern hill cluster on elevated granite bedrock and southern hill cluster in a low-lying valley surrounded by alluvial soils. As limestone hills continue to be quarried to meet the cement demand, the four identified limestone hills, along with other hills from the two clusters, warrant urgent conservation attention in order to maintain high species diversity within Perak’s terrestrial malacofauna. PMID:28769723

78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-09-04

...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

Engaging Youth on Climate & Health to Cultivate Community Resilience

Science.gov (United States)

Haine, D. B.; Gray, K. M.; Chang, D.; Morton, T.; Steele, B.; Backus, A.; Hauptman, M.

2017-12-01

Cultivating climate literacy among youth positions them to develop solutions and advocate for actions that prepare communities to adapt to climate change, mitigate emissions and ultimately protect human health and well-being, with an eye towards protecting the most vulnerable populations. This presentation will describe an innovative partnership among three university environmental health programs—based at the University of North Carolina at Chapel Hill, Columbia University and Harvard University—and their community collaborators: the Alliance for Climate Education, Boston Children's Hospital Pediatric Environmental Health Center and WE ACT for Environmental Justice. This project engages youth through non-formal educational programming that promotes climate literacy while also building the capacity of today's youth to promote community resilience. This partnership led to the development and implementation of two, long-duration extracurricular youth science enrichment programs in 2017, one in North Carolina (NC) and one in New York, with joint activities conducted virtually and in person to connect students with each other and with leading public health professionals and others working to promote community resilience and climate justice. Forty high school students, 20 from central NC and 20 from West Harlem in New York City, are enrolled in each program. In July 2017, students came together for a 3-day summer institute in NC. This session will feature the strategies, STEM-based activities and resources used in this project to engage students in the examination of their communities, identification and evaluation of climate adaptation and mitigation strategies and promotion of community resilience. Programming entailed having students interact with public health professionals, scientists and others to learn about climate impacts to public health and its infrastructure, vulnerable populations and planning for resilient communities. Ultimately, we sought to promote

Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

Directory of Open Access Journals (Sweden)

Lesley Joan Collins

2011-12-01

Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

Science.gov (United States)

Collins, Lesley Joan

2011-01-01

ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

Fertility in Hill Korwas -- a primitive tribe of Madhya Pradesh.

Science.gov (United States)

Pandey, G D; Tiwary, R S

1996-12-01

This study examines fertility behavior among 604 eligible couples in Hill Korwa tribes in Madhya Pradesh state, India. Low fertility patterns are compared to those of neighboring Gonds and nontribals from rural Jabalpur. The Hill Korwa are a subtribe of the Korwa, who remained in the hills and dense forests. Over 60% live in three tehsils of Surguja district, including Ambikapur tehsil where the study was conducted. Data were obtained in March 1991. Eligible couples were those where both partners live together and the noncontracepting wife is under age 50 and nonmenopausal. Only 3% were literate. Female marriage age was about 15 years. The median age was 23.8 years. 92% lived below the poverty line. The average number of children ever born (CEB) per couple was 1.9, compared to 2.5 for the Gond and 2.9 for nontribal couples. The CEB in a reproductive lifetime was 2.9, compared to 5.3 for Gond women and 5.9 for nontribal women. Fecundity among Hill Korwa women was 66% lower at younger ages (16-17 years and 17-18 years), and the differences increased with an increase in age at marriage. Hill Korwas had a low female age at marriage, low literacy, low percentages engaged in agriculture, and higher percentages living above the poverty line.

Midwest nukes tumble, rock industry: Byron, Marble Hill, Zimmer

International Nuclear Information System (INIS)

Nogee, A.

1984-01-01

The nuclear industry is suffering from a lack of investor confidence because of cancelled projects and the unprecedented rejection of an operating license for Commonwealth Edison's Byron plant on grounds that the utility failed to meet quality assurance responsibilities. When plans to complete the Zimmer and Marble Hill nuclear plants were abandoned, Bechtel came forward with a financing plan that, while rejected for Zimmer and Marble Hill, could lead to future bailouts. Both Zimmer and Marble Hill plants could be partially converted to coal. The loss of investor confidence in nuclear plants is largely due to political pressures brought on by a combination of citizen intervenors, whistle blowers on construction sites and disagreements between participating utilities. A rise in stock prices followed the cancellation announcements and the lowered investment security ratings

Microhabitats of Merriam's turkeys in the Black Hills, South Dakota

Science.gov (United States)

Mark A. Rumble; Stanley H. Anderson

1996-01-01

Merriam’s Turkeys (Meleagris gallopavo merriami) are associated with ponderosa pine (Pinus ponderosa) forests in the western United States, but are not native to the ponderosa pine forest of the Black Hills, South Dakota. The Black Hills population was established by transplanting birds from New Mexico and Colorado between 1948 and...

State of conservation of Santa Martha's hills, Colombia

International Nuclear Information System (INIS)

Lopez Salgado, Hector Jaime; Carbono Delahoz, Eduino

2006-01-01

The urban growth of Santa Marta and the occupation without planning of their surrounding hills, affect their natural conditions. The hills are part of the scenic beauty of the city and its conservation is indispensable to maintain the standard of life in her the vegetal cover corresponds to forests and scrubs of isomegathermic floor with xeromorphic characters, due to the low pluvial precipitation, this landscape characterizes the Colombian Caribbean coast in a narrow strip that extends from the south of the Guajira to the gulf of Morrosquillo. At the present time, only they are left surpluses in natural state, due to the floristic simplification of the vegetation, the introduction of invading species and modification of the landscape. The responsibility of the suitable handling of the urban space is imperative for the official, private sector and citizen institutions. The objective is to make an evaluation of the environmental conditions of hills of the city, in order to obtain basic elements, for the design of appropriate strategies of handling and its conservation. By means of the use of the GIS, with verification and aerial photo interpretation of field a multi-temporary study (1955-1993-2003) of the vegetal cover of the hills was elaborated that allowed to establish the happened changes. The execution of inventors allowed knowing the wealth and the structure floristic the vegetal cover of the area. The work was executed between May of the 2004 and May of the 2005

Mass, charge, and energy separation by selective acceleration with a traveling potential hill

Science.gov (United States)

Tung, L. Schwager; Barr, W. L.; Lowder, R. S.; Post, R. F.

1996-10-01

A traveling electric potential hill has been used to generate an ion beam with an energy distribution that is mass dependent from a monoenergetic ion beam of mixed masses. This effect can be utilized as a novel method for mass separation applied to identification or enrichment of ions (e.g., of elements, isotopes, or molecules). This theory for mass-selective acceleration is presented here and is shown to be confirmed by experiment and by a time-dependent particle-in-cell computer simulation. Results show that monoenergetic ions with the particular mass of choice are accelerated by controlling the hill potential and the hill velocity. The hill velocity is typically 20%-30% faster than the ions to be accelerated. The ability of the hill to pickup a particular mass uses the fact that small kinetic energy differences in the lab frame appear much larger in the moving hill frame. Ions will gain energy from the approaching hill if their relative energy in the moving hill frame is less than the peak potential of the hill. The final energy of these accelerated ions can be several times the source energy, which facilitates energy filtering for mass purification or identification. If the hill potential is chosen to accelerate multiple masses, the heaviest mass will have the greatest final energy. Hence, choosing the appropriate hill potential and collector retarding voltage will isolate ions with the lightest, heaviest, or intermediate mass. In the experimental device, called a Solitron, purified 20Ne and 22Ne are extracted from a ribbon beam of neon that is originally composed of 20Ne:22Ne in the natural ratio of 91:9. The isotopic content of the processed beam is determined by measuring the energy distribution of the detected current. These results agree with the theory. In addition to mass selectivity, our theory can also be applied to the filtration of an ion beam according to charge state or energy. Because of this variety of properties, the Solitron is envisioned to

From the Renaissance to the Modern World—Introduction

OpenAIRE

Peter Iver Kaufman

2012-01-01

On November 11 and 12, 2011, a symposium held at the University of North Carolina in Chapel Hill honored John M. Headley, Emeritus Professor of History. The organizers, Professor Melissa Bullard—Headley’s colleague in the department of history at that university—along with Professors Paul Grendler (University of Toronto) and James Weiss (Boston College), as well as Nancy Gray Schoonmaker, coordinator of the Program in Medieval and Early Modern Studies—assembled presenters, respondents, and do...

Factors that influence exercise activity among women post hip fracture participating in the Exercise Plus Program

OpenAIRE

Barbara Resnick; Denise Orwig; Christopher D′Adamo; Janet Yu-Yahiro; William Hawkes; et al

2007-01-01

Barbara Resnick1, Denise Orwig2, Christopher D’Adamo2, Janet Yu-Yahiro3, William Hawkes2, Michelle Shardell2, Justine Golden2, Sheryl Zimmerman4, Jay Magaziner21University of Maryland School of Nursing, 655 West Lombard Street, Baltimore, MD,21201, USA; 2University of Maryland School of Medicine, Howard Hall, Redwood Street, Baltimore MD 21201, USA; 3Department of Orthopaedic Surgery, Union Memorial Hospital, Baltimore, USA; 4University of North Carolina Chapel Hill, 301 Pittsboro St., ...

Recurrent symptomatic ischemic stroke in a 46-year-old African male revealing Angio-Behçet with severe cardiovascular involvement

OpenAIRE

Ba Djibril Marie; Diack Aminata; Mboup Mouhamed Cherif; Fall Moussa Daouda

2017-01-01

Behçet’sdisease (BD) is a chronic, multisystem vasculitis. It is categorized under variable vessel vasculitis in the new Chapel Hill nomenclature as it involves blood vessels of any type and size. It is characterized by relapsing aphthous ulcers commonly occurring in the oral mucosa and genitalia with ocular involvement. Other organ systems may be involved any time throughout the course of the disease. The exact cause is unknown. However, combination of genetic and environmental factors is li...

THE LARVAL DEVELOPMENT AND POPULATION DYNAMICS OF ...

African Journals Online (AJOL)

rocks and harbour areas, stippled area denotes beach. Depth contour in m. R ep rod u ced b y Sa b in et G a tew a. y u n d er licen ce gra n ted b y th e P u b ..... and recent ilIhtl1lces with emphosis on plant parasites and soil forms. cds. J. N. Sasser & W. R. Jenkins. Chapel Hill: Univ. North. Carolina Press. R ep rod u ced b.

The baryon vector current in the combined chiral and 1/Nc expansions

Energy Technology Data Exchange (ETDEWEB)

Flores-Mendieta, Ruben; Goity, Jose L [JLAB

2014-12-01

The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

1997-06-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

1997-01-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

Pouvoir et religion à la chapelle royale de Versailles sous Louis XIV Power and religion at the royal chapel of Versailles under Louis XIV

Directory of Open Access Journals (Sweden)

Alexandre Maral

2007-12-01

Full Text Available D’une manière peut‑être plus sensible que partout ailleurs, les objets et les insignes du pouvoir prennent une importance particulière dans le contexte du cérémonial liturgique de la religion catholique. À la chapelle royale de Versailles, la présence régulière du monarque et de sa cour complique encore la situation, d’autant que la desserte est assurée par deux corps distincts d’ecclésiastiques. Dépassant le simple cadre des préséances, Louis XIV a défini autour de sa personne royale un système rituel susceptible d’en manifester le caractère épiscopal dérivé du sacre. De même, l’enjeu juridictionnel représenté par la Chapelle royale se traduit par un jeu subtil d’attitudes, de gestes et de rites, chorégraphie sacrée qui accompagne et exprime les revendications des partisans et des adversaires de l’exemption du lieu de culte royal au regard du diocèse de Paris. Ce discours trouve un écho partiel dans le programme décoratif de la chapelle définitive du palais, achevée en 1710.Objects and symbols of power take on a particular importance in the liturgical ceremony of the Catholic Church, perhaps more so than in any other context. At the royal chapel of Versailles, the regular presence of the king and his court complicated the situation further, all the more so in that religious ceremony was administered by two distinct ecclesiastic bodies. Beyond the rules of precedence, Louis XIV had introduced around his royal persona a system of ritual that would manifest the episcopal identity conferred upon him by his coronation. Similarly, the jurisdictional authority represented by the royal chapel was conveyed in a subtle play of attitudes, gestures and rites, a symbolic choreography that accompanied and expressed the claims of the partisans and adversaries of the exemption of the royal place of worship with regard to the diocese of Paris. This stance was reflected in the decorative scheme of the palace�

Archeological Investigations at Big Hill Lake, Southeastern Kansas, 1980.

Science.gov (United States)

1982-09-01

settled primarily along the Neosho river and Labette, Big Hill, and Pumpkin creeks. One of the first settlers in Osage township, in which Big Hill...slabs is not known at present. About 10 years later, in 1876, materials were reported- ly collected from an aboriginal site along Pumpkin creek...and length- ening its lifetime of use. As would therefore be expected, cracks are present between each of the paired holes on both of the two restored

Measurements of the near-surface flow over a hill

Science.gov (United States)

Vosper, S. B.; Mobbs, S. D.; Gardiner, B. A.

2002-10-01

The near-surface flow over a hill with moderate slope and height comparable with the boundary-layer depth is investigated through field measurements of the mean flow (at 2 m), surface pressure, and turbulent momentum flux divergence between 8 and 15 m. The measurements were made along an east-west transect across the hill Tighvein (height 458 m, approximate width 8 km) on the Isle of Arran, south-west Scotland, during two separate periods, each of around three-weeks duration. Radiosonde ascents are used to determine the variation of a Froude number, FL = U/NL, where U is the wind speed at the middle-layer height, hm, N is the mean Brunt-Väisälä frequency below this height and L is a hill length-scale. Measurements show that for moderately stratified flows (for which FL 0.25) a minimum in the hill-induced surface-pressure perturbation occurs across the summit and this is accompanied by a maximum in the near-surface wind speed. In the more strongly stratified case (FL 0.25) the pressure field is more asymmetric and the lee-slope flow is generally stronger than on the windward slope. Such a flow pattern is qualitatively consistent with that predicted by stratified linear boundary-layer and gravity-wave theories. The near-surface momentum budget is analysed by evaluating the dominant terms in a Bernoulli equation suitable for turbulent flow. Measurements during periods of westerly flow are used to evaluate the dominant terms, and the equation is shown to hold to a reasonable approximation on the upwind slope of the hill and also on the downwind slope, away from the summit. Immediately downwind of the summit, however, the Bernoulli equation does not hold. Possible reasons for this, such as non-separated sheltering and flow separation, are discussed.

Novedades sobre el género Pilosella Hill.: (Asteraceae, Lactuceae) en España, II

OpenAIRE

Mateo Sanz, Gonzalo

2016-01-01

Se comunica la presencia de diversas especies nuevas del género Pilosella Hill. (Asteraceae, Lactuceae) en España. Novelties on the genus Pilosella Hill (Asteraceae, Lactuceae) in Spain, II. Several species of Pilosella Hill (Asteraceae, Lactuceae) found in Spain.

Génesis, postulados y críticas a la inflexión decolonial. Conversación con Eduardo Restrepo

Directory of Open Access Journals (Sweden)

Yuri Moreno

2015-07-01

Full Text Available El presente texto recupera el diálogo -vía Skype- sostenido por el antropólogo colombiano Eduardo Restrepo5 con el Grupo de Trabajo sobre Pensamiento Decolonial de la Universidad de Concordia (Montreal, Quebec, Canadá, el 25 de noviembre de 20146, organizada por Yuri Moreno. Al inicio de la charla se menciona que el objetivo es contextualizar y pensar el proyecto modernidad-colonialidad y la inflexión decolonial desde la perspectiva de Restrepo. Para ello, la primera pregunta alude a cómo es que Eduardo se incorpora al grupo modernidad-decolonialidad,  ante lo que no deja claro incluso si es que alguna vez se incorporó, ya siempre se referirá al grupo como “ellos”, aunque sí señala que su acercamiento se remite al tiempo en que estudiaba su doctorado en la Universidad de Carolina del Norte (en Chapel Hill, y en el marco de los contactos entreWalter Mignolo (Chapel Hill y Arturo Escobar (Duke. Rememora su participación en una reunión realizada en 2001, que era la 3° o 4° de este tipo, en donde confluyeron, entre otros, Aníbal Quijano, Walter Mignolo, Catherine Walsh, Zulma Palermo, Javier Sanjinés, Santiago Castro-Gómez y dos integrantes del Instituto Pensar.

George William Hill, the Great but Unknown 19th Century Celestial Mechanician

Science.gov (United States)

Corbin, Brenda G.

2012-01-01

George William Hill (1838-1914) has long been considered one of the most famous and talented celestial mechanicians of the past century and a half. However, many people have never heard of him and his work. Simon Newcomb said he "will easily rank as the greatest master of mathematical astronomy during the last quarter of the nineteenth century.” After receiving a B.A. at Rutgers in 1859, Hill began work in 1861 at the office of the American Ephemeris and Nautical Almanac in Cambridge, MA. He moved to Washington with the group in 1882 which then became part of the U. S. Naval Observatory. Newcomb, beginning his work on planetary motion, assigned the theory of Jupiter and Saturn to him, calling it about the most difficult topic. Hill's work was published by the USNO in 1890 as A New Theory of Jupiter and Saturn. From 1898 to 1901, Hill lectured on the subject of celestial mechanics at Columbia University in a position created just for him. After 1892 and until his death, he lived at the family homestead in West Nyack, NY. He never married, was something of a recluse, and spent most of his time with his books and research. Hill was an amateur botanist and enjoyed exploring on long walks in the countryside. Many honors and awards came to him during his lifetime, both from the U.S. and abroad, including serving as president of the American Mathematical Society. All of Hill's mathematical and astronomical research was incorporated in The Collected Mathematical Works of George William Hill. This work, containing a preface in French by Poincare, was published in 4 large volumes by the Carnegie Institution of Washington in 1905.

Multi-scale habitat use of male ruffed grouse in the Black Hills National Forest

Science.gov (United States)

Cassandra L. Mehls; Kent C. Jensen; Mark A. Rumble; Michael C. Wimberly

2014-01-01

Ruffed grouse (Bonasa umbellus) are native upland game birds and a management indicator species (MIS) for aspen (Populus tremuloides) in the Black Hills National Forest (Black Hills). Our objective was to assess resource selection of male ruffed grouse to identify the most appropriate scale to manage for aspen and ruffed grouse in the Black Hills. During spring 2007...

A System Dynamics Model for Integrated Decision Making ...

Science.gov (United States)

EPA’s Sustainable and Healthy Communities Research Program (SHC) is conducting transdisciplinary research to inform and empower decision-makers. EPA tools and approaches are being developed to enable communities to effectively weigh and integrate human health, socioeconomic, environmental, and ecological factors into their decisions to promote community sustainability. To help achieve this goal, EPA researchers have developed systems approaches to account for the linkages among resources, assets, and outcomes managed by a community. System dynamics (SD) is a member of the family of systems approaches and provides a framework for dynamic modeling that can assist with assessing and understanding complex issues across multiple dimensions. To test the utility of such tools when applied to a real-world situation, the EPA has developed a prototype SD model for community sustainability using the proposed Durham-Orange Light Rail Project (D-O LRP) as a case study.The EPA D-O LRP SD modeling team chose the proposed D-O LRP to demonstrate that an integrated modeling approach could represent the multitude of related cross-sectoral decisions that would be made and the cascading impacts that could result from a light rail transit system connecting Durham and Chapel Hill, NC. In keeping with the SHC vision described above, the proposal for the light rail is a starting point solution for the more intractable problems of population growth, unsustainable land use, environmenta

Monitoring and managing mothers with gestational diabetes mellitus: a nursing perspective

Directory of Open Access Journals (Sweden)

Berry DC

2015-10-01

Full Text Available Diane C Berry,1 Quinetta B Johnson,2,3 Alison M Stuebe2,3 1The University of North Carolina School of Nursing, 2Women's Primary Health Care, The University of North Carolina School of Medicine, Division of Maternal Fetal Medicine, 3The University of North Carolina Gillings School of Global Public Health, Chapel Hill, NC, USA Abstract: Women diagnosed with gestational diabetes mellitus (GDM must work in partnership with their health care team to improve both maternal and fetal outcomes. This team may include physicians, midwives, nurse practitioners, physician assistants, registered nurses, certified diabetes educators, and registered dietitians. Management should include medical nutrition therapy, self-monitoring of blood glucose with tight control, and exercise to prevent postprandial hyperglycemia. Approximately 80% of women diagnosed with GDM are well controlled with medical nutrition therapy, self-monitoring of blood glucose, and exercise; however, approximately 20% require medication to bring their blood glucose levels under control during pregnancy. The risk of developing type 2 diabetes mellitus decreases dramatically for women who engage in interventions to lose weight postpartum, improve their nutrition and increase their physical activity. Therefore, postpartum women with GDM should be retested and reclassified at 6 weeks postpartum and strongly encouraged to lose weight through proper nutrition and exercise. Keywords: gestational diabetes mellitus, medical nutrition therapy, self-monitoring of blood glucose, exercise, medication, type 2 diabetes

Applications of image processing and visualization in the evaluation of murder and assault

Science.gov (United States)

Oliver, William R.; Rosenman, Julian G.; Boxwala, Aziz; Stotts, David; Smith, John; Soltys, Mitchell; Symon, James; Cullip, Tim; Wagner, Glenn

1994-09-01

Recent advances in image processing and visualization are of increasing use in the investigation of violent crime. The Digital Image Processing Laboratory at the Armed Forces Institute of Pathology in collaboration with groups at the University of North Carolina at Chapel Hill are actively exploring visualization applications including image processing of trauma images, 3D visualization, forensic database management and telemedicine. Examples of recent applications are presented. Future directions of effort include interactive consultation and image manipulation tools for forensic data exploration.

Numerical Simulation Analysis of Seismic of Frame Structure on Hill Terrain

Directory of Open Access Journals (Sweden)

Weng Weisu

2017-01-01

Full Text Available In recent year, Wenchuan,Ya’an,Yushu and other areas in china occur a series of high earthquake, however areas of earthquake is similar as mountainous terrain, building structure of seismic increasingly aroused our concern, and the research that hill topography affected building structure seismic in shallow mountain. The research content mainly includes: through modelling was built by the ANSYS software, the cooperative effects of a ten layer of frame structure- hill system were calculation. First, simple comparative dynamic characteristics analysis of soil - structure interaction and the rigid foundation assumption conditions; Second, put Hill-Soil-Structure Interaction(referred to as HSSI and Soil - Structure - Interaction(referred to as SSI further analysis of the dynamic response, including: including structural modal analysis (vibration mode, cycle, the time history analysis (such as displacement, internal force and acceleration and so on. Through Hill-Soil-Structure Interaction research, taking each factor in consideration, giving structure seismic key technology measures about shallow mountain to provide reference for such structure theory research.

Noise in NC-AFM measurements with significant tip–sample interaction

Directory of Open Access Journals (Sweden)

Jannis Lübbe

2016-12-01

Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

ORF Sequence: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

ORF Sequence: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

DOE to accept bids for Elk Hills crude

International Nuclear Information System (INIS)

Anon.

1992-01-01

This paper reports that the Department of Energy will accept bids in a reoffering sale covering 53,400 b/d of Elk Hills field oil but later may exercise an option to cut sales volumes and ship 20,000 b/d to Strategic Petroleum Reserve sites in Texas. DOE rejected all 19 bids submitted in an earlier semiannual sale of crude oil from the California naval petroleum reserve, saying they were too low. DOE the, The unique combination of federal and state government policies affecting the movement of oil into and out of the California market has contributed to a situation in which it apparently is very difficult for the government to receive a price for Elk Hills oil that satisfies the minimum price tests that govern the sale of Elk Hills oil. The 12 winning bids in the reoffering sale averaged $13.58/bbl, with bids for the higher quality Stevens zone crude averaging $13.92/bbl, about 67 cents/bbl higher than bids rejected last month. DOE the 20,000 b/d is all local pipelines can ship to the interstate All-American pipeline for transfer to Texas beginning in June

Rare Plants and Animals of the Texas Hill Country: Educator's Guide.

Science.gov (United States)

Texas State Dept. of Parks and Wildlife, Austin.

Texas Hill Country is a land of fresh water springs, stony hills, and steep canyons and home to many rare plants and animals. Six activities for grades 3-5 and six activities for grades 6-12 are contained in this guide. Elementary activity highlights include using "The Lorax" by Dr. Seuss to stimulate critical thinking about…

Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

Science.gov (United States)

Das, Debajyoti; Mondal, Praloy

2017-09-01

Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

ORF Sequence: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

Conditioning exercises in ski jumping: biomechanical relationship of squat jumps, imitation jumps, and hill jumps.

Science.gov (United States)

Lorenzetti, Silvio; Ammann, Fabian; Windmüller, Sabrina; Häberle, Ramona; Müller, Sören; Gross, Micah; Plüss, Michael; Plüss, Stefan; Schödler, Berni; Hübner, Klaus

2017-11-22

As hill jumps are very time-consuming, ski jumping athletes often perform various imitation jumps during training. The performed jumps should be similar to hill jumps, but a direct comparison of the kinetic and kinematic parameters has not been performed yet. Therefore, this study aimed to correlate 11 common parameters during hill jumps (Oberstdorf Germany), squat jumps (wearing indoor shoes), and various imitation jumps (rolling 4°, rolling flat, static; jumping equipment or indoor shoes) on a custom-built instrumented vehicle with a catch by the coach. During the performed jumps, force and video data of the take-off of 10 athletes were measured. The imitation and squat jumps were then ranked. The main difference between the hill jumps and the imitation and squat jumps is the higher maximal force loading rate during the hill jumps. Imitation jumps performed on a rolling platform, on flat ground were the most similar to hill jumps in terms of the force-time, and leg joint kinematic properties. Thus, non-hill jumps with a technical focus should be performed from a rolling platform with a flat inrun with normal indoor shoes or jumping equipment, and high normal force loading rates should be the main focus of imitation training.

Comparison of Speed-Up Over Hills Derived from Wind-Tunnel Experiments, Wind-Loading Standards, and Numerical Modelling

Science.gov (United States)

Safaei Pirooz, Amir A.; Flay, Richard G. J.

2018-03-01

We evaluate the accuracy of the speed-up provided in several wind-loading standards by comparison with wind-tunnel measurements and numerical predictions, which are carried out at a nominal scale of 1:500 and full-scale, respectively. Airflow over two- and three-dimensional bell-shaped hills is numerically modelled using the Reynolds-averaged Navier-Stokes method with a pressure-driven atmospheric boundary layer and three different turbulence models. Investigated in detail are the effects of grid size on the speed-up and flow separation, as well as the resulting uncertainties in the numerical simulations. Good agreement is obtained between the numerical prediction of speed-up, as well as the wake region size and location, with that according to large-eddy simulations and the wind-tunnel results. The numerical results demonstrate the ability to predict the airflow over a hill with good accuracy with considerably less computational time than for large-eddy simulation. Numerical simulations for a three-dimensional hill show that the speed-up and the wake region decrease significantly when compared with the flow over two-dimensional hills due to the secondary flow around three-dimensional hills. Different hill slopes and shapes are simulated numerically to investigate the effect of hill profile on the speed-up. In comparison with more peaked hill crests, flat-topped hills have a lower speed-up at the crest up to heights of about half the hill height, for which none of the standards gives entirely satisfactory values of speed-up. Overall, the latest versions of the National Building Code of Canada and the Australian and New Zealand Standard give the best predictions of wind speed over isolated hills.

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

Distance-Based Functional Diversity Measures and Their Decomposition: A Framework Based on Hill Numbers

Science.gov (United States)

Chiu, Chun-Huo; Chao, Anne

2014-01-01

Hill numbers (or the “effective number of species”) are increasingly used to characterize species diversity of an assemblage. This work extends Hill numbers to incorporate species pairwise functional distances calculated from species traits. We derive a parametric class of functional Hill numbers, which quantify “the effective number of equally abundant and (functionally) equally distinct species” in an assemblage. We also propose a class of mean functional diversity (per species), which quantifies the effective sum of functional distances between a fixed species to all other species. The product of the functional Hill number and the mean functional diversity thus quantifies the (total) functional diversity, i.e., the effective total distance between species of the assemblage. The three measures (functional Hill numbers, mean functional diversity and total functional diversity) quantify different aspects of species trait space, and all are based on species abundance and species pairwise functional distances. When all species are equally distinct, our functional Hill numbers reduce to ordinary Hill numbers. When species abundances are not considered or species are equally abundant, our total functional diversity reduces to the sum of all pairwise distances between species of an assemblage. The functional Hill numbers and the mean functional diversity both satisfy a replication principle, implying the total functional diversity satisfies a quadratic replication principle. When there are multiple assemblages defined by the investigator, each of the three measures of the pooled assemblage (gamma) can be multiplicatively decomposed into alpha and beta components, and the two components are independent. The resulting beta component measures pure functional differentiation among assemblages and can be further transformed to obtain several classes of normalized functional similarity (or differentiation) measures, including N-assemblage functional generalizations of

Distance-based functional diversity measures and their decomposition: a framework based on Hill numbers.

Directory of Open Access Journals (Sweden)

Chun-Huo Chiu

Full Text Available Hill numbers (or the "effective number of species" are increasingly used to characterize species diversity of an assemblage. This work extends Hill numbers to incorporate species pairwise functional distances calculated from species traits. We derive a parametric class of functional Hill numbers, which quantify "the effective number of equally abundant and (functionally equally distinct species" in an assemblage. We also propose a class of mean functional diversity (per species, which quantifies the effective sum of functional distances between a fixed species to all other species. The product of the functional Hill number and the mean functional diversity thus quantifies the (total functional diversity, i.e., the effective total distance between species of the assemblage. The three measures (functional Hill numbers, mean functional diversity and total functional diversity quantify different aspects of species trait space, and all are based on species abundance and species pairwise functional distances. When all species are equally distinct, our functional Hill numbers reduce to ordinary Hill numbers. When species abundances are not considered or species are equally abundant, our total functional diversity reduces to the sum of all pairwise distances between species of an assemblage. The functional Hill numbers and the mean functional diversity both satisfy a replication principle, implying the total functional diversity satisfies a quadratic replication principle. When there are multiple assemblages defined by the investigator, each of the three measures of the pooled assemblage (gamma can be multiplicatively decomposed into alpha and beta components, and the two components are independent. The resulting beta component measures pure functional differentiation among assemblages and can be further transformed to obtain several classes of normalized functional similarity (or differentiation measures, including N-assemblage functional

The Hill's three-body problem: a new deduction of motion equations

International Nuclear Information System (INIS)

Fuente Marcos, C. de la.

1995-01-01

Although the Hill's problem has been considered traditionally as a particular case of the restricted problem, it is not but rather a different problem with the same degree of generality. In this paper it is presented a new derivation of the motion equations obtained originally by Hill in 1878 as well as a brief discussion about its possible applications. (Author) 13 refs

A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression

Directory of Open Access Journals (Sweden)

Yong Sun Lee

2015-06-01

Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.

76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-05-23

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-05

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-06-29

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-26

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

Effects of mineralogy on sorption of strontium and cesium onto Calico Hills Tuff

International Nuclear Information System (INIS)

Meyer, R.E.; Arnold, W.D.; Case, F.I.; O'Kelley, G.D.; Land, J.F.

1990-04-01

The sorption properties of tuff formations at the proposed site for the high-level nuclear waste repository at Yucca Mountain, Nevada, have been extensively studied. Sorption and desorption measurements were made of strontium and cesium onto clinoptilolite and Calico Hills Tuff. The object was to see whether there was a correlation between sorption of strontium and cesium onto Calico Hills Tuff and the sorption of strontium and cesium onto clinoptilolite based on the content of clinoptilolite in the Calico Hills Tuff. 13 refs., 10 figs., 6 tabs

ORF Sequence: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

3D Modeling By Consolidation Of Independent Geometries Extracted From Point Clouds - The Case Of The Modeling Of The Turckheim's Chapel (Alsace, France)

Science.gov (United States)

Koehl, M.; Fabre, Ph.; Schlussel, B.

2014-06-01

Turckheim is a small town located in Alsace, north-east of France. In the heart of the Alsatian vineyard, this city has many historical monuments including its old church. To understand the effectiveness of the project described in this paper, it is important to have a look at the history of this church. Indeed there are many historical events that explain its renovation and even its partial reconstruction. The first mention of a christian sanctuary in Turckheim dates back to 898. It will be replaced in the 12th century by a roman church (chapel), which subsists today as the bell tower. Touched by a lightning in 1661, the tower then was enhanced. In 1736, it was repaired following damage sustained in a tornado. In 1791, the town installs an organ to the church. Last milestone, the church is destroyed by fire in 1978. The organ, like the heart of the church will then have to be again restored (1983) with a simplified architecture. From this heavy and rich past, it unfortunately and as it is often the case, remains only very few documents and information available apart from facts stated in some sporadic writings. And with regard to the geometry, the positioning, the physical characteristics of the initial building, there are very little indication. Some assumptions of positions and right-of-way were well issued by different historians or archaeologists. The acquisition and 3D modeling project must therefore provide the current state of the edifice to serve as the basis of new investigations and for the generation of new hypotheses on the locations and historical shapes of this church and its original chapel (Fig. 1)

Analysis of automobile’s automatic control systems for the hill climbing start

Directory of Open Access Journals (Sweden)

Valeriy I. Klimenko

2014-12-01

Full Text Available To improve road safety while driving on the rise, facilitating the driver’s activity the automobile industry leaders are introducing automatic hill-hold control systems into the car design. This study purpose relates to the existing automatic start control systems’ design analysis. Analyzed are the existing design developments of automatic hill start assist control systems applied for driving at the start of the climbing. The effected research allows to select the scheme for further development of start driving automatic control systems. Further improvement of driving control systems and primarily the driver assistance hill-hold control systems is necessary to increase both the driving comfort and the traffic safety.

The Kapsiki of the Mandara Hills

NARCIS (Netherlands)

Beek, van W.E.A.

1987-01-01

The Kapsiki of Cameroon and the Higi of Nigeria are two tribes from the Mandara hills area of central and western Africa. Though they form one coherent group of villages, they are usually considered as two separate ethnic units. The author normally uses the term Kapsiki for both. Based on fieldwork

77 FR 2128 - Southwest Pennsylvania Railroad Company-Acquisition Exemption-Laurel Hill Development Corporation

Science.gov (United States)

2012-01-13

... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [Docket No. FD 35584] Southwest Pennsylvania Railroad Company--Acquisition Exemption-- Laurel Hill Development Corporation Southwest... 49 CFR 1150.41 to acquire a number of rail lines now owned by Laurel Hill Development Corporation...

Investigation of periodic systems by means of the generalized Hill method

International Nuclear Information System (INIS)

Baitin, A.V.; Ivanov, A.A.

1994-01-01

We propose the new method of investigation of infinite periodic determination which is a generalized Hill method. This method has been used for finding of the characteristic value for the Hill equation. finding the band structure of the one-dimensional periodic and obtaining of the dispersion equation for the electromagnetic wave propagation in the waveguide by plasma arbitrary periodic density modulation by plasma arbitrary periodic density modulation

77 FR 33560 - Southwest Pennsylvania Railroad Company-Acquisition Exemption-Laurel Hill Development Corporation

Science.gov (United States)

2012-06-06

... Pennsylvania Railroad Company--Acquisition Exemption-- Laurel Hill Development Corporation Southwest... 49 CFR 1150.41 to acquire a 0.66-mile line of railroad owned by Laurel Hill Development Corporation... rail line. Most recently, in Southwest Pennsylvania Railroad Company--Acquisition Exemption--Laurel...

Effects of carboxylic acids on nC60 aggregate formation

International Nuclear Information System (INIS)

Chang Xiaojun; Vikesland, Peter J.

2009-01-01

The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed

ORF Sequence: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Evidence to the Marley Hill Public Inquiry

Energy Technology Data Exchange (ETDEWEB)

Wilson, G.K. (Council for the Protection of Rural England (UK). Durham and Teesdale Branch)

1989-11-01

George Kenneth Wilson, a retired power station enginer, and holder of such offices as Vice-Chairman of the CPRE Durham and Teesdale Branch, Secretary of the Derwent Valley Protection Society and an officer of the Opencast Mining Intelligence Group, presents reasons for dismissing the appeal for opencast mining at the Marley Hill site in the NE of England saying that the Mineral Planning Guidance Note, MPG3 seemed to be repeating mistakes inherent in the previous 'Plan for coal'. He considers that the application cannot be justified on the grounds of demand or forecast market trends. The type of coal is unsuitable for local power station boilers. The working of the site would destroy a large area of pleasant countryside. The standard of restoration of the 32 sites surrounding Marley Hill is in his opinion very poor.

Characterization and properties of acetylated nanocrystalline cellulose (aNC) reinforced polylactic acid (PLA) polymer

Science.gov (United States)

Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam

2017-12-01

Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.

Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices

Directory of Open Access Journals (Sweden)

A. F. Qasrawi

2013-01-01

Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.

Hill functions for stochastic gene regulatory networks from master equations with split nodes and time-scale separation

Science.gov (United States)

Lipan, Ovidiu; Ferwerda, Cameron

2018-02-01

The deterministic Hill function depends only on the average values of molecule numbers. To account for the fluctuations in the molecule numbers, the argument of the Hill function needs to contain the means, the standard deviations, and the correlations. Here we present a method that allows for stochastic Hill functions to be constructed from the dynamical evolution of stochastic biocircuits with specific topologies. These stochastic Hill functions are presented in a closed analytical form so that they can be easily incorporated in models for large genetic regulatory networks. Using a repressive biocircuit as an example, we show by Monte Carlo simulations that the traditional deterministic Hill function inaccurately predicts time of repression by an order of two magnitudes. However, the stochastic Hill function was able to capture the fluctuations and thus accurately predicted the time of repression.

Penerapan Metode Hill Climbing Pada Sistem Informasi Geografis Untuk Mencari Lintasan Terpendek

Directory of Open Access Journals (Sweden)

Eka Vickraien Dangkua

2016-04-01

Full Text Available Heuristic search methods is one of the methods commonly in use in finding the shortest path, one of which, namely the methods Hill Climbing process where testing is done using heuristic functions. Problems generally encountered is the shortest path search to solve the problem of distance can be changed into a graph structure, where the point of declaring the city and the State line that connects the two cities. From the logic so that it can locate destinations and save on travel costs. The hallmarks of this algorithm are all possible solutions will have then checked one by one from the left side, so it will be obtained solutions with optimal results. On a Hill Climbing method according to case using geographic information systems as a tool in making a decision, by way of collect, examine, and analyze information related to digital map. with a combination of Hill Climbing method and geographic information systems can result in an application that is certainly feasible for use in the search path problems.   Keywords: Hill Climbin method; digital map; Geographic Information Systems

EnviroAtlas - Durham, NC - Demo (Parent)

Data.gov (United States)

U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

Water quality impacts from mining in the Black Hills, South Dakota, USA

International Nuclear Information System (INIS)

Rahn, P.H.; Davis, A.D.; Webb, C.J.; Nichols, A.D.

1996-01-01

The focus of this research was to determine if abandoned mines constitute a major environmental hazard in the Black Hills. Many abandoned gold mines in the Black Hills contribute acid and heavy metals to streams. In some areas of sulfide mineralization local impacts are severe, but in most areas the impacts are small because most ore deposits consist of small quartz veins with few sulfides. Pegmatite mines appear to have negligible effects on water due to the insoluble nature of pegmatite minerals. Uranium mines in the southern Black Hills contribute some radioactivity to surface water, but he impact is limited because of the dry climate and lack of runoff in that area. 26 refs

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

ORF Sequence: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

Sharing the Gift of Jazz: An Interview with Willie L. Hill Jr.

Science.gov (United States)

Howe, Brad

2011-01-01

This article presents an interview with Willie L. Hill Jr., founder and director of the Society for Jazz Education. Currently a professor of music education at the University of Massachusetts-Amherst and the director of the UMass Fine Arts Center, Hill has served as director of education for the Thelonious Monk Institute of Jazz. He is a past…

77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-09-17

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-10-24

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

ORF Sequence: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming

Science.gov (United States)

Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke

A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.

NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

Science.gov (United States)

Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua

2017-01-04

The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

Mammals of Kalimpong Hills, Darjeeling District, West Bengal, India

Directory of Open Access Journals (Sweden)

J.K. Mallick

2012-10-01

Full Text Available Neora Valley National Park (NVNP in the Kalimpong Hills, Darjeeling District, having a wide range of altitudinal variations (183-3,200 m and climatic conditions and forming an ecological trijunction with Sikkim and Bhutan, is the last virgin wilderness in West Bengal. It is a global hotspot for the unique ecosystem, where tropical, sub-tropical, temperate and sub-temperate forests represent a wealth of biodiversity including many threatened and rare mammals. It is the prime habitat of Ailurus fulgens (estimated population 28-32, Neofelis nebulosa (population unassessed, Ursus thibetanus (18, Bos gaurus (81, Hemitragus jemlahicus (32, Naemorhedus goral (73, Capricornis sumatraensis (89, Rusa unicolor (286, Muntiacus vaginalis (590 and Sus scrofa (615. Discovery of Panthera tigris (20 in 1998 prompted the forest department to include NVNP as a sensitive wildlife zone. Many authors recorded the mammalian diversity in Darjeeling District since the mid-nineteenth century, but most of them referred to the Darjeeling Hills. The documentations on Kalimpong Hills are scarce because of the dense canopy, thick undergrowth and inaccessible terrain, particularly in the pristine forests of Neora Valley. Consequently, a comprehensive compendium of the mammals in this region was not prepared. A study was undertaken in 2008-2009 with a view to bridging this knowledge-gap and presenting an updated account of the mammalian species in this new short-listed World Heritage Site and surrounding forests of the Kalimpong Hills based on literature review, questionnaire survey, direct sighting and indirect evidences. During June-October 1916, N.A. Baptista recorded 29 mammalian species (22 genera out of 563 specimens collected, from the region. The present study registered 99 species (68 genera after 94 years.

Micro-topography showing the landslide-origin of the Marumori hill, Matsukawa geothermal field Iwate Prefecture, Japan

Energy Technology Data Exchange (ETDEWEB)

Hashimoto, Tomomasa; Ikeda, Kazuo; Sumi, Seiai

1988-07-27

The Marumori Hill in the Matsukawa geothermal field has been previously considered to be a central cone or a lava dome in a caldera. Airphotogeological study, topographical surveying, and trenching are carried out in order to clarify the origin of the hill. Fifty six topographic linearments trending NE-SW direction distributed parallelly were detected on the top area and the northern flank of the hill. This linearment swarm is composed of the alternated small ranges and valleys with asymmetric profiles similar to cuesta topography. These topographic features are considered to be formed under the tensional stress field trending NW-SE direction on the surface of a landslide block. The hill is inferred to be not a lava dome but a landslide block which slide down from the steep scarp north and west of the hill. The age of the landslide is dated back to be older than 2400 years B.P. according to 14C age of the humic strata covering the hill. (7 figs, 1 tab, 14 refs)

precision deburring using NC and robot equipment. Final report

Energy Technology Data Exchange (ETDEWEB)

Gillespie, L.K.

1980-05-01

Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

"Beverly Hills 90210" : kes mida teeb / Tiina Lepiste

Index Scriptorium Estoniae

Lepiste, Tiina

2003-01-01

Aaron Spellingu produtseeritud ja 2000. aastal lõpetatud menuseriaalis "Beverly Hills 90210" osalenud näitlejate edaspidisest elust seoses plaaniga teha täispikk mängufilm "10 Year High School Reunion"

The prevalence of bullying and cyberbullying in high school: a 2011 survey.

Science.gov (United States)

Gan, Sophie S; Zhong, Connie; Das, Shreya; Gan, Julia S; Willis, Stephanie; Tully, Eileen

2014-01-01

Bullying is common among young students, and cyberbullying has increased due to the use of technology. This study investigates the prevalence of bullying and cyberbullying among high school students and the emotional effects of bullying on students. Students at East Chapel Hill High School, Chapel Hill, North Carolina completed the Gatehouse Bullying Scale and the Peer Relations Questionnaire. They answered questions regarding how often they had experienced certain types of bullying in school and the emotional effects the bullying had on them. The combined results from both surveys indicated that the prevalence of bullying was 55% with 18% of respondents reporting cyberbullying. Teasing and name-calling were the most common types of bullying, as 40% of students reported having been teased or called names. The most serious type of bullying, being threatened with harm, hit, or kicked, occurred in 20% of boys and 8% of girls, with 25% of respondents reported "quite upset" by the experience. The majority (79%) of students who had been bullied did not share with anyone about being bullied, and of those who did, only 50% were taken seriously. Bullying is still prevalent among high school students, and cyberbullying is becoming more widespread. Most victims do not share their bullying experience, and if they did, only half believe they are taken seriously. Both bullying among students in school and cyberbullying deserve attention due to their potentially devastating effects on victims.

ORF Sequence: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

Review of Barrow Hill: Curse of the Ancient Circle PC Game

OpenAIRE

Michael Charno

2007-01-01

Archaeological video games are few and far between. Internet Archaeology has reviewed a number of archaeologically-based computer applications, but none that in my opinion would fall under the video game category. Barrow Hill: Curse of the ancient circle from Shadow Tor Studios, is a video game…with archaeology in it. It would be a stretch to claim that Barrow Hill is actually an archaeological video game, but it does have an occasionally solid archaeological foundation and back story.

77 FR 5525 - Federal Property Suitable as Facilities to Assist the Homeless

Science.gov (United States)

2012-02-03

... soon as possible. For complete details concerning the processing of applications, the reader is... Kills Devil Hill NC 27948 Landholding Agency: Interior Property Number: 61201210002 Status: Unutilized...

ORF Sequence: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

Engine Of Innovation: Building the High Performance Catalog

Directory of Open Access Journals (Sweden)

Will Owen

2015-06-01

Full Text Available Numerous studies have indicated the sophisticated web-based search engines have eclipsed the primary importance of the library catalog as the premier tool for researchers in Higher education.  We submit that the catalog remains central to the research process.  Through a series of strategic enhancements, the University of North Carolina at Chapel Hill, in partnership with the other members of the Triangle Research Libraries Network, has made the catalog a carrier of services in addition to bibliographic data, facilitating not simply discovery but also delivery of the information researchers seek.

Structure and evolution of the Horse Heaven Hills in South-Central Washington

International Nuclear Information System (INIS)

Hagood, M.C.

1986-03-01

The purpose of this study is to describe the structure and evolution of the Horse Heaven Hills uplift at its abrupt structural transition. This was achieved by: (1) delineating the structure within the two trends as they approach the intersection; (2) determining the timing and location of uplift within each trend; (3) comparing and contrasting Miocene vertical growth rates along folds within both trends; and (4) imposing constraints for tectonic models that pertain to the genesis of the Horse Heaven Hills uplift. These objectives can only be fulfilled if the stratigraphy of the area is first delineated. Data from this study suggest that tectonic models that directly or indirectly pertain to the origin of the Horse Heaven Hills uplift may be constrained by: (1) the predominance of monoclinal or near-monoclinal fold geometries and reverse faults along both the northwest and northeast trends; (2) preliminary data which suggest clockwise rotation has occurred along folds of both trends; (3) folds along both trends developing simultaneously and at similar rates (at least during Wanapum and Saddle Mountains time); (4) folds along the northwest trend of the Horse Heaven Hills uplift being genetically related to and forming simultaneously with at least certain folds along the Rattlesnake-Wallula structural alignment; (5) the uplift developing simultaneously with the north-northwest-trending Hog Ranch-Naneum Ridge anticline as well as other Yakima folds during at least Columbia River Basalt Group time. It is proposed that folds of both trends of the Horse Heaven Hills uplift were generated by the same tectonic processes

De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences

DEFF Research Database (Denmark)

Ruzzo, Walter L; Gorodkin, Jan

2014-01-01

De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

ORF Sequence: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

Explicit flow equations and recursion operator of the ncKP hierarchy

International Nuclear Information System (INIS)

He, Jingsong; Wang, Lihong; Tu, Junyi; Li, Xiaodong

2011-01-01

The explicit expression of the flow equations of the noncommutative Kadomtsev–Petviashvili (ncKP) hierarchy is derived. Compared with the flow equations of the KP hierarchy, our result shows that the additional terms in the flow equations of the ncKP hierarchy indeed consist of commutators of dynamical coordinates {u i }. The recursion operator for the flow equations under n-reduction is presented. Further, under 2-reduction, we calculate a nonlocal recursion operator Φ(2) of the noncommutative Korteweg–de Vries(ncKdV) hierarchy, which generates a hierarchy of local, higher-order flows. Thus we solve the open problem proposed by Olver and Sokolov (1998 Commun. Math. Phys. 193 245–68)

Profiles in medical courage: causation and Austin Bradford Hill

Directory of Open Access Journals (Sweden)

Robbins RA

2012-09-01

Full Text Available Austin Bradford Hill was a British epidemiologist and statistician who is best remembered for two landmark pulmonary studies. He was the statistician on the Medical Research Council Streptomycin in Tuberculosis Trial. This is regarded as the first randomized clinical trial. The second was the demonstration of the connection between cigarette smoking and lung cancer. However, Hill’s most lasting contribution may be his establishment of a group of conditions necessary to provide adequate evidence of a causal relationship between an incidence and a consequence, widely known as the Bradford Hill Criteria of Causation. In this profile of medical courage we examine his remarkable background that led to the epidemiological equivalent of Koch’s postulates.

Testing the QCD string at large Nc from the thermodynamics of the hadronic phase

Science.gov (United States)

Cohen, Thomas D.

2007-02-01

It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

ORF Sequence: NC_001147 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

ORF Sequence: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

Review of Barrow Hill: Curse of the Ancient Circle PC Game

Directory of Open Access Journals (Sweden)

Michael Charno

2007-01-01

Full Text Available Archaeological video games are few and far between. Internet Archaeology has reviewed a number of archaeologically-based computer applications, but none that in my opinion would fall under the video game category. Barrow Hill: Curse of the ancient circle from Shadow Tor Studios, is a video game…with archaeology in it. It would be a stretch to claim that Barrow Hill is actually an archaeological video game, but it does have an occasionally solid archaeological foundation and back story.

2013 strategic petroleum reserve big hill well integrity grading report.

Energy Technology Data Exchange (ETDEWEB)

Lord, David L.; Roberts, Barry L.; Lord, Anna C. Snider; Bettin, Giorgia; Sobolik, Steven Ronald; Park, Byoung Yoon; Rudeen, David Keith; Eldredge, Lisa; Wynn, Karen; Checkai, Dean; Perry, James Thomas

2014-02-01

This report summarizes the work performed in developing a framework for the prioritization of cavern access wells for remediation and monitoring at the Big Hill Strategic Petroleum Reserve site. This framework was then applied to all 28 wells at the Big Hill site with each well receiving a grade for remediation and monitoring. Numerous factors affecting well integrity were incorporated into the grading framework including casing survey results, cavern pressure history, results from geomechanical simulations, and site geologic factors. The framework was developed in a way as to be applicable to all four of the Strategic Petroleum Reserve sites.

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

ORF Alignment: NC_006569 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

ORF Sequence: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

Solar heating and hot water system installed at Cherry Hill, New Jersey

Science.gov (United States)

1979-01-01

The solar heating and hot water system installed in existing buildings at the Cherry Hill Inn in Cherry Hill, New Jersey is described in detail. The system is expected to furnish 31.5% of the overall heating load and 29.8% of the hot water load. The collectors are liquid evacuated tube type. The storage system is an above ground insulated steel water tank with a capacity of 7,500 gallons.

Long-term changes in explosive and effusive behaviour at andesitic arc volcanoes: Chronostratigraphy of the Centre Hills Volcano, Montserrat

Science.gov (United States)

Coussens, Maya; Cassidy, Michael; Watt, Sebastian F. L.; Jutzeler, Martin; Talling, Peter J.; Barfod, Dan; Gernon, Thomas M.; Taylor, Rex; Hatter, Stuart J.; Palmer, Martin R.; Montserrat Volcano Observatory

2017-03-01

Volcanism on Montserrat (Lesser Antilles arc) has migrated southwards since the formation of the Silver Hills 2.5 Ma, and has formed three successively active volcanic centres. The Centre Hills volcano was the focus of volcanism from 1-0.4 Ma, before activity commenced at the currently active Soufrière Hills volcano. The history of activity at these two volcanoes provides an opportunity to investigate the pattern of volcano behaviour on an andesitic arc island over the lifetime of individual volcanoes. Here, we describe the pyroclastic stratigraphy of subaerial exposures around central Montserrat; identifying 11 thick (> 1 m) pumiceous units derived from sustained explosive eruptions of Centre Hills from 0.8-0.4 Ma. Over 10 other, less well- exposed pumiceous units have also been identified. The pumice-rich units are interbedded with andesite lava breccias derived from effusive, dome-forming eruptions of Centre Hills. The stratigraphy indicates that large (up to magnitude 5) explosive eruptions occurred throughout the history of Centre Hills, alongside effusive activity. This behaviour at Centre Hills contrasts with Soufrière Hills, where deposits from sustained explosive eruptions are much less common and restricted to early stages of activity at the volcano, from 175-130 ka. Subsequent eruptions at Soufriere Hills have been dominated by andesitic effusive eruptions. The bulk composition, petrography and mineral chemistry of volcanic rocks from Centre Hills and Soufrière Hills are similar throughout the history of both volcanoes, except for occasional, transient departures to different magma compositions, which mark shifts in vent location or dominant eruption style. For example, the final recorded eruption of Centre Hills, before the initiation of activity at Soufrière Hills, was more silicic than any other identified eruption on Montserrat; and the basaltic South Soufrière Hills episode marked the transition to the current stage of predominantly effusive

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

ORF Alignment: NC_003228 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

ORF Sequence: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003064 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Sequence: NC_001145 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

3D Modeling By Consolidation Of Independent Geometries Extracted From Point Clouds – The Case Of The Modeling Of The Turckheim's Chapel (Alsace, France

Directory of Open Access Journals (Sweden)

M. Koehl

2014-06-01

Full Text Available Turckheim is a small town located in Alsace, north-east of France. In the heart of the Alsatian vineyard, this city has many historical monuments including its old church. To understand the effectiveness of the project described in this paper, it is important to have a look at the history of this church. Indeed there are many historical events that explain its renovation and even its partial reconstruction. The first mention of a christian sanctuary in Turckheim dates back to 898. It will be replaced in the 12th century by a roman church (chapel, which subsists today as the bell tower. Touched by a lightning in 1661, the tower then was enhanced. In 1736, it was repaired following damage sustained in a tornado. In 1791, the town installs an organ to the church. Last milestone, the church is destroyed by fire in 1978. The organ, like the heart of the church will then have to be again restored (1983 with a simplified architecture. From this heavy and rich past, it unfortunately and as it is often the case, remains only very few documents and information available apart from facts stated in some sporadic writings. And with regard to the geometry, the positioning, the physical characteristics of the initial building, there are very little indication. Some assumptions of positions and right-of-way were well issued by different historians or archaeologists. The acquisition and 3D modeling project must therefore provide the current state of the edifice to serve as the basis of new investigations and for the generation of new hypotheses on the locations and historical shapes of this church and its original chapel (Fig. 1

Improving medication adherence of patients with chronic heart failure: challenges and solutions

Directory of Open Access Journals (Sweden)

Shah D

2015-07-01

Full Text Available Deval Shah,1 Kim Simms,2 Debra J Barksdale,3 Jia-Rong Wu3 1Internal Medicine, Wake Forest Baptist Hospital, Winston-Salem, 2Duke University Hospital, Durham, 3School of Nursing, University of North Carolina, Chapel Hill, NC, USA Abstract: Heart failure is a chronic debilitating illness that affects 5.7 million Americans. The financial burden of heart failure in the US toppled $31 billion in 2012, which is one of the highest among all chronic medical conditions. Medication adherence is a major component of heart failure self-care behaviors. Therefore, medication non-adherence is associated with more emergency department visits, frequent rehospitalizations, and higher medical cost. Medication adherence rates have varied from 10% to 98% depending on the definition and measurement used to assess and analyze adherence. Many factors contribute to medication non-adherence such as lack of support, finances, absent of symptoms, cognitive decline, adverse reactions, depression, poor attention span, poor knowledge about medication, multiple medications, difficulty swallowing large pills, and inconveniences of urinary frequency with diuretics. Researchers have explored various strategies such as the use of pharmacists, nurses, telemedicine, and interdisciplinary teams to provide interventions to improve medication adherence in heart failure. Health care providers should continue to provide education, constantly reinforce the importance of taking medication as prescribed, and when feasible, utilize one of the successful evidence-based strategies to increase adherence. Keywords: pharmacy, tele-health, interdisciplinary, registered nurse, interventions

Optimal breast cancer screening strategies for older women: current perspectives

Directory of Open Access Journals (Sweden)

Braithwaite D

2016-02-01

Full Text Available Dejana Braithwaite,1 Joshua Demb,1 Louise M Henderson2 1Department of Epidemiology and Biostatistics, University of California, San Francisco, CA, 2Department of Radiology, University of North Carolina, Chapel Hill, NC, USA Abstract: Breast cancer is a major cause of cancer-related deaths among older women, aged 65 years or older. Screening mammography has been shown to be effective in reducing breast cancer mortality in women aged 50–74 years but not among those aged 75 years or older. Given the large heterogeneity in comorbidity status and life expectancy among older women, controversy remains over screening mammography in this population. Diminished life expectancy with aging may decrease the potential screening benefit and increase the risk of harms. In this review, we summarize the evidence on screening mammography utilization, performance, and outcomes and highlight evidence gaps. Optimizing the screening strategy will involve separating older women who will benefit from screening from those who will not benefit by using information on comorbidity status and life expectancy. This review has identified areas related to screening mammography in older women that warrant additional research, including the need to evaluate emerging screening technologies, such as tomosynthesis among older women and precision cancer screening. In the absence of randomized controlled trials, the benefits and harms of continued screening mammography in older women need to be estimated using both population-based cohort data and simulation models. Keywords: aging, breast cancer, precision cancer screening

A clinical review of recent findings in the epidemiology of inflammatory bowel disease

Directory of Open Access Journals (Sweden)

Ponder A

2013-07-01

Full Text Available Alexis Ponder, Millie D LongDepartment of Medicine, University of North Carolina, Chapel Hill, NC, USAAbstract: Inflammatory bowel diseases (IBD, including both Crohn’s disease and ulcerative colitis, are disorders of chronic inflammation of the gastrointestinal tract marked by episodes of relapse and remission. Over the past several decades, advances have been made in understanding the epidemiology of IBD. The incidence and prevalence of both Crohn’s disease and ulcerative colitis have been increasing worldwide across pediatric and adult populations. As IBD is thought to be related to a combination of individual genetic susceptibility, environmental triggers, and alterations in the gut microbiome that stimulate an inflammatory response, understanding the potentially modifiable environmental risk factors associated with the development or the course of IBD could impact disease rates or management in the future. Current hypotheses as to the development of IBD are reviewed, as are a host of environmental cofactors that have been investigated as both protective and inciting factors for IBD onset. Such environmental factors include breast feeding, gastrointestinal infections, urban versus rural lifestyle, medication exposures, stress, smoking, and diet. The role of these factors in disease course is also reviewed. Looking forward, there is still much to be learned about the etiology of IBD and how specific environmental exposures intimately impact the development of disease and also the potential for relapse.Keywords: clinical epidemiology, inflammatory bowel disease, environmental risk factors

Stigma experiences in youth with facial differences: a multi-site study of adolescents and their mothers.

Science.gov (United States)

Strauss, Ronald P; Ramsey, Barry L; Edwards, Todd C; Topolski, Tari D; Kapp-Simon, Kathy A; Thomas, Christopher R; Fenson, Carla; Patrick, Donald L

2007-05-01

To describe stigma experiences of adolescents with congenital and acquired facial differences. Used baseline cross-sectional stigma-related responses from a four site (Seattle WA, Galveston TX, Chicago IL and Chapel Hill NC) US study enrolling 185 English speaking, US participants ages 1118 years old with facial differences (60% male; 80% congenital conditions). Closed-ended, self-administered questions drawn from the Youth Quality of Life Instrument Facial Differences Module (YQOL-FD) determined perceptions of stigmatization. Mothers (n=153) were independently asked seven matching questions. Frequencies report combined responses of 'sometimes,' 'fairly often,' and 'very often.' Mother's responses are in parentheses. *35% (47%) noticed people staring at their face in the past week. * 28% (43%) talked with others about how their face looks in the past month. * 29% (31%) heard others say something about their face in the past month. * 32% (32%) told peers about their facial difference in the past month. * 12% (12%) felt left out of doing things with peers because of how their face looks in the past month. * 11% (8%) got into a fight because of how their face looks in the past month. * 20% (18%) were teased about how their face looks in the past month. Stigma experiences were frequently reported by youth with facial differences and were correlated with independent parental report. This level of stigma suggests that media and public health interventions may be warranted to reduce discrimination, prejudice and negative adolescent social experiences related to facial difference.

Gender, professionalization, and the child in the Progressive Era: Patty Smith Hill, 1868-1946.

Science.gov (United States)

Allen, Ann Taylor

2011-01-01

This article discusses the career of Patty Smith Hill, a major figure in the American kindergarten movement, in the context of the Progressive Era in American history. Hill, an educator and child-welfare activist, became known both as a reformer of early-childhood education and as an advocate of the inclusion of the kindergarten, originally a private institution, in public-school systems. The article acknowledges this as one of the most significant achievements of the woman-led reform movements of the Progressive Era, but at the same time notes that it involved a substantial transfer of power from the women who had originally developed the kindergarten to the male principals and superintendants who now supervised kindergarten teachers, often without much understanding of their distinctive methods and aims. As a professor at Columbia Teachers College, Hill also exercised an international influence. Hill's career exemplifies broader patterns of women's professionalization during the late-nineteenth and early-twentieth centuries.

Outcomes of arthroscopic "Remplissage": capsulotenodesis of the engaging large Hill-Sachs lesion

Directory of Open Access Journals (Sweden)

Mayo Lee

2011-06-01

Full Text Available Abstract Background A Hill-Sachs lesion of the humeral head after a shoulder dislocation is clinically insignificant in most cases. However, a sizable defect will engage with the anterior rim of the glenoid and cause instability even after anterior glenoid reconstruction. The purpose of this study was to evaluate the outcome of arthroscopic capsulotenodesis of the posterior capsule and infraspinatus tendon ("remplissage" to seal a large engaging Hill-Sachs lesion in an unstable shoulder. Methods This was a prospective follow-up study of patients who underwent arthroscopic surgery for recurrent shoulder instability with a large engaging Hill-Sachs lesion from 2007 to 2009. The clinical results were measured preoperatively and postoperatively with the Simple Shoulder test (SST and the Rowe score for instability. Results Eleven patients met the inclusion criteria of this study. The mean follow-up time was 30 months (range 24 to 35 months. At the last follow-up, significant improvement was observed in both scores with no recurrent dislocations. The mean SST improved from 6.6 to 11 (p Conclusions Arthroscopic remplissage for shoulder instability is an effective soft tissue technique to seal a large engaging Hill-Sachs lesion with respect to recurrence rate, range of motion and shoulder function.

46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

ORF Alignment: NC_006371 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

Topographical Hill Shading Map Production Based Tianditu (map World)

Science.gov (United States)

Wang, C.; Zha, Z.; Tang, D.; Yang, J.

2018-04-01

TIANDITU (Map World) is the public version of National Platform for Common Geospatial Information Service, and the terrain service is an important channel for users on the platform. With the development of TIANDITU, topographical hill shading map production for providing and updating global terrain map on line becomes necessary for the characters of strong intuition, three-dimensional sense and aesthetic effect. As such, the terrain service of TIANDITU focuses on displaying the different scales of topographical data globally. And this paper mainly aims to research the method of topographical hill shading map production globally using DEM (Digital Elevation Model) data between the displaying scales about 1 : 140,000,000 to 1 : 4,000,000, corresponded the display level from 2 to 7 on TIANDITU website.

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_002929 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

ORF Alignment: NC_003296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

Soils of wet valleys in the Larsemann Hills and Vestfold Hills oases (Princess Elizabeth Land, East Antarctica)

Science.gov (United States)

Mergelov, N. S.

2014-09-01

The properties and spatial distribution of soils and soil-like bodies in valleys of the coastal Larsemann Hills and Vestfold Hills oases—poorly investigated in terms of the soil areas of East Antarctica—are discussed. In contrast to Dry Valleys—large continental oases of Western Antarctica—the studied territory is characterized by the presence of temporarily waterlogged sites in the valleys. It is argued that the deficit of water rather than the low temperature is the major limiting factor for the development of living organisms and the pedogenesis on loose substrates. The moisture gradients in the surface soil horizons explain the spatial distribution of the different soils and biotic complexes within the studied valleys. Despite the permanent water-logging of the deep suprapermafrost horizons of most of the soils in the valleys, no gley features have been identified in them. The soils of the wet valleys in the Larsemann Hills oasis do not contain carbonates. They have a slightly acid or neutral reaction. The organic carbon and nitrogen contents are mainly controlled by the amount of living and dead biomass rather than by the humic substances proper. The larger part of the biomass is concentrated inside the mineral soil matrix rather than on the soil surface. The stresses caused by surface drying, strong winds, and ultraviolet radiation prevent the development of organisms on the surface of the soil and necessitate the search for shelter within the soil fine earth material (endoedaphic niche) or under the gravelly pavement (hypolithic niche). In the absence of higher plants, humified products of their decomposition, and rainwater that can wash the soil profile and upon the low content of silt and clay particles in the soil material, "classical" soil horizons are not developed. The most distinct (and, often, the only diagnosed) products of pedogenesis in these soils are represented by organomineral films on the surface of mineral particles.

Medical Surveillance Monthly Report (MSMR). Volume 19, Number 3, March 2012

Science.gov (United States)

2012-03-01

injury events (Parris Island/Beaufort, SC [n=899], MCB Camp Lejeune/Cherry Point, NC [n=659], Fort Polk, LA [n=555], Fort Cambell , KY [n=508]). Of the...7.7 MCB Camp Lejuene/ Cherry Hill, NC 659 5.7 Fort Polk, LA 555 4.8 Fort Cambell , KY 508 4.4 Camp Pendleton, CA 336 2.9 Fort Hood, TX 330 2.8 Fort

New records of Athyma whitei Tytler, 1940 (Lepidoptera: Nymphalidae: Limenitidinae from northeastern India: a recently reported species from India

Directory of Open Access Journals (Sweden)

M.Y. Gogoi

2014-08-01

Full Text Available Tytler’s Sergeant, Atyma whitei was described by Tytler from Chin Hills, Myanmar in 1940. The taxon was not reported in India untill the record from Phura, Mizoram in November 2012. Recent surveys in northeastern India recorded the species four times in the forest of North Cachar (N.C. Hills and E. Jaintia Hills. The new sightings are approximately 223km from Chin-type locality. These recent records of the rare insect gives an insight into the distribution range and habitat of the rare taxon in northeast India.

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006349 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

ORF Alignment: NC_000964 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

ORF Alignment: NC_002570 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_003237 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

ORF Alignment: NC_006395 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

ORF Alignment: NC_002771 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Sequence: NC_001141 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_002976 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

ORF Alignment: NC_002951 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

ORF Alignment: NC_006087 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

ORF Alignment: NC_004603 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

ORF Alignment: NC_004331 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

ORF Alignment: NC_003366 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

ORF Alignment: NC_003485 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

ORF Alignment: NC_002737 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

ORF Alignment: NC_000853 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin

ORF Alignment: NC_002944 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

ORF Alignment: NC_000117 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

ORF Alignment: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

ORF Alignment: NC_004722 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

ORF Alignment: NC_002952 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

ORF Alignment: NC_000921 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

ORF Alignment: NC_006348 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

ORF Alignment: NC_006350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

77 FR 70162 - Ocean Transportation Intermediary License Applicants

Science.gov (United States)

2012-11-23

...), 900 Center Park Drive, Suite F, Charlotte, NC 28217, Officers: Paul L. Carter, Vice President (QI...), Application Type: New NVO License. Transport Partner (USA), Inc. (NVO & OFF), 2006 Cherry Hill Lane...

Three-dimensional computed tomography measurement accuracy of varying Hill-Sachs lesion size.

Science.gov (United States)

Ho, Anthony; Kurdziel, Michael D; Koueiter, Denise M; Wiater, J Michael

2018-02-01

The glenoid track concept has been proposed to correlate shoulder stability with bone loss. Accurate assessment of Hill-Sachs lesion size preoperatively may affect surgical planning and postoperative outcomes; however, no measurement method has been universally accepted. This study aimed to assess the accuracy and reliability of measuring Hill-Sachs lesion sizes using 3-dimensional (3D) computed tomography (CT). Nine polyurethane humerus bone substitutes were used to create Hill-Sachs lesions of varying sizes with a combination of lesion depth (shallow, intermediate, and deep) and width (small, medium, and large). Specimens were scanned with a clinical CT scanner for size measurements and a micro-CT scanner for measurement of true lesion size. Six evaluators repeated measurements twice in a 2-week interval. Scans were measured by use of 3D CT reconstructions for length, width, and Hill-Sachs interval and with use of 2D CT for depth. The interclass correlation coefficient evaluated interobserver and intraobserver variability and percentage error, and Student t-tests assessed measurement accuracy. Interclass correlation coefficient reliability demonstrated strong agreement for all variables measured (0.856-0.975). Percentage error between measured length and measured depth and the true measurement significantly varied with respect to both lesion depth (P = .003 and P = .005, respectively) and lesion size (P = .049 and P = .004, respectively). The 3D CT imaging is effective and reproducible in determining lesion size. Determination of Hill-Sachs interval width is also reliable when it is applied to the glenoid track concept. Measured values on 3D and 2-dimensional imaging using a conventional CT scanner may slightly underestimate true measurements. Copyright © 2017 Journal of Shoulder and Elbow Surgery Board of Trustees. Published by Elsevier Inc. All rights reserved.

Assessment of Groundwater Resources in Kirana Hills Region, Rabwah, District Chiniot, Pakistan

Directory of Open Access Journals (Sweden)

Mirza Naseer Ahmad

2016-12-01

Full Text Available This study was planned to assess the groundwater quality of the area adjacent to Precambrian Kirana Hills, Pakistan. The majority of the people in the area use groundwater from private wells for drinking and domestic use. Therefore, it is important to provide an overview of the groundwater quality. This information would be beneficial to local people and the administration for selecting suitable water treatment methods. Samples were collected from different wells of Rabwah town, close to the Kirana Hills. Parameters like EC, pH, alkalinity and total dissolved solids (TDS were determined for 142 samples. While 40 samples were analyzed for hardness, Ca, Mg, Cl, SO4, NO3, and F. standards set by the World Health Organization (WHO were considered to evaluate the quality of groundwater. Geographic Information System (GIS was used to interpolate analyzed physicochemical parameters. The results showed that EC, TDS, hardness, Cl, SO4, and Ca were very high in the water samples of the area. Fifty-two percent of samples had pH values lower than the permissible limits. Results suggest that the water quality is extremely adverse close to the hills. The poor water quality in the area near the hills may be due to the limited recharge of aquifers because of the hills and shallow basement, which may act as a barrier to subsurface water movement. Some physical and chemical parameters indicated that the quality of water at deeper levels (i.e. >150 ft is relatively better. This may be due to limited exploitation of water from deeper aquifers as compared to shallow aquifers. Hence, proper aquifer management is required to prevent water quality deterioration due to over exploiataion. NO3 was found within the acceptable limits and all water samples were found free of any significant contamination by human activities.

78 FR 21098 - Black Hills National Forest Advisory Board

Science.gov (United States)

2013-04-09

... Hills National Forest Advisory Board (Board) will meet in Rapid City South Dakota. The Board is... staff before the meeting. The agenda will include time for people to make oral statements of three...

Stormwater Management Plan for the Arden Hills Army Training Site, Arden Hills, Minnesota

Energy Technology Data Exchange (ETDEWEB)

Carr, Adrianne E. [Argonne National Lab. (ANL), Argonne, IL (United States); Wuthrich, Kelsey K. [Argonne National Lab. (ANL), Argonne, IL (United States); Ziech, Angela M. [Argonne National Lab. (ANL), Argonne, IL (United States); Bowen, Esther E. [Argonne National Lab. (ANL), Argonne, IL (United States); Quinn, John [Argonne National Lab. (ANL), Argonne, IL (United States)

2013-03-01

This stormwater management plan focuses on the cantonment and training areas of the Arden Hills Army Training Site (AHATS). The plan relates the site stormwater to the regulatory framework, and it summarizes best management practices to aide site managers in promoting clean site runoff. It includes documentation for a newly developed, detailed model of stormwater flow retention for the entire AHATS property and adjacent upgradient areas. The model relies on established modeling codes integrated in a U.S. Department of Defense-sponsored software tool, the Watershed Modeling System (WMS), and it can be updated with data on changes in land use or with monitoring data.

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

ORF Alignment: NC_004350 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

ORF Alignment: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

ORF Alignment: NC_003317 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

ORF Alignment: NC_003232 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

ORF Alignment: NC_003071 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...