WorldWideScience

Sample records for chapel hill nc

  1. Parks of Chapel Hill

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Hours, location, and amenity information for Chapel Hill parks as shown on the Town of Chapel Hill's website. Includes a map with points for each park location.

  2. Public Computer Usage in Chapel Hill Public Library

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Data collected November 2014 - May 2016. As of June 2016, this data is no longer collected on a continual basis.This dataset includes frequency and length of use of...

  3. CT features of vasculitides based on the 2012 international chapel hill consensus conference revised classification

    International Nuclear Information System (INIS)

    Hur, Jee Hye; Chun, Eun Ju; Kim, Hae Young; Kim, Jeong Jae; Lee, Kyung Won; Kwang, Hyon Joo; Yoo, Jin Young

    2017-01-01

    Vasculitis, characterized by inflammation of vessel walls, is comprised of heterogeneous clinicopathological entities, and thus poses a diagnostic challenge. The most widely used approach for classifying vasculitides is based on the International Chapel Hill Consensus Conference (CHCC) nomenclature system. Based on the recently revised CHCC 2012, we propose computed tomography (CT) features of vasculitides and a differential diagnosis based on location and morphological characteristics. Finally, vasculitis mimics should be differentiated, because erroneous application of immunosuppressive drugs on vasculitis mimics may be ineffective, even deteriorating. This article presents the utility of CT in the diagnosis and differential diagnosis of vasculitides

  4. CT features of vasculitides based on the 2012 international chapel hill consensus conference revised classification

    Energy Technology Data Exchange (ETDEWEB)

    Hur, Jee Hye; Chun, Eun Ju; Kim, Hae Young; Kim, Jeong Jae; Lee, Kyung Won [Dept. of Radiology, Seoul National University Bundang Hospital, Seongnam (Korea, Republic of); Kwang, Hyon Joo [Dept. of Radiology, Kangbuk Samsung Hospital, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Yoo, Jin Young [Dept. of Radiology, Seoul National University Hospital, Seoul (Korea, Republic of)

    2017-09-15

    Vasculitis, characterized by inflammation of vessel walls, is comprised of heterogeneous clinicopathological entities, and thus poses a diagnostic challenge. The most widely used approach for classifying vasculitides is based on the International Chapel Hill Consensus Conference (CHCC) nomenclature system. Based on the recently revised CHCC 2012, we propose computed tomography (CT) features of vasculitides and a differential diagnosis based on location and morphological characteristics. Finally, vasculitis mimics should be differentiated, because erroneous application of immunosuppressive drugs on vasculitis mimics may be ineffective, even deteriorating. This article presents the utility of CT in the diagnosis and differential diagnosis of vasculitides.

  5. A Healthy Mix: A Case Study of the University of North Carolina at Chapel Hill's Interdisciplinary Health Communication Certificate Program

    Science.gov (United States)

    El-Toukhy, Sherine; Holman, Lynette

    2012-01-01

    This study evaluated attitudes toward interdisciplinary education by appraising the Interdisciplinary Health Communication (IHC) Certificate program at the University of North Carolina at Chapel Hill as a case study. Sixteen affiliated faculty and thirteen students enrolled in the IHC program as of 2008-2009 were surveyed. Although the attitude…

  6. Chapel Hill bisphenol A expert panel consensus statement: Integration of mechanisms, effects in animals and potential to impact human health at current levels of exposure

    Science.gov (United States)

    vom Saal, Frederick S.; Akingbemi, Benson T.; Belcher, Scott M.; Birnbaum, Linda S.; Crain, D. Andrew; Eriksen, Marcus; Farabollini, Francesca; Guillette, Louis J.; Hauser, Russ; Heindel, Jerrold J.; Ho, Shuk-Mei; Hunt, Patricia A.; Iguchi, Taisen; Jobling, Susan; Kanno, Jun; Keri, Ruth A.; Knudsen, Karen E.; Laufer, Hans; LeBlanc, Gerald A.; Marcus, Michele; McLachlan, John A.; Myers, John Peterson; Nadal, Angel; Newbold, Retha R.; Olea, Nicolas; Prins, Gail S.; Richter, Catherine A.; Rubin, Beverly S.; Sonnenschein, Carlos; Soto, Ana M.; Talsness, Chris E.; Vandenbergh, John G.; Vanderberg, Laura N.; Walser-Kuntz, Debby R.; Watson, Cheryl S.; Welshons, Wade V.; Wetherill, Yelena; Zoeller, R. Thomas

    2007-01-01

    This document is a summary statement of the outcome from the meeting: “Bisphenol A: An Examination of the Relevance of Ecological, In vitro and Laboratory Animal Studies for Assessing Risks to Human Health” sponsored by both the NIEHS and NIDCR at NIH/DHHS, as well as the US-EPA and Commonweal on the estrogenic environmental chemical bisphenol A (BPA, 2,2-bis(4-hydroxyphenyl)propane; CAS# 80-05-7). The meeting was held in Chapel Hill, NC, 28–30 November 2006 due to concerns about the potential for a relationship between BPA and negative trends in human health that have occurred in recent decades. Examples include increases in abnormal penile/urethra development in males, early sexual maturation in females, an increase in neurobehavioral problems such as attention deficit hyperactivity disorder (ADHD) and autism, an increase in childhood and adult obesity and type 2 diabetes, a regional decrease in sperm count, and an increase in hormonally mediated cancers, such as prostate and breast cancers. Concern has been elevated by published studies reporting a relationship between treatment with “low doses” of BPA and many of theses negative health outcomes in experimental studies in laboratory animals as well as in vitro studies identifying plausible molecular mechanisms that could mediate such effects. Importantly, much evidence suggests that these adverse effects are occurring in animals within the range of exposure to BPA of the typical human living in a developed country, where virtually everyone has measurable blood, tissue and urine levels of BPA that exceed the levels produced by doses used in the “low dose” animal experiments.

  7. Explaining the salience of anti-elitism and reducing political corruption for political parties in Europe with the 2014 Chapel Hill Expert Survey data

    Directory of Open Access Journals (Sweden)

    Jonathan Polk

    2017-01-01

    Full Text Available This article addresses the variation of anti-corruption and anti-elite salience in party positioning across Europe. It demonstrates that while anti-corruption salience is primarily related to the (regional context in which a party operates, anti-elite salience is primarily a function of party ideology. Extreme left and extreme conservative (TAN parties are significantly more likely to emphasize anti-elite views. Through its use of the new 2014 Chapel Hill Expert Survey wave, this article also introduces the dataset.

  8. Fostering Under-represented Minority Student Success and Interest in the Geosciences: Outcomes of the UNC-Chapel Hill Increasing Diversity and Enhancing Academia (IDEA) Program

    Science.gov (United States)

    Hughes, M. H.; Gray, K.; Drostin, M.

    2016-12-01

    For under-represented minority (URM) students, opportunities to meaningfully participate in academic communities and develop supportive relationships with faculty and peers influence persistence in STEM majors (Figueroa, Hurtado, & Wilkins, 2015; PCAST, 2012; Tsui, 2007). Creating such opportunities is even more important in the geosciences, where a lower percentage of post-secondary degrees are awarded to URM students than in other STEM fields (NSF, 2015; O'Connell & Holmes, 2011; NSF, 2011). Since 2011, Increasing Diversity and Enhancing Academia (IDEA), a program of the UNC-Chapel Hill Institute for the Environment (UNC-IE), has provided 39 undergraduates (predominantly URM and female students) with career-relevant research experiences and professional development opportunities, including a culminating experience of presenting their research at a campus-wide research symposium. External evaluation data have helped to characterize the effectiveness of the IDEA program. These data included pre- and post-surveys assessing students' interest in geosciences, knowledge of career pathways, and perceptions of their abilities related to a specific set of scientific research skills. Additionally, progress towards degrees and dissemination outcomes were tracked. In this presentation, we will share quantitative and qualitative data that demonstrate that participation in the IDEA program has influenced students' interest and persistence in geosciences research and careers. These data range from self-reported competencies in a variety of scientific skills (such as organizing and interpreting data and reading and interpreting science literature) to documentation of student participation in geoscience study and professions. About 69% of participants continued research begun during their internships beyond the internship; and about 38% pursued graduate degrees and secured jobs in geoscience and other STEM fields. (Nearly half are still in school.) Overall, these evaluation data

  9. PRESENTED AT TRIANGLE CONSORTIUM FOR REPRODUCTIVE BIOLOGY MEETING IN CHAPEL HILL, NC ON 2/11/2006: SPERM COUNT DISTRIBUTIONS IN FERTILE MEN

    Science.gov (United States)

    Sperm concentration and count are often used as indicators of environmental impacts on male reproductive health. Existing clinical databases may be biased towards sub-fertile men with low sperm counts and less is known about expected sperm count distributions in cohorts of ferti...

  10. Addresses

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Point features representing locations of all street addresses in Orange County, NC including Chapel Hill, NC. Data maintained by Orange County, the Town of Chapel...

  11. The Secret Life of Quarks, Final Report for the University of North Carolina at Chapel Hill

    Energy Technology Data Exchange (ETDEWEB)

    Fowler, Robert J. [Univ. of North Carolina, Chapel Hill, NC (United States)

    2012-12-10

    This final report summarizes activities and results at the University of North Carolina as part of the the SciDAC-2 Project The Secret Life of Quarks: National Computational Infrastructure for Lattice Quantum Chromodynamics. The overall objective of the project is to construct the software needed to study quantum chromo- dynamics (QCD), the theory of the strong interactions of subatomic physics, and similar strongly coupled gauge theories anticipated to be of importance in the LHC era. It built upon the successful efforts of the SciDAC-1 project National Computational Infrastructure for Lattice Gauge Theory, in which a QCD Applications Programming Interface (QCD API) was developed that enables lat- tice gauge theorists to make effective use of a wide variety of massively parallel computers. In the SciDAC-2 project, optimized versions of the QCD API were being created for the IBM Blue- Gene/L (BG/L) and BlueGene/P (BG/P), the Cray XT3/XT4 and its successors, and clusters based on multi-core processors and Infiniband communications networks. The QCD API is being used to enhance the performance of the major QCD community codes and to create new applications. Software libraries of physics tools have been expanded to contain sharable building blocks for inclusion in application codes, performance analysis and visualization tools, and software for au- tomation of physics work flow. New software tools were designed for managing the large data sets generated in lattice QCD simulations, and for sharing them through the International Lattice Data Grid consortium. As part of the overall project, researchers at UNC were funded through ASCR to work in three general areas. The main thrust has been performance instrumentation and analysis in support of the SciDAC QCD code base as it evolved and as it moved to new computation platforms. In support of the performance activities, performance data was to be collected in a database for the purpose of broader analysis. Third, the UNC work was done at RENCI (Renaissance Computing Institute), which has extensive expertise and facilities for scientific data visualization, so we acted in an ongoing consulting and support role in that area.

  12. Look What We Got! How Inherited Data Drives Decision-Making: UNC-Chapel Hill’s 19th-Century American Sheet Music Collection

    Directory of Open Access Journals (Sweden)

    Renée McBride

    2011-04-01

    Full Text Available Have you inherited a digital collection containing valuable, but inconsistent metadata? And wondered how to transform it into a usable, quality resource while accepting that it can’t meet your idea of perfection? This article describes such an experience at the University of North Carolina at Chapel Hill University Library with its CONTENTdm-based 19th-Century American Sheet Music Collection, addressing issues such as field construction, the use of controlled vocabularies, development of a project data dictionary, and metadata clean-up.

  13. Archaeological Investigations at the Upper Chapel, Norfolk Street, Sheffield, UK

    Directory of Open Access Journals (Sweden)

    Katherine Baker

    2011-02-01

    Full Text Available Sheffield, in the north of England, grew rapidly in the 19th century and gained an international reputation for its cutlery, tableware, and steel products. The material legacy of this age of industrialisation is extensive, and archaeological work in the modern city over the last 20 years has, for the most part, focused on the above and below ground industrial archaeology relating to metals trades' production sites spanning the 19th and 20th centuries. This article describes recent archaeological work around the Upper Chapel, a Unitarian Meeting House in the city centre where archaeological work recovered a possible buried medieval soil deposit, which contained an assemblage of medieval pottery dating from the 12th to 15th centuries. The presence of waster sherds and fragments of kiln furniture within this assemblage suggests that pottery production may have taken place on or near the site, making this the first putative evidence for pottery production in medieval Sheffield. The archaeological investigations also recovered four human burials from the 18th- to 19th-century burial ground associated with the Upper Chapel. The Upper Chapel burial ground differs from other recently excavated cemeteries in Sheffield as it potentially contained graves of high-status individuals, with at least a proportion of the skeletons and coffins well-preserved owing to waterlogged ground conditions. Detailed studies of the human remains, coffins, and incorporated material, including brass shroud pins are also discussed.

  14. Library Programs in North Carolina

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Count of programs offered and program attendance numbers at public libraries in North CarolinaData is from the 2014-15 NC Statistical Report of NC Public Libraries:...

  15. Loess Hills of Iowa

    Data.gov (United States)

    Iowa State University GIS Support and Research Facility — This coverage outlines the boundary of the Loess Hills in Iowa at 1:100,000 scale. Criteria applied to the delineation of the Loess Hills included drainage density,...

  16. Ergonomics and cultural heritage: the Palatina chapel in Palermo, Italy

    Directory of Open Access Journals (Sweden)

    Salvatore Barbaro

    2007-07-01

    Full Text Available The present article presents results of a study that aims at the assessment of ergonomic safety conditions inside the Palatina chapel of Palermo. To reach this object, an informative questionnaire was established so as to collect visitors’ subjective judgments regarding overall ergonomic conditions in terms of accessibility, availability, safety or else environmental conditions (thermo-hygrometry; air, sound and visual quality; this stage was carried out, bearing in mind the Museum Visitors’ Rights Card that is currently under creation by the “Legambiente” group. An automatic instrument was bought to daily count the numbers of visitors; the latter element shall then be related to indoor environmental data registered thanks to a monitoring system of thermohygrometry, illuminating engineering and environmental aggressiveness.

  17. Chapel of cemetery church of all saints in Sedlec - Long-term analysis of hygrothermal conditions

    Science.gov (United States)

    Pavlík, Zbyšek; Balík, Lukáš; Kudrnáčová, Lucie; Maděra, Jiří; Černý, Robert

    2017-07-01

    In this paper, long-term monitoring of hygrothermal conditions of the chapel of the cemetery church of All Saints in Sedlec, Czech Republic is presented as a practical tool for evaluation of functional problems of the researched structure. Within the performed experimental tests, interior and exterior climatic conditions were monitored over one year period. Herewith, surface temperature of the chapel wall was measured. Exterior climatic data were collected using weather station Vantage Pro2 placed in church tower. In interior, precise combined relative humidity/temperature sensors were installed. Based on the accessed hygrothermal state of the inspected chapel and identified periods of possible surface condensation, service conditions of the chapel will be optimized in order to prevent extensive damage of historically valuable finishing and furnishing materials, paintings, plasters, and architectural ornaments.

  18. The paintings in the chapels of the Camaldolese church in Bielany and its significance for the Krakow art in the 1st half of the 17th century (the Royal Chapel and St Romuald's Chapel

    Directory of Open Access Journals (Sweden)

    Jerzy Żmudziński

    2011-12-01

    Full Text Available The enormous significance of the Bielany hermitage in the history of Polish art of the transition period between Mannerism and Baroque has long been rightly acknowledged. However, such appreciation concerns primarily architecture and decorations (stuccoes, and to a lesser extent paintings. Studies on the Polish art of the 1st half of the 17th century have repeatedly mentioned the paintings in the Bielany chapels, albeit they were mostly limited to the statement that some decorations are the work of Venetian painter Tommaso Dolabella and his followers (paintings in the Royal and St Romuald's Chapels and illustrate, as it were, the artist's 'decline', who, having arrived in Poland in the late 17th century, in time abandoned the glorious tradition of the grand Venetian school of the Mannerism epoch, lowered the standard of his artistic output and in a way became "Sarmatised", catering to the taste and expectations of the locals. The authorship of the paintings in the two most prominent chapels of the Bielany church was attributed to Dolabella, his students and followers. The thesis of "Sarmatisation" and the lowering of standards in his work has recently been critically analysed, as the artist's authenticated works from the Royal Chapel have been referred to and "vindicated".

  19. Fulltext PDF

    Indian Academy of Sciences (India)

    client1

    Salt Lake City, UT, USA. Sir Martin J Evans – Cardiff University, Cardiff, United Kingdom. Oliver Smithies – University of North Carolina at Chapel Hill, Chapel Hill, NC, USA. Peace. “for their efforts to build up and disseminate greater knowledge about man-made climate change, and to lay the foundations for the measures ...

  20. Unmet Need for Contraception among Clients of FP/HIV Integrated ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    1 Department of Maternal and Child Health, Gillings School of Global Public Health, University of North Carolina at Chapel Hill,. Chapel Hill, NC 27599, USA; .... observational learning, and facilitation11. These factors interact in a unique way to ..... cognitive theory, agency and self-efficacy influence adoption of a new health ...

  1. 75 FR 62841 - Award of a Single-Source Program Expansion Supplement to Chapel Hill Training Outreach Project, Inc.

    Science.gov (United States)

    2010-10-13

    ... Protection and Affordable Care Act. Supplemental funding will assist in the initial planning and... stakeholders including national program model developers; Provide staff time for support for general...

  2. PHOTOGRAMMETRIC AND LIDAR DOCUMENTATION OF THE ROYAL CHAPEL (CATHEDRAL-MOSQUE OF CORDOBA, SPAIN

    Directory of Open Access Journals (Sweden)

    J. Cardenal

    2012-07-01

    Full Text Available At present, cultural heritage documentation projects use a variety of spatial data acquisition techniques such as conventional surveying, photogrammetry and terrestrial laser scanning. This paper deals with a full documentation project based on all those techniques in the Royal Chapel located in the Cathedral-Mosque of Cordoba in Spain, declared World Heritage Site by UNESCO. At present, the Royal Chapel is under study for a detailed diagnostic analysis in order to evaluate the actual state of the chapel, pathologies, construction phases, previous restoration works, material analysis, etc. So in order to assist the evaluation, a documentation project with photogrammetric and laser scanner techniques (TLS has been carried out. With this purpose, accurate cartographic and 3D products, by means of the integration of both image and laser based techniques, were needed to register all data collected during the diagnostic analysis.

  3. The artistic endowment of the Incarnation chapel in the Cathedral of Seville

    Directory of Open Access Journals (Sweden)

    Lina Malo Lara

    2016-12-01

    Full Text Available The author documents and studies the artistic endowment of a chapel that belonged to knight Twenty-Four, Juan Serón Olarte, and his wife, Antonia de Verástegui, members of the Sevillian social elite, enriched thanks to the American trade. Between 1636 and 1638 several prominent artists such as Martín Moreno, Francisco de Ocampo and Baltasar Quintero, as well as the lesser known Juan de Palacios, took part in this project. The altarpiece in this chapel reflects the continuing influence of Italian Mannerism in Sevillian art of the early seventeenth century, a circumstance largely determined by the assimilation of diverse engraved sources.

  4. Lamb's Chapel Revisited: A Mixed Message on Establishment of Religion, Forum and Free Speech.

    Science.gov (United States)

    Mawdsley, Ralph D.

    1995-01-01

    The Supreme Court in "Lamb's Chapel" unanimously reversed federal district and court of appeals decisions that had upheld school district rules prohibiting use of school district property "by any group for religious purposes." Discusses three issues within the context of religious speech: establishment of religion, free speech,…

  5. Disorders of the Small Intestine

    Science.gov (United States)

    ... of Medicine, Division of Digestive Diseases Professor of Psychology University of North Carolina, Chapel Hill, NC. Digestive ... how improve living with these conditions . Publication Library Books of Interest Medical Definitions About IFFGD About IFFGD ...

  6. Hill, Prof. Archibald Vivian

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1935 Honorary. Hill, Prof. Archibald Vivian Nobel Laureate (Medicine) - 1922. Date of birth: 26 September 1886. Date of death: 3 June 1977. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year ...

  7. Evaluation of HRV Biofeedback as a Resilience Building Intervention in the Reserve Component

    Science.gov (United States)

    2017-08-01

    ORGANIZATION NAME(S) AND ADDRESS(ES) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER RTI International 3040 E Cornwallis Road Research Triangle Park...NC 27709 UNC Chapel Hill 388 Medical School Wing D Emergency Room Drive Chapel Hill, NC 27599 9. SPONSORING / MONITORING AGENCY NAME(S) AND...mental health symptoms have lower HRVs and resilience measures at baseline and change over time; (4) find out how having other mental health issues

  8. Visualising the Guild Chapel, Stratford-upon-Avon: digital models as research tools in buildings archaeology

    Directory of Open Access Journals (Sweden)

    Kate Giles

    2012-07-01

    Full Text Available This article disseminates the results of a programme of detailed archaeological survey and archive research on one of Europe's most important surviving late-medieval Guild Chapels — that of the Holy Cross Guild, Stratford-upon-Avon (Warwickshire. Today the building is part of Stratford-upon-Avon's tourist trail, located directly opposite William Shakespeare's home, 'New Place', and visited by thousands of tourists every year. However, its archaeological and historical significance has been overlooked owing to the extensive restoration of the building in the 19th and 20th centuries. This destroyed evidence for an internationally significant scheme of wall paintings within the Chapel, paid for by the London Mayor and Stratford-upon-Avon merchant, Hugh Clopton, an important member of the Holy Cross Guild and the original builder of 'New Place'. The paintings also have an important connection with Stratford-upon-Avon's most famous son, William Shakespeare, whose father may have been involved in their destruction and removal during the 16th century. Research by a team of historical archaeologists and digital heritage specialists at the Department of Archaeology, University of York, has revealed the significance of the Guild Chapel through the creation of a digital model and textual paradata, which form the focus of this article. The project is ground-breaking in that it moves beyond the traditional use of digital models as virtual reconstructions of past buildings to use the model itself as a research tool through which the user can explore and validate the evidence for the scheme directly. This is achieved through the creation of a palimpsest of antiquarian drawings of the paintings, made as they were revealed during restoration works in the 19th and 20th centuries, and set within their 3-dimensional architectural context. The model allows the user to compare and contrast differences in the recording methods, iconographies and interpretations of

  9. The Rosslyn Code: Can Physics Explain a 500-Year Old Melody Etched in the Walls of a Scottish Chapel?

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Chris [State Magazine

    2011-10-19

    For centuries, historians have puzzled over a series of 213 symbols carved into the stone of Scotland’s Rosslyn Chapel. (Disclaimer: You may recognize this chapel from The Da Vinci Code, but this is real and unrelated!) Several years ago, a composer and science enthusiast noticed that the symbols bore a striking similarity to Chladni patterns, the elegant images that form on a two- dimensional surface when it vibrates at certain frequencies. This man’s theory: A 500-year-old melody was inscribed in the chapel using the language of physics. But not everyone is convinced. Slate senior editor Chris Wilson travelled to Scotland to investigate the claims and listen to this mysterious melody, whatever it is. Come find out what he discovered, including images of the patterns and audio of the music they inspired.

  10. Antigravity hills are visual illusions.

    Science.gov (United States)

    Bressan, Paola; Garlaschelli, Luigi; Barracano, Monica

    2003-09-01

    Antigravity hills, also known as spook hills or magnetic hills, are natural places where cars put into neutral are seen to move uphill on a slightly sloping road, apparently defying the law of gravity. We show that these effects, popularly attributed to gravitational anomalies, are in fact visual illusions. We re-created all the known types of antigravity spots in our laboratory using tabletop models; the number of visible stretches of road, their slant, and the height of the visible horizon were systematically varied in four experiments. We conclude that antigravity-hill effects follow from a misperception of the eye level relative to gravity, caused by the presence of either contextual inclines or a false horizon line.

  11. Hill's formula

    Energy Technology Data Exchange (ETDEWEB)

    Bolotin, Sergey V [Steklov Mathematical Institute, Russian Academy of Sciences, Moscow (Russian Federation); Treschev, Dmitrii V [M. V. Lomonosov Moscow State University, Moscow (Russian Federation)

    2010-07-27

    In his study of periodic orbits of the three-body problem, Hill obtained a formula connecting the characteristic polynomial of the monodromy matrix of a periodic orbit with the infinite determinant of the Hessian of the action functional. A mathematically rigorous definition of the Hill determinant and a proof of Hill's formula were obtained later by Poincare. Here two multidimensional generalizations of Hill's formula are given: for discrete Lagrangian systems (symplectic twist maps) and for continuous Lagrangian systems. Additional aspects appearing in the presence of symmetries or reversibility are discussed. Also studied is the change of the Morse index of a periodic trajectory upon reduction of order in a system with symmetries. Applications are given to the problem of stability of periodic orbits. Bibliography: 34 titles.

  12. Are hills like white elephants?

    Directory of Open Access Journals (Sweden)

    Sunil Sharma

    2016-11-01

    Full Text Available 'Are Hills Like White Elephants?' is, of course, inspired by Hemingway; the tribute reflects on the abiding relevance of serious art in a changed world and extends the boundaries of his message to other human situations.

  13. Exploiting Inhibitory Siglecs to Combat Food Allergies

    Science.gov (United States)

    2017-10-01

    AWARD NUMBER: W81XWH-16-1-0302 TITLE: Exploiting Inhibitory Siglecs to Combat Food Allergies PRINCIPAL INVESTIGATOR: Michael Kulis, Ph.D...CONTRACTING ORGANIZATION: University of North Carolina at Chapel Hill Chapel Hill, NC 27599 REPORT DATES: October 2017 TYPE OF REPORT: Annual PREPARED FOR...Department of Defense, Washington Headquarters Services , Directorate for Information Operations and Reports (0704-0188), 1215 Jefferson Davis Highway, Suite

  14. Pagan symbols associated with the female anatomy in the Medici Chapel by Michelangelo Buonarroti.

    Science.gov (United States)

    De Campos, Deivis; Oxley Da Rocha, Andrea; De Oliveira Lemos, Rodrigo; Malysz, Tais; Antonio Bonatto-Costa, João; Pereira Jotz, Geraldo; Pinto De Oliveira Junior, Lino; Da Costa Oliveira, Miriam

    2017-07-01

    Numerous studies have shown that many works of art from the Renaissance period contain hidden symbols and codes that could have religious, mathematical and/or pagan significance and even anatomical allusions. In this context, the present manuscript offers new evidence that the great genius of anatomy, Michelangelo Buonarroti (1475-1564), included pagan symbols associated with female anatomy in the funerary monuments found in the Sagrestia Nuova/Medici Chapel (1519-1533) in Florence, Italy. The interpretation of the symbols provided in this study will interest those with a passion for the history of anatomy. Clin. Anat. 30:572-577, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  15. The hidden symbols of the female anatomy in Michelangelo Buonarroti's ceiling in the Sistine Chapel.

    Science.gov (United States)

    de Campos, Deivis; Malysz, Tais; Bonatto-Costa, João Antonio; Jotz, Geraldo Pereira; de Oliveira Junior, Lino Pinto; Wichmann, Jéssica Francine; Goulart, Guilherme Reghelin; Stefani, Marco Antonio; da Rocha, Andrea Oxley

    2016-10-01

    A number of published articles have suggested that each element of Renaissance art contains an inner meaning. Some of these elements include the choice of theme and protagonists, faces selected for the characters, colors used, species of flowers and trees chosen, animals depicted, positions of the elements, posture of the characters and their gestures, juxtapositions in the scenes, and even the very scenario or landscape. All of these elements are thought to have hidden meanings. In this context, this manuscript presents a new hypothesis suggesting that Michelangelo Buonarroti (1475-1564) may have concealed symbols associated with female anatomy in the ceiling of the Sistine Chapel (painted 1508-1512) in Rome. Thus, this paper is useful to better understand the history of anatomy and corroborates recent descriptions that have suggested the possible existence of anatomic figures concealed in many of Michelangelo's works. Clin. Anat. 29:911-916, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  16. Soufriere Hills Volcano

    Science.gov (United States)

    2002-01-01

    In this ASTER image of Soufriere Hills Volcano on Montserrat in the Caribbean, continued eruptive activity is evident by the extensive smoke and ash plume streaming towards the west-southwest. Significant eruptive activity began in 1995, forcing the authorities to evacuate more than 7,000 of the island's original population of 11,000. The primary risk now is to the northern part of the island and to the airport. Small rockfalls and pyroclastic flows (ash, rock and hot gases) are common at this time due to continued growth of the dome at the volcano's summit.This image was acquired on October 29, 2002 by the Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) on NASA's Terra satellite. With its 14 spectral bands from the visible to the thermal infrared wavelength region, and its high spatial resolution of 15 to 90 meters (about 50 to 300 feet), ASTER images Earth to map and monitor the changing surface of our planet.ASTER is one of five Earth-observing instruments launched December 18, 1999, on NASA's Terra satellite. The instrument was built by Japan's Ministry of Economy, Trade and Industry. A joint U.S./Japan science team is responsible for validation and calibration of the instrument and the data products.The broad spectral coverage and high spectral resolution of ASTER will provide scientists in numerous disciplines with critical information for surface mapping, and monitoring of dynamic conditions and temporal change. Example applications are: monitoring glacial advances and retreats; monitoring potentially active volcanoes; identifying crop stress; determining cloud morphology and physical properties; wetlands evaluation; thermal pollution monitoring; coral reef degradation; surface temperature mapping of soils and geology; and measuring surface heat balance.Dr. Anne Kahle at NASA's Jet Propulsion Laboratory, Pasadena, California, is the U.S. Science team leader; Bjorn Eng of JPL is the project manager. The Terra mission is part of NASA

  17. RECONSTRUCTION OF HUMAN LUNG MORPHOLOGY MODELS FROM MAGNETIC RESONANCE IMAGES

    Science.gov (United States)

    Reconstruction of Human Lung Morphology Models from Magnetic Resonance ImagesT. B. Martonen (Experimental Toxicology Division, U.S. EPA, Research Triangle Park, NC 27709) and K. K. Isaacs (School of Public Health, University of North Carolina, Chapel Hill, NC 27514)

  18. Evaluation of autophagy as a mechanism involved in air pollutant-induced pulmonary injury

    Science.gov (United States)

    Evaluation of autophagy as a mechanism involved in air pollutant-induced pulmonary injuryHenriquez, A.1, Snow, S.2, Miller, D1.,Schladweiler, M.2 and Kodavanti, U2.1 Curriculum in Toxicology, UNC, Chapel Hill, NC. 2 EPHD/NHEERL, US EPA, RTP, Durham, NC. ...

  19. Geometrical analysis of Palesch family chapel in Kľačno, former Gaidel in Western Slovakia.

    Directory of Open Access Journals (Sweden)

    Grúňová Zuzana

    2017-01-01

    Full Text Available Oval and elliptic spaces are one group of central plans, used mainly in sacral architecture and palaces. Paper deals with geometrical analysis of one of the smaller representatives of the neoclassical sacral architecture with oval plan - Palesch family chapel of Virgin Mary in village Kľačno in Western Slovakia. Oval and elliptic forms are not so often used in Slovak historical architecture and they are almost always connected with foreign influence and knowledge brought form Vienna, Paris, Pest, Eger and other education and praxis localities of the builder or architect. This uncommon oval form used in the small chapel is therefore certainly of interest from the point of view of architecture and geometry.

  20. Explaining the salience of anti-elitism and reducing political corruption for political parties in Europe with the 2014 Chapel Hill Expert Survey data

    NARCIS (Netherlands)

    Polk, J.; Rovny, J.; Bakker, R.; Edwards, E.; Hooghe, L.; Jolly, S.; Koedam, J.; Kostelka, F.; Marks, G.; Schumacher, G.; Steenbergen, M.; Vachudova, M.; Zilovic, M.

    2017-01-01

    This article addresses the variation of anti-corruption and anti-elite salience in party positioning across Europe. It demonstrates that while anti-corruption salience is primarily related to the (regional) context in which a party operates, anti-elite salience is primarily a function of party

  1. Rainfall-runoff modeling of the Chapel Branch Creek Watershed using GIS-based rational and SCS-CN methods

    Science.gov (United States)

    Elizabeth N. Mihalik; Norm S. Levine; Devendra M. Amatya

    2008-01-01

    Chapel Branch Creek (CBC), located within the Town of Santee adjacent to Lake Marion in Orangeburg County, SC, is listed on the SC 2004 303(d) list of impaired waterbodies due to elevated levels of nitrogen (N), phosphorus (P), chlorophyll-a, and pH. In this study, using a GIS-based approach, two runoff modeling methods, the Rational and SCS-CN methods, have been...

  2. IMPLEMENTASI SANDI HILL UNTUK PENYANDIAN CITRA

    Directory of Open Access Journals (Sweden)

    JJ Siang

    2002-01-01

    Full Text Available Hill's code is one of text encoding technique. In this research, Hill's code is extended to image encoding. The image used is BMP 24 bit format. 2x2 and 3x3 matrices is used as a key. The results show that Hill's code is suitable for image whose RGB values vary highly. On the contrary, it is not suitable for less varied RGB images since its original pattern is still persisted in encrypted image. Hill's code for image encoding has also disadvantage in the case that the key matrix is not unique. However, for daily application, with good key matrix, Hill's code can be applied to encode image since it's process only deals with simple matrix operation so it become fast. Abstract in Bahasa Indonesia : Sandi Hill merupakan salah satu teknik penyandian teks. Dalam penelitian ini, pemakaian sandi Hill diperluas dari teks ke citra bertipe BMP 24 bit. Matriks yang dipakai berordo 2x2 dan 3x3. Hasil percobaan menunjukkan bahwa sandi Hill cocok untuk enkripsi citra dengan variasi nilai RGB antar piksel berdekatan yang tinggi (seperti foto, tapi tidak cocok untuk citra dengan variasi nilai RGB yang rendah (seperti gambar kartun karena pola citra asli masih tampak dalam citra sandi. Sandi Hill juga memiliki kelemahan dalam hal tidak tunggalnya matriks kunci yang dapat dipakai. Akan tetapi untuk pemakaian biasa, dengan pemilihan matriks kunci yang baik, sandi Hill dapat dipakai untuk penyandian karena hanya melibatkan operasi matriks biasa sehingga prosesnya relatif cepat. Kata kunci: Sandi Hill, Citra, Relatif Prima.

  3. The man and the hill

    Science.gov (United States)

    Leopold, Luna Bergere

    1962-01-01

    He was sitting on a large slab of rock. As he looked at the cloud of dust hanging hazily on the horizon, the piece of antler and the block of flint he held in his hand hung as if they were suspended from their previous rapid motion. The man gazed intently across the swaying grass which rose in wave-like billows across the distant hills. What was that dust - a herd of buffalo, a band of hunters, or were coyotes chasing the antelope again? After watching for a while he started again to chip the flint with a rapid twisting motion of the bone in his right hand. The little chips of flint fell in the grass before him. It is the same hill but the scene has changed. Seated on the same rock, holding the reins of a saddle horse, a man dressed in buckskin took the fur cap off his head and wiped his brow. He was looking intently across a brown and desolate landscape at a cloud of dust on the far horizon. Was it the hostile tribe of Indians? It could be buffalo. Nervously he kicked at the ground with the deerhide moccasin, pushing the flint chips out of the way. He wiped the dust from his long rifle. What a terrible place - no water, practically no grass, everything bare and brown. Now at sunset, slanting across the hills green with springtime, a cowman sits on a big rock, pushes his sombrero back on his head, and looks across the valley at a large but quiet herd of stock, moving slowly as each steer walks from one lush patch of grass to another, nibbling. Suddenly he stood up. Far on the horizon some dark objects were moving. Is it the sheepmen? Could it be the stage coach from Baggs to the Sweetwater Crossing?Same hill - a gray truck was grinding slowly toward the summit. It pulled up near a small fenced enclosure where there were some instruments painted a bright silver color. A man stepped out of the truck and turned to his younger companion, "You've never found an arrowhead? Maybe you have never thought about it correctly. If you want to find where an Indian camped long

  4. Virtues of Giambologna from Grimaldi Chapel Archaeometric Characterisation Part II: `Artistic' and Natural Patinas

    Science.gov (United States)

    Bongiorno, Valeria; Grosso, Pamela; Piccardo, Paolo; Magnani, Lauro G.; Carnasciali, Maria M.

    2016-08-01

    The scientific investigation on metal artwork is meant to expand the knowledge regarding the technical skills developed by artists in sculpture manufacturing. Moreover, all the gathered data support the speculation about the motivations behind the choices of certain material or a specific casting and/or finishing method (e.g., aesthetic, economic or technical reasons, or both) and give fundamental information for planning adequate restoration interventions. The subject of this study is the Virtues sculptural group made at the end of the XVI century by Giambologna to decorate the Grimaldi Chapel in the church of San Francesco di Castelletto (Genoa, Italy). Six life-size statues depicting Charity, Justice, Hope, Fortitude, Faith, and Temperance (i.e., the artwork discussed in this article); seven bas-reliefs; and six winged representations of putti are what remains of the original monumental project. Different micro-invasive analytical techniques (scanning electron microscopy and energy dispersive x-ray spectroscopy, SEM-EDS; micro-Raman Spectroscopy, μRS; gas chromatography-mass spectrometry, GC-MS) were applied to determine the chemical nature and the state of conservation of the "artistic" and natural patinas visible on the Virtues surfaces. Some patination tests were performed taking into account the collected analytical data and the indications provided by the scientific literature and the historical documents. The combination of the results obtained through the scientific investigations and the experimental work allowed for supposing the materials and the patination technique selected by the artist to adorn the sculptures and providing indications for the correct conservation of the six sculptures.

  5. Hill climbing algorithms and trivium

    DEFF Research Database (Denmark)

    Borghoff, Julia; Knudsen, Lars Ramkilde; Matusiewicz, Krystian

    2011-01-01

    This paper proposes a new method to solve certain classes of systems of multivariate equations over the binary field and its cryptanalytical applications. We show how heuristic optimization methods such as hill climbing algorithms can be relevant to solving systems of multivariate equations....... A characteristic of equation systems that may be efficiently solvable by the means of such algorithms is provided. As an example, we investigate equation systems induced by the problem of recovering the internal state of the stream cipher Trivium. We propose an improved variant of the simulated annealing method...

  6. Microbial monitoring in treated stone at the Royal Chapel of Granada

    Science.gov (United States)

    Jroundi, Fadwa; Pinar, Guadalupe; González-Muñoz, Maria Theresa; Sterflinger, Katja

    2014-05-01

    Biomineralization processes have been applied in situ to protect and consolidate decayed ornamental stone of the Royal Chapel in Granada (Spain). In few years, this conservation treatment has gained worth attention as environmentally friendly methodology for protection and consolidation of limestone because of the compatibilities shown between the new calcium carbonate cement and the original stone substrate. Moreover, the success of this approach may be related to the diversity of the microbiota inhabiting the stone and activated upon the biotreatment application and throughout the time. González-Muñoz et al. (2008) proposed a nutritional solution that activate among the bacteria inhabiting the stone those with carbonatogenic activity. In this study, a long-term (one, two and three years) monitoring of the microbiota present on the treated and untreated stones was done using a molecular strategy, including total DNA extraction, PCR amplification of 16S rRNA sequences, construction of clone libraries and fingerprinting by DGGE (Denaturing Gradient Gel Electrophoresis) analysis. Sequencing of the 16S rDNA revealed the dominant occurrence of members of Actinobacteria (44.20%), Gamma-proteobacteria (30.24%) and Chloroflexi (25.56%) after one year of the biotreatment. Whereas after two years, members of Cyanobacteria (22.10%) appeared and three years after, the microbiota consisted of only Actinobacteria and Cyanobacteria with approximately the same percentage in comparison with the untreated stones, dominated exclusively by Actinobacteria (100%). Fungal diversity followed the same dynamic as bacterial diversity being Ascomicota the predominant order before treatment. After one year, members of Basidiomycota and Viridiplantae appeared on the stone while two years after, the Viridiplantae dominated with a percentage of 84.77%. Finally, three years after the treatment, fungi population started to stabilize again and Ascomicota predominated next to 16.67% of

  7. The Camp Hill Project: Objectives and Design

    Science.gov (United States)

    Mattingly, John B.

    1976-01-01

    Available from: EC 090 474. Outlined are the problems and objectives of Pennsylvania's Camp Hill Project--a program designed to complete psychological needs assessments for juveniles incarcerated at Camp Hill, to develop project policies and guidelines in preparation for meeting with juvenile court judges, and to hire staff. (SBH)

  8. Michelangelo Buonarroti: Restoration of the Frescoes on the Vaulted Ceiling and the Last Judgment in the Sistine Chapel

    Directory of Open Access Journals (Sweden)

    Gianluigi Colalucci

    2017-07-01

    Full Text Available The last restoration of Michelangelo’s frescoes in the Sistine Chapel was directed and conducted by the internal staff of the Vatican Museums, in the period from June 1980 to April 1994. The historical importance of this restoration is found in the recovery of the unexpected chromatic tones used by Michelangelo and hidden for centuries by the dust, black smoke and grease produced by candles and braziers, and by the animal glue, gum resin and ox bile used by restorers in the past to revive the colors. The important result was obtained without any risk, thanks to developments in the field of methods and materials, the progress made in diagnostics, and the elaboration of a theory of restoration (Brandi C. 1950 which still acts as a support to the scientific and technical guidelines used in restoration today. The good preservation of the frescoes in the Chapel is entrusted to a filter and air conditioning system which was renewed and upgraded in 2015, and to modern LED lighting installed in the same year. The cleaning of the frescoes, which were almost perfectly preserved thanks to Michelangelo’s technique, allowed us to study the artist’s painting technique and to learn that some of the techniques he employed in marble sculpting were applied to his painting, and that he introduced novel methods, such as the technique used to give three-dimensionality to figures or his particular brushstrokes, which anticipated divisionism and pointillism.

  9. Mariological paintings in the Chapel of Our Lady's Tomb in the Kalwaria Zebrzydowska compound. From studies on the reception of graphics in Polish 17th century painting

    Directory of Open Access Journals (Sweden)

    Janina Dzik

    2008-12-01

    Full Text Available The Chapel of Our Lady's Tomb in Brody, complete with valuable interior furnishing, in terms of history and territory belongs to the architectural landscape concept of the Marian- and Passion-themed compound in Kalwaria Zebrzydowska. In the fields of the late-Renaissance choir parapet and the galleries of the chapel there are a series of paintings showing hitherto unspecified Marian themes. The items have never been referred to in literature on Kalwaria or mentioned in guidebooks or maintenance records. The article analyses, in a broad context, the symbolism of 37 Marian scenes presenting Mary and symbolic objects (e.g. a heart, a building, a garden.

  10. The Origin of the Columbia Hills

    Science.gov (United States)

    Rice, J. W.

    2005-12-01

    The Columbia Hills form a rugged ridge complex comprised of 7 peaks spanning some 3.5 km in length and reaching a maximum height of 106 m (Husband Hill) above the plains of Spirit's landing site. As of this writing Spirit has been exploring the Columbia Hills for over 440 sols (since sol 156 on June 11, 2004). Thus far the origin of the Columbia Hills has remained elusive despite detailed analysis of numerous rock and soil targets, including outcrops. The chemical differences among the 6 distinct rock classes attest to the lithologic diversity and geologic complexity of the Hills. Origin of the Columbia Hills Several hypothesis have been put forth to explain the origin of the Columbia Hills: Old eroded partially buried impact crater rim(s), central peak, residual intracrater fill material, volcanic construct, wrinkle ridge, delta and or combinations of the above. Observations that support various aspects of these multiple hypotheses will be discussed. Numerous buried craters are observed on the floor of Gusev lending credence to the idea that the Columbia Hills are the remains of an ancient impact crater rim or possibly a central peak. Morphologic evidence of the rim of Thira crater and the Columbia Hills appears to support this hypothesis. The Aeolis region contains numerous craters that contain layered materials in the absence of any major fluvial systems. This could imply that the Columbia Hills are the remnants of a formerly extensive unit(s). Gusev contains many hills scattered across its floor such as Grissom, White, Chaffee and numerous other buttes and mesas that may be remnants of a former extensive intracrater deposit. Another possibility is that the Columbia Hills are composed of volcanic materials (cinder cones and associated ash and lava flows) derived either locally or from Apollinaris Patera located 300 km to the north. Several depressions are located in the Columbia Hills. These features could be calderas but are most likely impact craters. The most

  11. 75 FR 36608 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway, (AIWW) Scotts Hill, NC

    Science.gov (United States)

    2010-06-28

    ... to the docket to support concerns that vehicle traffic across the bridge had increased or was... change would have allowed the drawbridge to open on signal every hour on the half hour for the passage of... have allowed the drawbridge to open on signal every hour on the half hour for the passage of pleasure...

  12. Kinematic analysis of the flight phase of the Nordic combined and ski jump on a large hill (HS-134 m) during the 2009 Nordic World Ski Championships.

    Science.gov (United States)

    Svoboda, Zdenek; Janura, Miroslav; Cabell, Lee; Janurová, Eva

    2011-01-01

    The purpose of this study was to assess the execution of the flight phase in the Nordic combined (NC) among three groups of competitors, representing different skill levels, and to compare them with three groups of ski jumpers (SJs). Thirty NC and thirty SJ competitors, who performed ski jumps on an HS-134 m jumping hill, were divided into three subgroups based on jump length execution. Two-dimensional (2-D) kinematic data were collected from the lower extremities, trunks, and skis of the competitors. The SJ group had a smaller lower extremity angle ( p jump lengths comparable to those of the SJ competitors by having significantly higher in-run velocities.

  13. Soufriere Hills, Montserrat, West Indies

    Science.gov (United States)

    2002-01-01

    Volcanic activity on the West Indian island of Montserrat has remained high for several years-the current activity started in 1995. However, remote sensing of the island has been difficult because of frequent cloud cover. The International Space Station crew flew north of the island on a clear day in early July (July 9, 2001) and recorded a vigorous steam plume emanating from the summit of Soufriere Hills. The image also reveals the extensive volcanic mud flows (lahars) and new deltas built out from the coast from the large amounts of volcanic debris delivered downstream by the rivers draining the mountain. As a small island (only 13 x 8 km), all of Montserrat has been impacted by the eruptions. Sources of Information: Smithsonian Global Volcanism Program Italy's Volcanoes Montserrat Volcano Observatory Digital photograph number ISS002-E-9309 was taken on 9 July 2001 from Space Station Alpha and was provided by the Earth Sciences and Image Analysis Laboratory at Johnson Space Center. Additional images taken by astronauts and cosmonauts can be viewed at the NASA-JSC Gateway to Astronaut Photography of Earth.

  14. 27 CFR 9.190 - Red Hill Douglas County, Oregon.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Red Hill Douglas County... Areas § 9.190 Red Hill Douglas County, Oregon. (a) Name. The name of the viticultural area described in this section is “Red Hill Douglas County, Oregon”. For purposes of part 4 of this chapter, “Red Hill...

  15. Bunker Hill Sediment Characterization Study

    Energy Technology Data Exchange (ETDEWEB)

    Neal A. Yancey; Debby F. Bruhn

    2009-12-01

    The long history of mineral extraction in the Coeur d’Alene Basin has left a legacy of heavy metal laden mine tailings that have accumulated along the Coeur d’Alene River and its tributaries (U.S. Environmental Protection Agency, 2001; Barton, 2002). Silver, lead and zinc were the primary metals of economic interest in the area, but the ores contained other elements that have become environmental hazards including zinc, cadmium, lead, arsenic, nickel, and copper. The metals have contaminated the water and sediments of Lake Coeur d’Alene, and continue to be transported downstream to Spokane Washington via the Spokane River. In 1983, the EPA listed the Bunker Hill Mining and Metallurgical Complex on the National Priorities List. Since that time, many of the most contaminated areas have been stabilized or isolated, however metal contaminants continue to migrate through the basin. Designation as a Superfund site causes significant problems for the economically depressed communities in the area. Identification of primary sources of contamination can help set priorities for cleanup and cleanup options, which can include source removal, water treatment or no action depending on knowledge about the mobility of contaminants relative to water flow. The mobility of contaminant mobility under natural or engineered conditions depends on multiple factors including the physical and chemical state (or speciation) of metals and the range of processes, some of which can be seasonal, that cause mobilization of metals. As a result, it is particularly important to understand metal speciation (National Research Council, 2005) and the link between speciation and the rates of metal migration and the impact of natural or engineered variations in flow, biological activity or water chemistry.

  16. Traffic Signal Cycle Lengths

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Traffic signal location list for the town of Chapel Hill. This data set includes light cycle information as well as as intersection information.The Town of Chapel...

  17. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  18. DETERMINATION OF URINARY TRIVALENT ARSENICALS (MMASIII AND DMASIII) IN INDIVIDUALS CHRONICALLY EXPOSED TO ARSENIC

    Science.gov (United States)

    DETERMINATION OF URINARY TRIVALENT ARSENICALS (MMAsIII and DMAsIII) IN INDIVIDUALS CHRONICALLY EXPOSED TO ARSENIC. L. M. Del Razo1, M. Styblo2, W. R. Cullen3, and D.J. Thomas4. 1Toxicology Section, Cinvestav-IPN, Mexico, D.F., 2Univ. North Carolina, Chapel Hill, NC; 3Uni...

  19. Kentucky's Individualized Kindergartens: A State Network Design for Early Intervention.

    Science.gov (United States)

    Bright, B.; Cansler, D. P.

    The KIK (Kentucky Individualized Kindergartens) project, a collaborative project between Kentucky's Department of Education and the Chapel Hill (NC) Training-Outreach project, is designed to serve high risk children. KIK provides early identification of high risk kindergarteners, development of individualized education programs, and implementation…

  20. GESTATIONAL EXPOSURE TO ETHANE DIMETHANESULFONATE (EDS) ALTERS DEVELOPMENT OF THE MOUSE TESTIS

    Science.gov (United States)

    GESTATIONAL EXPOSURE TO ETHANE DIMETHANESULFONATE (EDS) ALTERS DEVELOPMENT OF THE MOUSE TESTIS. D.K. Tarka*1,2, J.D. Suarez*2, N.L. Roberts*2, J.M. Rogers*1,2, M.P. Hardy3, and G.R. Klinefelter1,2. 1University of North Carolina, Curriculum in Toxicology, Chapel Hill, NC; 2USEPA,...

  1. Disorders of the Large Intestine

    Science.gov (United States)

    ... of Medicine, Division of Digestive Diseases; Professor of Psychology, University of North Carolina, Chapel Hill, NC, IFFGD Publication #839 by Samuel Nurko, MD, MPH, Center for Motility and Functional Gastrointestinal Disorders, Children’s Hospital Boston, Boston, MA, "Irritable Bowel Syndrome" by ...

  2. COCKROACHES, PESTICIDE USE, AND CHILDREN'S PULMONARY FUNCTION IN AN ARID COMMUNITY

    Science.gov (United States)

    Cockroaches, pesticide use, and children's pulmonary function in an arid communityErik Svendsen1, Mary Ross1, Melissa Gonzales2, Debra Walsh1, Scott Rhoney1, Gina Terrill1, Lucas Neas11US EPA, Chapel Hill, NC; 2University of New MexicoThe El Paso Children's He...

  3. OBJECTIVE EVALUATION OF HYPERACTIVATED MOTILITY IN RAT SPERMATOZA USING COMPUTER-ASSISTED SPERM ANALYSIS (CASA)

    Science.gov (United States)

    Objective evaluation of hyperactivated motility in rat spermatozoa using computer-assisted sperm analysis.Cancel AM, Lobdell D, Mendola P, Perreault SD.Toxicology Program, University of North Carolina, Chapel Hill, NC 27599, USA.The aim of this study was t...

  4. TB/HIV integration at primary care level: A quantitative assessment ...

    African Journals Online (AJOL)

    2012-09-02

    Sep 2, 2012 ... Public Health Leadership Program, University of North Carolina, Chapel Hill, NC, USA. L Evarts, MPH. WitkoppenHealth ..... for TB symptoms. • 10% of TB suspects assessed by smear microscopy. Percentage of new HIV-positive patients starting. IPT (indicator B.2.1). 100%. 124 059 (12%). • 0% at 2 clinics.

  5. INHIBITION OF TOBACCO SMOKE-INDUCED LUNG INFLAMMATION BY A CATALYTIC ANTIOXIDANT

    Science.gov (United States)

    AMathematical Model for the Kinetics of the Male Reproductive Endocrine SystemLaura K. Potter1,2, H.A. Barton2 and R.W. Setzer21Curriculum in Toxicology, UNC-Chapel Hill, NC; 2US EPA, ORD, NHEERL, ETD, RTP, NCIn this presentation a model for the hormonal regul...

  6. EFFECT OF DOSE ON THE EXCRETION AND METABOLISM OF MONOMETHYLARSONIC ACID IN THE MOUSE

    Science.gov (United States)

    EFFECT OF DOSE ON THE EXCRETION AND METABOLISM OF MONOMETHYLARSONIC ACID IN THE MOUSEM F Hughes1, V Devesa2, B C Edwards1, C T Mitchell1, E M Kenyon1, and D J Thomas1. 1US EPA, ORD, NHEERL, ETD, Research Triangle Park, NC; 2UNC-CH, CEMALB, Chapel Hill, NCMonomethylar...

  7. Brick durability and conservation treatment (Santa María de Jesús chapel portal, Seville, Spain

    Directory of Open Access Journals (Sweden)

    Villegas, R.

    2009-03-01

    Full Text Available Durability differences of 2 types of brick from Santa María de Jesús Chapel (Sevilla and 2 treatments for its restoration have been studied. They have been characterizad using XRD and SEM, as well as their physical, hydric and mechanical properties. Samples prepared with bricks from the chapel have been submitted to salt crystallization test, to identify decay causes and mechanisms.The red brick present the lowest firing temperature, lower porosity and a great proportion of micropores. Physical and mechanical properties don’t change significantly with the treatments, only hygric properties vary with the water repellent. The accelerated aging test revealed significant improvement in the behaviour of yellow brick, but no change in the decay mechanism of red brick (Typical of microporous materials or its durability is observed.Se ha estudiado la alteración diferencial de los 2 tipos de ladrillo de la iglesia de Santa María de Jesús (Sevilla y 2 tratamientos para su restauración. Se han caracterizado por DRX y SEM, así como sus propiedades físicas, hídricas y mecánicas. Probetas preparadas de ladrillos de la iglesia se han sometido a ensayo de cristalización de sales para determinar las causas y los mecanismos de alteración.El ladrillo rojo es el que presenta menor temperatura de cocción, menor porosidad y mayor proporción de microporos. Las propiedades físicas y mecánicas de ambos ladrillos no varían significativamente con los tratamientos, sólo las propiedades hídricas cambian con el hidrófugo. En el ensayo de alteración mejora mucho el comportamiento del ladrillo amarillo, mientras que en el rojo no varía la morfología de alteración (características de materiales con microporos ni la durabilidad.

  8. Newtonian and pseudo-Newtonian Hill problem

    International Nuclear Information System (INIS)

    Steklain, A.F.; Letelier, P.S.

    2006-01-01

    A pseudo-Newtonian Hill problem based on the Paczynski-Wiita pseudo-Newtonian potential that reproduces general relativistic effects is presented and compared with the usual Newtonian Hill problem. Poincare maps, Lyapunov exponents and fractal escape techniques are employed to study bounded and unbounded orbits. In particular we consider the systems composed by Sun, Earth and Moon and composed by the Milky Way, the M2 cluster and a star. We find that some pseudo-Newtonian systems-including the M2 system-are more stable than their Newtonian equivalent

  9. Photovoltaics - 10 years after Cherry Hill

    Science.gov (United States)

    Ralph, E. L.

    The status of R&D programs connected with photovoltaic (PV) systems 10 years after the Cherry Hill workshop on 'Photovoltaic Conversion of Solar Energy for Terrestrial Applications' is assessed. The five categories of research recommended by the Cherry Hill Workshop are listed in a table together with their recommended research budget allocations. The workshop categories include: single-crystal Si cells; poly-Si cells; systems and diagnostics. Categories for thin film CdS/Cu2S and CuInSe2 cells are also included. The roles of government and private utility companies in providing adequate financial support for PV research programs is emphasized.

  10. Acoustics Characterization of the Open Chapel´s St. Nicholas of Tolentino Ancient Monastery at Actopan [Hidalgo], Mexico. An example of regional heritage resignification

    Directory of Open Access Journals (Sweden)

    Eduardo Javier García Alonso

    2014-04-01

    Full Text Available This paper summarizes the study of the acoustic behavior of the opened chapel from the “ex convento de San Nicolás de Tolentino”, located in the municipality of Actopan, state of Hidalgo, in Mexico. Such behavior is explained through the acoustic modeling; how at the time, a higher sound pressure level could be attained to cover a longer distance enabling to transmit the religious message to a multitude of parishioners. A collateral and brief historiographic analysis is made about the main function of the opened chapel, and has been complemented with this acustic analysis allowing us to pose new research horizons for this type of heritage buildings at the region.

  11. Mindfulness training applied to addiction therapy: insights into the neural mechanisms of positive behavioral change

    OpenAIRE

    Garland, Eric; Howard,Matthew; Priddy,Sarah; McConnell,Patrick; Riquino,Michael; Froeliger,Brett

    2016-01-01

    Eric L Garland,1,2 Matthew O Howard,3 Sarah E Priddy,1 Patrick A McConnell,4 Michael R Riquino,1 Brett Froeliger4 1College of Social Work, 2Hunstsman Cancer Institute, University of Utah, Salt Lake City, UT, USA; 3School of Social Work, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 4Department of Neuroscience, Medical University of South Carolina, Charleston, SC, USA Abstract: Dual-process models from neuroscience suggest that addiction is driven by dysregulated interact...

  12. Use of a Novel Embryonic Mammary Stem Cell Gene Signature to Improve Human Breast Cancer Diagnostics and Therapeutic Decision Making

    Science.gov (United States)

    2015-12-01

    Hill Chapel Hill, NC 27599 REPORT DATE: December 2015 TYPE OF REPORT: Final Report PREPARED FOR: U.S. Army Medical Research and Materiel...Hill NC 27599-7295 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S ACRONYM(S) U.S. Army Medical Research and Materiel...the analysis of 10 Kl4+K8+ cells that are currently be sequenced with funding from the JCVI and a Salk Cancer Center Starter award to yield a total of

  13. The Kapsiki of the Mandara Hills

    NARCIS (Netherlands)

    Beek, van W.E.A.

    1987-01-01

    The Kapsiki of Cameroon and the Higi of Nigeria are two tribes from the Mandara hills area of central and western Africa. Though they form one coherent group of villages, they are usually considered as two separate ethnic units. The author normally uses the term Kapsiki for both. Based on fieldwork

  14. Accounting for imperfect detection in Hill numbers for biodiversity studies

    Science.gov (United States)

    Broms, Kristin M.; Hooten, Mevin B.; Fitzpatrick, Ryan M.

    2015-01-01

    Hill numbers unify biodiversity metrics by combining several into one expression. For example, species richness, Shannon's diversity index and the Gini–Simpson index are a few of the most used diversity measures, and they can be expressed as Hill numbers. Traditionally, Hill numbers have been calculated from relative abundance data, but the expression has been modified to use incidence data as well. We demonstrate an approach for estimating Hill numbers using an occupancy modelling framework that accounts for imperfect detection.

  15. EnviroAtlas - Durham, NC - Demo (Parent)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  16. The Hill Chart Calculation for Pelton Runner Models using the HydroHillChart - Pelton Module Software

    Directory of Open Access Journals (Sweden)

    Adelina Bostan

    2015-07-01

    Full Text Available The Pelton turbines industrial design is based on the hill chart characteristics obtained by measuring the models. Primary data measurements used to obtain the hill chart can be processed graphically, by hand or by using graphic programs respectively CAD programs; the HydroHillChart - Pelton module software is a specialized tool in achieving the hill chart, using interpolation cubic spline functions. Thereby, based on measurements of several models of Pelton turbines, a computerized library, used to design industrial Pelton turbines can be created. The paper presents the universal characteristics calculated by using the HydroHillChart - Pelton module software for a series of Pelton runners.

  17. Evidence to the Marley Hill Public Inquiry

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, G.K. (Council for the Protection of Rural England (UK). Durham and Teesdale Branch)

    1989-11-01

    George Kenneth Wilson, a retired power station enginer, and holder of such offices as Vice-Chairman of the CPRE Durham and Teesdale Branch, Secretary of the Derwent Valley Protection Society and an officer of the Opencast Mining Intelligence Group, presents reasons for dismissing the appeal for opencast mining at the Marley Hill site in the NE of England saying that the Mineral Planning Guidance Note, MPG3 seemed to be repeating mistakes inherent in the previous 'Plan for coal'. He considers that the application cannot be justified on the grounds of demand or forecast market trends. The type of coal is unsuitable for local power station boilers. The working of the site would destroy a large area of pleasant countryside. The standard of restoration of the 32 sites surrounding Marley Hill is in his opinion very poor.

  18. Confidence Hills Mineralogy and Chemin Results from Base of Mt. Sharp, Pahrump Hills, Gale Crater, Mars

    Science.gov (United States)

    Cavanagh, P. D.; Bish, D. L.; Blake, D. F.; Vaniman, D. T.; Morris, R. V.; Ming, D. W.; Rampe, E. B.; Achilles, C. N.; Chipera, S. J.; Treiman, A. H.; hide

    2015-01-01

    The Mars Science Laboratory (MSL) rover Curiosity recently completed its fourth drill sampling of sediments on Mars. The Confidence Hills (CH) sample was drilled from a rock located in the Pahrump Hills region at the base of Mt. Sharp in Gale Crater. The CheMin X-ray diffractometer completed five nights of analysis on the sample, more than previously executed for a drill sample, and the data have been analyzed using Rietveld refinement and full-pattern fitting to determine quantitative mineralogy. Confidence Hills mineralogy has several important characteristics: 1) abundant hematite and lesser magnetite; 2) a 10 angstrom phyllosilicate; 3) multiple feldspars including plagioclase and alkali feldspar; 4) mafic silicates including forsterite, orthopyroxene, and two types of clinopyroxene (Ca-rich and Ca-poor), consistent with a basaltic source; and 5) minor contributions from sulfur-bearing species including jarosite.

  19. Non-destructive EDXRF-analysis of the golden haloes of Giotto's frescos in the Chapel of the Scrovegni in Padua

    International Nuclear Information System (INIS)

    Cesareo, Roberto

    2003-01-01

    The famous frescos by Giotto in the 'Chapel of the Scrovegni in Padua' were systematically analysed in more than 300 points with various types of portable equipments based on energy dispersive X-ray fluorescence. A large number of golden haloes in particular were analysed, several black haloes where a golden leaf had come off, as well as several black haloes with no gold. From the measurements it could be deduced that the golden leaf is composed of pure gold, with a mean thickness of about 1.6 μm

  20. Molecular Tools for Monitoring the Ecological Sustainability of a Stone Bio-Consolidation Treatment at the Royal Chapel, Granada.

    Directory of Open Access Journals (Sweden)

    Fadwa Jroundi

    Full Text Available Biomineralization processes have recently been applied in situ to protect and consolidate decayed ornamental stone of the Royal Chapel in Granada (Spain. While this promising method has demonstrated its efficacy regarding strengthening of the stone, little is known about its ecological sustainability.Here, we report molecular monitoring of the stone-autochthonous microbiota before and at 5, 12 and 30 months after the bio-consolidation treatment (medium/long-term monitoring, employing the well-known molecular strategy of DGGE analyses. Before the bio-consolidation treatment, the bacterial diversity showed the exclusive dominance of Actinobacteria (100%, which decreased in the community (44.2% after 5 months, and Gamma-proteobacteria (30.24% and Chloroflexi (25.56% appeared. After 12 months, Gamma-proteobacteria vanished from the community and Cyanobacteria (22.1% appeared and remained dominant after thirty months, when the microbiota consisted of Actinobacteria (42.2% and Cyanobacteria (57.8% only. Fungal diversity showed that the Ascomycota phylum was dominant before treatment (100%, while, after five months, Basidiomycota (6.38% appeared on the stone, and vanished again after twelve months. Thirty months after the treatment, the fungal population started to stabilize and Ascomycota dominated on the stone (83.33% once again. Members of green algae (Chlorophyta, Viridiplantae appeared on the stone at 5, 12 and 30 months after the treatment and accounted for 4.25%, 84.77% and 16.77%, respectively.The results clearly show that, although a temporary shift in the bacterial and fungal diversity was observed during the first five months, most probably promoted by the application of the bio-consolidation treatment, the microbiota tends to regain its initial stability in a few months. Thus, the treatment does not seem to have any negative side effects on the stone-autochthonous microbiota over that time. The molecular strategy employed here is suggested

  1. Science, art, and mistery in the statues and in the anatomical machines of the prince of sansevero: the masterpieces of the "Sansevero Chapel".

    Science.gov (United States)

    Della Monica, Matteo; Galzerano, Domenico; Di Michele, Sara; Acquaviva, Fabio; Gregorio, Giovanni; Lonardo, Fortunato; Sguazzo, Francesca; Scarano, Francesca; Lama, Diana; Scarano, Gioacchino

    2013-11-01

    During the 18th century in Naples, Raimondo di Sangro, Prince of Sansevero, completed works on the family chapel, the so-called "Cappella Sansevero." The chapel houses statues of extraordinary beauty and spectacularly detailed but also, in the basement, two human skeletons known as the "Anatomical Machines" ("Macchine Anatomiche"). These two skeletons, a man and a pregnant woman, are entirely surrounded by their circulatory systems, just as if these were suddenly fixed. Legend, believed as truth until few years ago, says that Prince Raimondo had prepared and injected an unknown embalming substance in the blood vessels of two of his servants convicting them to eternal fixity. Recent investigations have demonstrated that, while the bones are authentic, the blood vessels are actually extraordinary artifacts that also reproduce some congenital malformations. The dreadful aspect of these two skeletons appears to be in strident contrast with the classic beauty of the statues which glorify and celebrate the ideal of morphology. Conversely, the two Anatomical Machines, protagonists of legends and superstitions since centuries, represent a marvelous example of science mixed with art. © 2013 Wiley Periodicals, Inc.

  2. Les peintures murales de la chapelle du château de Montreuil-Bellay / The Murals of the Chapel of Montreuil-Bellay Castle

    Directory of Open Access Journals (Sweden)

    Samuel Gras

    2015-05-01

    Full Text Available The castle of Montreuil-Bellay was rebuilt by Guillaume d’Harcourt († 1487 and his wife Yolande de Laval († 1487. It contains in one of the chapels a rare testimony of murals dating from the last quarter of the fifteenth century in the Loire Valley, in France. Based on a widespread iconography, images however respond to specific expectations of the owners. Several complementary readings can be made in the representation of the six saints painted in the chapel. Individual devotions combine collective concerns of several members of the Harcourt and Laval families. Also, this short introduction on the murals also leads us to take a new look at the painter in charge of it. The artist, who was familiar with Flemish painting innovations during the fifteenth century. He probably can be identified with Coppin Delf. From an artistic standpoint, the murals of Montreuil-Bellay put on display an entanglement of different influences and iconographic sources. Indeed, they emphasize the extent and complexity in artistic transfers away from political divisions or distant geographical areas.

  3. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  4. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  5. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  6. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  7. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  8. HydroHillChart – Francis module. Software used to Calculate the Hill Chart of the Francis Hydraulic Turbines

    Directory of Open Access Journals (Sweden)

    Dorian Nedelcu

    2015-07-01

    Full Text Available The paper presents the Hydro Hill Chart - Francis module application, used to calculate the hill chart of the Pelton, Francis and Kaplan hydraulic turbine models, by processing the data measured on the stand. After describing the interface and menu, the input data is graphically presented and the universal characteristic for measuring scenarios ao=const. and n11=const is calculated. Finally, the two calculated hill charts are compared through a graphical superimposition of the isolines.

  9. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  10. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  11. The Goodwin model: behind the Hill function.

    Directory of Open Access Journals (Sweden)

    Didier Gonze

    Full Text Available The Goodwin model is a 3-variable model demonstrating the emergence of oscillations in a delayed negative feedback-based system at the molecular level. This prototypical model and its variants have been commonly used to model circadian and other genetic oscillators in biology. The only source of non-linearity in this model is a Hill function, characterizing the repression process. It was mathematically shown that to obtain limit-cycle oscillations, the Hill coefficient must be larger than 8, a value often considered unrealistic. It is indeed difficult to explain such a high coefficient with simple cooperative dynamics. We present here molecular models of the standard Goodwin model, based on single or multisite phosphorylation/dephosphorylation processes of a transcription factor, which have been previously shown to generate switch-like responses. We show that when the phosphorylation/dephosphorylation processes are fast enough, the limit-cycle obtained with a multisite phosphorylation-based mechanism is in very good quantitative agreement with the oscillations observed in the Goodwin model. Conditions in which the detailed mechanism is well approximated by the Goodwin model are given. A variant of the Goodwin model which displays sharp thresholds and relaxation oscillations is also explained by a double phosphorylation/dephosphorylation-based mechanism through a bistable behavior. These results not only provide rational support for the Goodwin model but also highlight the crucial role of the speed of post-translational processes, whose response curve are usually established at a steady state, in biochemical oscillators.

  12. New type of hill-top inflation

    Energy Technology Data Exchange (ETDEWEB)

    Barvinsky, A.O.; Nesterov, D.V. [Theory Department, Lebedev Physics Institute, Leninsky Prospect 53, Moscow 119991 (Russian Federation); Kamenshchik, A.Yu., E-mail: barvin@td.lpi.ru, E-mail: Alexander.Kamenshchik@bo.infn.it, E-mail: nesterov@td.lpi.ru [Dipartimento di Fisica and INFN, via Irnerio 46, 40126 Bologna (Italy)

    2016-01-01

    We suggest a new type of hill-top inflation originating from the initial conditions in the form of the microcanonical density matrix for the cosmological model with a large number of quantum fields conformally coupled to gravity. Initial conditions for inflation are set up by cosmological instantons describing underbarrier oscillations in the vicinity of the inflaton potential maximum. These periodic oscillations of the inflaton field and cosmological scale factor are obtained within the approximation of two coupled oscillators subject to the slow roll regime in the Euclidean time. This regime is characterized by rapid oscillations of the scale factor on the background of a slowly varying inflaton, which guarantees smallness of slow roll parameters ε and η of the following inflation stage. A hill-like shape of the inflaton potential is shown to be generated by logarithmic loop corrections to the tree-level asymptotically shift-invariant potential in the non-minimal Higgs inflation model and R{sup 2}-gravity. The solution to the problem of hierarchy between the Planckian scale and the inflation scale is discussed within the concept of conformal higher spin fields, which also suggests the mechanism bringing the model below the gravitational cutoff and, thus, protecting it from large graviton loop corrections.

  13. New type of hill-top inflation

    Energy Technology Data Exchange (ETDEWEB)

    Barvinsky, A.O. [Theory Department, Lebedev Physics Institute,Leninsky Prospect 53, Moscow 119991 (Russian Federation); Department of Physics, Tomsk State University,Lenin Ave. 36, Tomsk 634050 (Russian Federation); Department of Physics and Astronomy, Pacific Institue for Theoretical Physics,University of British Columbia, 6224 Agricultural Road, Vancouver, BC V6T 1Z1 (Canada); Kamenshchik, A.Yu. [Dipartimento di Fisica and INFN,via Irnerio 46, 40126 Bologna (Italy); L.D. Landau Institute for Theoretical Physcis,Kosygin str. 2, 119334 Moscow (Russian Federation); Nesterov, D.V. [Theory Department, Lebedev Physics Institute,Leninsky Prospect 53, Moscow 119991 (Russian Federation)

    2016-01-20

    We suggest a new type of hill-top inflation originating from the initial conditions in the form of the microcanonical density matrix for the cosmological model with a large number of quantum fields conformally coupled to gravity. Initial conditions for inflation are set up by cosmological instantons describing underbarrier oscillations in the vicinity of the inflaton potential maximum. These periodic oscillations of the inflaton field and cosmological scale factor are obtained within the approximation of two coupled oscillators subject to the slow roll regime in the Euclidean time. This regime is characterized by rapid oscillations of the scale factor on the background of a slowly varying inflaton, which guarantees smallness of slow roll parameters ϵ and η of the following inflation stage. A hill-like shape of the inflaton potential is shown to be generated by logarithmic loop corrections to the tree-level asymptotically shift-invariant potential in the non-minimal Higgs inflation model and R{sup 2}-gravity. The solution to the problem of hierarchy between the Planckian scale and the inflation scale is discussed within the concept of conformal higher spin fields, which also suggests the mechanism bringing the model below the gravitational cutoff and, thus, protecting it from large graviton loop corrections.

  14. Weak Properties and Robustness of t-Hill Estimators

    Czech Academy of Sciences Publication Activity Database

    Jordanova, P.; Fabián, Zdeněk; Hermann, P.; Střelec, L.; Rivera, A.; Girard, S.; Torres, S.; Stehlík, M.

    2016-01-01

    Roč. 19, č. 4 (2016), s. 591-626 ISSN 1386-1999 Institutional support: RVO:67985807 Keywords : asymptotic properties of estimators * point estimation * t-Hill estimator * t-lgHill estimator Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.679, year: 2016

  15. 78 FR 73187 - Black Hills National Forest Advisory Board

    Science.gov (United States)

    2013-12-05

    ... DEPARTMENT OF AGRICULTURE Forest Service Black Hills National Forest Advisory Board AGENCY: Forest Service, USDA. ACTION: Notice of meeting. SUMMARY: The Black Hills National Forest Advisory Board (Board... all members of the Advisory Board; (2) provide orientation to Board Members on Basic Laws governing...

  16. Plants profile of Malakand Pass Hills, District Malakand, Pakistan

    African Journals Online (AJOL)

    use

    2011-11-21

    Nov 21, 2011 ... famous Malakand fort guards the road on both sides of the pass. Malakand is a ... Underneath Malakand Hills, the waters of the River Swat ... southern sloping faces of the hills. They speak ...... Pinus roxburghii Sarg. Antidote ...

  17. 27 CFR 9.162 - Sta. Rita Hills.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Sta. Rita Hills. 9.162.... Rita Hills. (a) Name. The name of the viticultural area described in this section is “Sta. Rita Hills”. For purposes of part 4 of this chapter, “Sta. Rita Hills” is a term of viticultural significance. (b...

  18. Spectral parameter power series representation for Hill's discriminant

    International Nuclear Information System (INIS)

    Khmelnytskaya, K.V.; Rosu, H.C.

    2010-01-01

    We establish a series representation of the Hill discriminant based on the spectral parameter power series (SPPS) recently introduced by Kravchenko. We also show the invariance of the Hill discriminant under a Darboux transformation and employing the Mathieu case the feasibility of this type of series for numerical calculations of the eigenspectrum.

  19. Microhabitats of Merriam's turkeys in the Black Hills, South Dakota

    Science.gov (United States)

    Mark A. Rumble; Stanley H. Anderson

    1996-01-01

    Merriam’s Turkeys (Meleagris gallopavo merriami) are associated with ponderosa pine (Pinus ponderosa) forests in the western United States, but are not native to the ponderosa pine forest of the Black Hills, South Dakota. The Black Hills population was established by transplanting birds from New Mexico and Colorado between 1948 and...

  20. The montane forest associated amphibian species of the Taita Hills ...

    African Journals Online (AJOL)

    The montane forest associated amphibian species of the Taita Hills, Kenya. ... They are surrounded by the dry Tsavo plains. ... The biodiversity importance of the Taita Hills lies with the number of endemics per unit of area of remaining forest, ...

  1. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  2. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  3. Pouvoir et religion à la chapelle royale de Versailles sous Louis XIV Power and religion at the royal chapel of Versailles under Louis XIV

    Directory of Open Access Journals (Sweden)

    Alexandre Maral

    2007-12-01

    Full Text Available D’une manière peut‑être plus sensible que partout ailleurs, les objets et les insignes du pouvoir prennent une importance particulière dans le contexte du cérémonial liturgique de la religion catholique. À la chapelle royale de Versailles, la présence régulière du monarque et de sa cour complique encore la situation, d’autant que la desserte est assurée par deux corps distincts d’ecclésiastiques. Dépassant le simple cadre des préséances, Louis XIV a défini autour de sa personne royale un système rituel susceptible d’en manifester le caractère épiscopal dérivé du sacre. De même, l’enjeu juridictionnel représenté par la Chapelle royale se traduit par un jeu subtil d’attitudes, de gestes et de rites, chorégraphie sacrée qui accompagne et exprime les revendications des partisans et des adversaires de l’exemption du lieu de culte royal au regard du diocèse de Paris. Ce discours trouve un écho partiel dans le programme décoratif de la chapelle définitive du palais, achevée en 1710.Objects and symbols of power take on a particular importance in the liturgical ceremony of the Catholic Church, perhaps more so than in any other context. At the royal chapel of Versailles, the regular presence of the king and his court complicated the situation further, all the more so in that religious ceremony was administered by two distinct ecclesiastic bodies. Beyond the rules of precedence, Louis XIV had introduced around his royal persona a system of ritual that would manifest the episcopal identity conferred upon him by his coronation. Similarly, the jurisdictional authority represented by the royal chapel was conveyed in a subtle play of attitudes, gestures and rites, a symbolic choreography that accompanied and expressed the claims of the partisans and adversaries of the exemption of the royal place of worship with regard to the diocese of Paris. This stance was reflected in the decorative scheme of the palace

  4. Motivations of female Black Hills deer hunters

    Science.gov (United States)

    Gigliotti, Larry M.; Covelli Metcalf, Elizabeth

    2016-01-01

    State fish and wildlife agencies are particularly interested in attracting female participation because of the potential to offset declining participation in hunting. Understanding female hunters’ motivations will be critical for designing effective recruitment and retention programs for women hunters. Although female participation in hunting is increasing, males still outnumber females by about tenfold. Gender differences in deer hunters were explored by comparing ratings of eight motivations (social, nature, excitement, meat, challenge, trophy, extra hunting opportunity, and solitude). Hunter types were defined by hunters’ selection of the most important motivation for why they like Black Hills deer hunting. Overall, females and males were relatively similar in their ratings of the eight motivations, and we found 85% gender similarity in the selection of the most important motivation. Women were slightly more motivated by the food aspect of the hunt while men placed slightly more value on the hunt as a sporting activity.

  5. HydroHillChart – Pelton module. Software used to Calculate the Hill Chart of the Pelton Hydraulic Turbines

    OpenAIRE

    Dorian Nedelcu; Adelina Bostan; Florin Peris-Bendu

    2015-01-01

    The paper presents the HydroHillChart - Pelton module application, used to calculate the hill chart of the Pelton hydraulic turbine models, by processing the data measured on the stand. In addition, the tools offered by the application such as: interface, menu, input data, numerical and graphical results, etc. are described.

  6. HydroHillChart – Pelton module. Software used to Calculate the Hill Chart of the Pelton Hydraulic Turbines

    Directory of Open Access Journals (Sweden)

    Dorian Nedelcu

    2015-07-01

    Full Text Available The paper presents the HydroHillChart - Pelton module application, used to calculate the hill chart of the Pelton hydraulic turbine models, by processing the data measured on the stand. In addition, the tools offered by the application such as: interface, menu, input data, numerical and graphical results, etc. are described.

  7. Ash and Steam, Soufriere Hills Volcano, Monserrat

    Science.gov (United States)

    2002-01-01

    International Space Station crew members are regularly alerted to dynamic events on the Earth's surface. On request from scientists on the ground, the ISS crew observed and recorded activity from the summit of Soufriere Hills on March 20, 2002. These two images provide a context view of the island (bottom) and a detailed view of the summit plume (top). When the images were taken, the eastern side of the summit region experienced continued lava growth, and reports posted on the Smithsonian Institution's Weekly Volcanic Activity Report indicate that 'large (50-70 m high), fast-growing, spines developed on the dome's summit. These spines periodically collapsed, producing pyroclastic flows down the volcano's east flank that sometimes reached the Tar River fan. Small ash clouds produced from these events reached roughly 1 km above the volcano and drifted westward over Plymouth and Richmond Hill. Ash predominately fell into the sea. Sulfur dioxide emission rates remained high. Theodolite measurements of the dome taken on March 20 yielded a dome height of 1,039 m.' Other photographs by astronauts of Montserrat have been posted on the Earth Observatory: digital photograph number ISS002-E-9309, taken on July 9, 2001; and a recolored and reprojected version of the same image. Digital photograph numbers ISS004-E-8972 and 8973 were taken 20 March, 2002 from Space Station Alpha and were provided by the Earth Sciences and Image Analysis Laboratory at Johnson Space Center. Additional images taken by astronauts and cosmonauts can be viewed at the NASA-JSC Gateway to Astronaut Photography of Earth.

  8. Flotation process control optimisation at Prominent Hill

    International Nuclear Information System (INIS)

    Lombardi, Josephine; Muhamad, Nur; Weidenbach, M.

    2012-01-01

    OZ Minerals' Prominent Hill copper- gold concentrator is located 130 km south east of the town of Coober Pedy in the Gawler Craton of South Australia. The concentrator was built in 2008 and commenced commercial production in early 2009. The Prominent Hill concentrator is comprised of a conventional grinding and flotation processing plant with a 9.6 Mtpa ore throughput capacity. The flotation circuit includes six rougher cells, an IseMill for regrinding the rougher concentrate and a Jameson cell heading up the three stage conventional cell cleaner circuit. In total there are four level controllers in the rougher train and ten level controllers in the cleaning circuit for 18 cells. Generic proportional — integral and derivative (PID) control used on the level controllers alone propagated any disturbances downstream in the circuit that were generated from the grinding circuit, hoppers, between cells and interconnected banks of cells, having a negative impact on plant performance. To better control such disturbances, FloatStar level stabiliser was selected for installation on the flotation circuit to account for the interaction between the cells. Multivariable control was also installed on the five concentrate hoppers to maintain consistent feed to the cells and to the IsaMill. An additional area identified for optimisation in the flotation circuit was the mass pull rate from the rougher cells. FloatStar flow optimiser was selected to be installed subsequent to the FloatStar level stabiliser. This allowed for a unified, consistent and optimal approach to running the rougher circuit. This paper describes the improvement in the stabilisation of the circuit achieved by the FloatStar level stabiliser by using the interaction matrix between cell level controllers and the results and benefits of implementing the FloatStar flow optimiser on the rougher train.

  9. 3D Modeling By Consolidation Of Independent Geometries Extracted From Point Clouds - The Case Of The Modeling Of The Turckheim's Chapel (Alsace, France)

    Science.gov (United States)

    Koehl, M.; Fabre, Ph.; Schlussel, B.

    2014-06-01

    Turckheim is a small town located in Alsace, north-east of France. In the heart of the Alsatian vineyard, this city has many historical monuments including its old church. To understand the effectiveness of the project described in this paper, it is important to have a look at the history of this church. Indeed there are many historical events that explain its renovation and even its partial reconstruction. The first mention of a christian sanctuary in Turckheim dates back to 898. It will be replaced in the 12th century by a roman church (chapel), which subsists today as the bell tower. Touched by a lightning in 1661, the tower then was enhanced. In 1736, it was repaired following damage sustained in a tornado. In 1791, the town installs an organ to the church. Last milestone, the church is destroyed by fire in 1978. The organ, like the heart of the church will then have to be again restored (1983) with a simplified architecture. From this heavy and rich past, it unfortunately and as it is often the case, remains only very few documents and information available apart from facts stated in some sporadic writings. And with regard to the geometry, the positioning, the physical characteristics of the initial building, there are very little indication. Some assumptions of positions and right-of-way were well issued by different historians or archaeologists. The acquisition and 3D modeling project must therefore provide the current state of the edifice to serve as the basis of new investigations and for the generation of new hypotheses on the locations and historical shapes of this church and its original chapel (Fig. 1)

  10. 3D Modeling By Consolidation Of Independent Geometries Extracted From Point Clouds – The Case Of The Modeling Of The Turckheim's Chapel (Alsace, France

    Directory of Open Access Journals (Sweden)

    M. Koehl

    2014-06-01

    Full Text Available Turckheim is a small town located in Alsace, north-east of France. In the heart of the Alsatian vineyard, this city has many historical monuments including its old church. To understand the effectiveness of the project described in this paper, it is important to have a look at the history of this church. Indeed there are many historical events that explain its renovation and even its partial reconstruction. The first mention of a christian sanctuary in Turckheim dates back to 898. It will be replaced in the 12th century by a roman church (chapel, which subsists today as the bell tower. Touched by a lightning in 1661, the tower then was enhanced. In 1736, it was repaired following damage sustained in a tornado. In 1791, the town installs an organ to the church. Last milestone, the church is destroyed by fire in 1978. The organ, like the heart of the church will then have to be again restored (1983 with a simplified architecture. From this heavy and rich past, it unfortunately and as it is often the case, remains only very few documents and information available apart from facts stated in some sporadic writings. And with regard to the geometry, the positioning, the physical characteristics of the initial building, there are very little indication. Some assumptions of positions and right-of-way were well issued by different historians or archaeologists. The acquisition and 3D modeling project must therefore provide the current state of the edifice to serve as the basis of new investigations and for the generation of new hypotheses on the locations and historical shapes of this church and its original chapel (Fig. 1

  11. Funny hills in pion spectra from heavy-ion collisions

    International Nuclear Information System (INIS)

    Rasmussen, J.O.

    1982-03-01

    A discussion of some of the systematic features of the pion spectra in heavy-ions reactions is given. A discussion of the hills and valleys in heavy ion pion spectra that show up at the lower pion energies is given. The following topics are discussed: (1) three kinds of funny hills; (2) π - / + ratios near center of mass; (3) new Monte Carlo studies of charged pion spectra; and (4) pion orbiting about fireballs and Bose-Einstein behavior as explanation for the mid-rapidity P/sub perpendicular to/ approx. = 0.4 to 0.5 m/sub π/c hill

  12. Evolution of the Puente Hills Thrust Fault

    Science.gov (United States)

    Bergen, K. J.; Shaw, J. H.; Dolan, J. F.

    2013-12-01

    This study aims to assess the evolution of the blind Puente Hills thrust fault system (PHT) by determining its age of initiation, lateral propagation history, and changes in slip rate over time. The PHT presents one of the largest seismic hazards in the United States, given its location beneath downtown Los Angeles. The PHT is comprised of three fault segments: the Los Angeles (LA), Santa Fe Springs (SFS), and Coyote Hills (CH). The LA and SFS segments are characterized by growth stratigraphy where folds formed by uplift on the fault segments have been continually buried by sediment from the Los Angeles and San Gabriel rivers. The CH segment has developed topography and is characterized by onlapping growth stratigraphy. This depositional setting gives us the unique opportunity to measure uplift on the LA and SFS fault segments, and minimum uplift on the CH fault segment, as the difference in sediment thicknesses across the buried folds. We utilize depth converted oil industry seismic reflection data to image the fold geometries. Identifying time-correlative stratigraphic markers for slip rate determination in the basin has been a problem for researchers in the past, however, as the faunal assemblages observed in wells are time-transgressive by nature. To overcome this, we utilize the sequence stratigraphic model and well picks of Ponti et al. (2007) as a basis for mapping time-correlative sequence boundaries throughout our industry seismic reflection data from the present to the Pleistocene. From the Pleistocene to Miocene we identify additional sequence boundaries in our seismic reflection data from imaged sequence geometries and by correlating industry well formation tops. The sequence and formation top picks are then used to build 3-dimensional surfaces in the modeling program Gocad. From these surfaces we measure the change in thicknesses across the folds to obtain uplift rates between each sequence boundary. Our results show three distinct phases of

  13. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  14. 78 FR 21098 - Black Hills National Forest Advisory Board

    Science.gov (United States)

    2013-04-09

    ... Hills National Forest Advisory Board (Board) will meet in Rapid City South Dakota. The Board is... staff before the meeting. The agenda will include time for people to make oral statements of three...

  15. USGS Hill Shade Base Map Service from The National Map

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — USGS Hill Shade (or Shaded Relief) is a tile cache base map created from the National Elevation Dataset (NED), a seamless dataset of best available raster elevation...

  16. "Beverly Hills 90210" : kes mida teeb / Tiina Lepiste

    Index Scriptorium Estoniae

    Lepiste, Tiina

    2003-01-01

    Aaron Spellingu produtseeritud ja 2000. aastal lõpetatud menuseriaalis "Beverly Hills 90210" osalenud näitlejate edaspidisest elust seoses plaaniga teha täispikk mängufilm "10 Year High School Reunion"

  17. Stormwater Management Plan for the Arden Hills Army Training Site, Arden Hills, Minnesota

    Energy Technology Data Exchange (ETDEWEB)

    Carr, Adrianne E. [Argonne National Lab. (ANL), Argonne, IL (United States); Wuthrich, Kelsey K. [Argonne National Lab. (ANL), Argonne, IL (United States); Ziech, Angela M. [Argonne National Lab. (ANL), Argonne, IL (United States); Bowen, Esther E. [Argonne National Lab. (ANL), Argonne, IL (United States); Quinn, John [Argonne National Lab. (ANL), Argonne, IL (United States)

    2013-03-01

    This stormwater management plan focuses on the cantonment and training areas of the Arden Hills Army Training Site (AHATS). The plan relates the site stormwater to the regulatory framework, and it summarizes best management practices to aide site managers in promoting clean site runoff. It includes documentation for a newly developed, detailed model of stormwater flow retention for the entire AHATS property and adjacent upgradient areas. The model relies on established modeling codes integrated in a U.S. Department of Defense-sponsored software tool, the Watershed Modeling System (WMS), and it can be updated with data on changes in land use or with monitoring data.

  18. After runaway: The trans-Hill stage of planetesimal growth

    International Nuclear Information System (INIS)

    Lithwick, Yoram

    2014-01-01

    When planetesimals begin to grow by coagulation, they first enter an epoch of runaway, during which the biggest bodies grow faster than all the others. The questions of how runaway ends and what comes next have not been answered satisfactorily. We show that runaway is followed by a new stage—the 'trans-Hill stage'—that commences when the bodies that dominate viscous stirring ('big bodies') become trans-Hill, i.e., when their Hill velocity matches the random speed of the small bodies they accrete. Subsequently, the small bodies' random speed grows in lockstep with the big bodies' sizes, such that the system remains in the trans-Hill state. Trans-Hill growth is crucial for determining the efficiency of growing big bodies, as well as their growth timescale and size spectrum. Trans-Hill growth has two sub-stages. In the earlier one, which occurs while the stirring bodies remain sufficiently small, the evolution is collisionless, i.e., collisional cooling among all bodies is irrelevant. The efficiency of forming big bodies in this collisionless sub-stage is very low, ∼10α << 1, where α ∼ 0.005(a/AU) –1 is the ratio between the physical size of a body and its Hill radius. Furthermore, the size spectrum is flat (equal mass per size decade, i.e., q = 4). This collisionless trans-Hill solution explains results from previous coagulation simulations for both the Kuiper Belt and the asteroid belt. The second trans-Hill sub-stage commences once the stirring bodies grow big enough (>α –1 × the size of the accreted small bodies). After that time, collisional cooling among small bodies controls the evolution. The efficiency of forming big bodies rises and the size spectrum becomes more top heavy. Trans-Hill growth can terminate in one of two ways, depending on the sizes of the small bodies. First, mutual accretion of big bodies can become significant and conglomeration proceeds until half of the total mass is converted into big bodies

  19. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  20. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  1. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  2. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  3. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  4. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  5. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  6. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  7. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  8. ORF Sequence: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  9. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  10. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

  11. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

  12. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  13. Biogeography of the Shimba Hills ecosystem herpetofauna in Kenya.

    Science.gov (United States)

    Malonza, Patrick K; Mulwa, David M; Nyamache, Joash O; Jones, Georgina

    2018-03-18

    The Shimba Hills ecosystem along the south coast of Kenya is a key East African biodiversity hotspot. Historically, it is biogeographically assignable to the East African coastal biome. We examined the current Shimba Hills herpetofauna and their zoogeographical affinities to the coastal forests and nearby Eastern Arc Mountains biodiversity hotspots. The key studied sites included the Shimba Hills National Reserve, forest reserves, Kaya forests, and adjacent private land. Data on herpetofaunal richness were obtained from recent field surveys, literature, and specimens held at the National Museums of Kenya, Herpetology Section Collection, Nairobi. The Makadara, Mwele, and Longo-Mwagandi forests within the Shimba Hills National Reserve hosted the highest number of unique and rare species. Generally, the forest reserves and Kaya forests were important refuges for forest-associated species. On private land, Mukurumudzi Dam riparian areas were the best amphibian habitat and were host to three IUCN (Red List) Endangered-EN amphibian species, namely, Boulengerula changamwensis, Hyperolius rubrovermiculatus, and Afrixalus sylvaticus, as well as one snake species Elapsoidea nigra. Using herpetofauna as zoogeographic indicators, the Shimba Hills were determined to be at a crossroads between the coastal forests (13 endemic species) and the Eastern Arc Mountains (seven endemic species). Most of the Eastern Arc Mountains endemic species were from recent records, and thus more are likely to be found in the future. This 'hybrid' species richness pattern is attributable to the hilly topography of the Shimba Hills and their proximity to the Indian Ocean. This has contributed to the Shimba Hills being the richest herpetofauna area in Kenya, with a total of 89 and 36 reptile and amphibian species, respectively. Because of its unique zoogeography, the Shimba Hills ecosystem is undoubtedly a key biodiversity area for conservation investment.

  14. Archeological Investigations at Big Hill Lake, Southeastern Kansas, 1980.

    Science.gov (United States)

    1982-09-01

    settled primarily along the Neosho river and Labette, Big Hill, and Pumpkin creeks. One of the first settlers in Osage township, in which Big Hill...slabs is not known at present. About 10 years later, in 1876, materials were reported- ly collected from an aboriginal site along Pumpkin creek...and length- ening its lifetime of use. As would therefore be expected, cracks are present between each of the paired holes on both of the two restored

  15. The Bradford Hill considerations on causality: a counterfactual perspective

    Directory of Open Access Journals (Sweden)

    Höfler Michael

    2005-11-01

    Full Text Available Abstract Bradford Hill's considerations published in 1965 had an enormous influence on attempts to separate causal from non-causal explanations of observed associations. These considerations were often applied as a checklist of criteria, although they were by no means intended to be used in this way by Hill himself. Hill, however, avoided defining explicitly what he meant by "causal effect". This paper provides a fresh point of view on Hill's considerations from the perspective of counterfactual causality. I argue that counterfactual arguments strongly contribute to the question of when to apply the Hill considerations. Some of the considerations, however, involve many counterfactuals in a broader causal system, and their heuristic value decreases as the complexity of a system increases; the danger of misapplying them can be high. The impacts of these insights for study design and data analysis are discussed. The key analysis tool to assess the applicability of Hill's considerations is multiple bias modelling (Bayesian methods and Monte Carlo sensitivity analysis; these methods should be used much more frequently.

  16. Greenways Pedestrian & Cyclist Counters

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Pedestrian and cyclist sensor data time stamped from sensors on the Bolin Creek Trail and Meadowmont Trail in Chapel Hill. Each sensor has four value points that...

  17. Pedestrian Crashes

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — This data set maps the locations of crashes involving pedestrians in the Chapel Hill Region of North Carolina.The data comes from police-reported bicycle-motor...

  18. Community Survey Q2: What to emphasize in Q1

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — This question is from the 2015 Chapel Hill Community Survey.Which THREE of these items do you think should receive the most emphasis from Town leaders over the next...

  19. Bicycle Crashes

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — This data set maps the locations of crashes involving bicyclists in the Chapel Hill Region of North Carolina.The data comes from police-reported bicycle-motor...

  20. Community Survey Q7: Nature of police interactions with respondents

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — This question is from the 2015 Chapel Hill Community Survey.Have you interacted with the Town’s Police Department in any of the following ways within the past 2...

  1. Precursors to the Development of Anxiety Disorders in Young Children with Autism Spectrum Disorder

    Science.gov (United States)

    2017-12-01

    graduate trainees. Undergraduate Training: Logan Beyer, a Duke University undergraduate student , received course credit as an Independent Study student ...Grace Baranek at UNC Chapel Hill, and Adrianne Harris, a graduate student under Drs. Geraldine Dawson, and Nancy Zucker at Duke University , have... Responsivity in Children with Autism.” Poster presented at the Visual Thinking Symposium at Duke University , Durham, NC. Baranek, G. T. (2015

  2. Book Reviews

    OpenAIRE

    Redactie KITLV

    2001-01-01

    -Virginia R. Dominguez, Louis A. Pérez, Jr., On becoming Cuban: Identity, nationality, and culture. Chapel Hill: University of North Carolina Press, 1999. xiv + 579 pp. -Solimar Otero, Kali Argyriadis, La religión à la Havane: Actualités des représentations et des pratiques culturelles havanaises. Paris: Éditions des Archives Contemporaines,1999. 373 pp. -Jane Desmond, Jane Blocker, Where is Ana Mendieta?: Identity, performativity, and exile. Durham NC: Duke University Press, 1999. xvi + 166 ...

  3. Circadian rhythm and sleep influences on digestive physiology and disorders

    OpenAIRE

    Vaughn, Bradley; Rotolo,Sean; Roth,Heidi

    2014-01-01

    Bradley V Vaughn, Sean Rotolo, Heidi L Roth Division of Sleep Medicine, Department of Neurology, University of North Carolina School of Medicine, Chapel Hill, NC, USA Abstract: Circadian rhythms and sleep influence a variety of physiological functions, including the digestive system. The digestive system also has intrinsic rhythms that interact dynamically with circadian rhythms. New advances in understanding the interaction of these rhythms and sleep provide the prospect of evaluating their...

  4. Nutrition in pregnancy: the argument for including a source of choline

    OpenAIRE

    Zeisel, Steven H

    2013-01-01

    Steven H Zeisel Nutrition Research Institute at Kannapolis, Department of Nutrition, University of North Carolina at Chapel Hill, Kannapolis, NC, USA Abstract: Women, during pregnancy and lactation, should eat foods that contain adequate amounts of choline. A mother delivers large amounts of choline across the placenta to the fetus, and after birth she delivers large amounts of choline in milk to the infant; this greatly increases the demand on the choline stores of the mother. Adequate inta...

  5. Filipino Insurgencies (1899-1913): Failures to Incite Popular Support

    Science.gov (United States)

    2016-04-08

    Wars of Peace, 6. 5 Richard E . Welch, Response to Imperialism: The United States and the Philippine- American War, 1899-1902 (Chapel Hill, NC...Muslim Filipinos, 1899-1920 (Quezon City, Philippines: New Day Publishing, 1983). 24 Carlos Quirino, Filipinos at War (Philippines: Vera -Reyes, Inc...Carlos. Filipinos at War. Philippines: Vera -Reyes, Inc, 1987. Ramsey, Robert D. Savage Wars of Peace: Case Studies of Pacification in the Philippines

  6. Statistical Bias in Maximum Likelihood Estimators of Item Parameters.

    Science.gov (United States)

    1982-04-01

    34 a> E r’r~e r ,C Ie I# ne,..,.rVi rnd Id.,flfv b1 - bindk numb.r) I; ,t-i i-cd I ’ tiie bias in the maximum likelihood ,st i- i;, ’ t iIeiIrs in...NTC, IL 60088 Psychometric Laboratory University of North Carolina I ERIC Facility-Acquisitions Davie Hall 013A 4833 Rugby Avenue Chapel Hill, NC

  7. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  8. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  9. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  10. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-26

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  11. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  12. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  13. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  14. The experience of the National Historical and Artistic Heritage Service in São Paulo: the restoration of the Santo Antônio ranch and chapel, 1940-1947

    Directory of Open Access Journals (Sweden)

    Cristiane Souza Gonçalves

    2007-06-01

    Full Text Available Among the pioneer examples of architectural heritage preservation works, the restoration of the Santo Antônio ranch and chapel, in São Roque, represents a significant case of the activities held by architect Luis Saia, while leading the São Paulo´s regional office of the federal organ then called National Historical and Artistic Heritage Service (Sphan in portuguese, from 1945 to 1975. The architectural set, which consisted of a 17th century house and chapel and the ruins of a 19th century building, was an impressive discovery which delighted Mario de Andrade by the end of the 1930´s. However its poor conservation condition demanded urgent repair to restore its physical integrity. It presented, then, to the architects of Sphan a bigger and more complex restoration and conservation challenge whose phases and results will be subject of analysis in the present article.

  15. Fertility in Hill Korwas -- a primitive tribe of Madhya Pradesh.

    Science.gov (United States)

    Pandey, G D; Tiwary, R S

    1996-12-01

    This study examines fertility behavior among 604 eligible couples in Hill Korwa tribes in Madhya Pradesh state, India. Low fertility patterns are compared to those of neighboring Gonds and nontribals from rural Jabalpur. The Hill Korwa are a subtribe of the Korwa, who remained in the hills and dense forests. Over 60% live in three tehsils of Surguja district, including Ambikapur tehsil where the study was conducted. Data were obtained in March 1991. Eligible couples were those where both partners live together and the noncontracepting wife is under age 50 and nonmenopausal. Only 3% were literate. Female marriage age was about 15 years. The median age was 23.8 years. 92% lived below the poverty line. The average number of children ever born (CEB) per couple was 1.9, compared to 2.5 for the Gond and 2.9 for nontribal couples. The CEB in a reproductive lifetime was 2.9, compared to 5.3 for Gond women and 5.9 for nontribal women. Fecundity among Hill Korwa women was 66% lower at younger ages (16-17 years and 17-18 years), and the differences increased with an increase in age at marriage. Hill Korwas had a low female age at marriage, low literacy, low percentages engaged in agriculture, and higher percentages living above the poverty line.

  16. A conversão do sertão capelas e a governamentalidade nas Minas Gerais The conversion of the hinterland chapels and governamentalidade in the Minas Gerais

    Directory of Open Access Journals (Sweden)

    Francisco Eduardo de Andrade

    2007-06-01

    Full Text Available O artigo trata da instituição das capelas no território das Minas Gerais, considerando a sua significação política e a sua relação com o enquadramento social da população. Procura-se avaliar essa prática de poder, desde a fundação pelos patronos coloniais até o reconhecimento eclesiástico e régio. Observando-se os laços políticos na segunda metade do século XVIII, verifica-se ainda que as capelas, mecanismos de poder senhorial e de normalização dos súditos, tinham um papel fundamental na governamentalidade do Estado, especialmente nas fronteiras.This paper is concerned with the establishment of chapels in Minas Gerais, taking into account its political meaning and its relationship with the social fitting of the population. Power practices are evaluated, since foundations of the chapels by colonial sponsors to their ecclesiastical and royal admissions. Considering political bonds on the second half of the eighteen century, one verifies that chapels - a way of power of owners and subject regulation - had a fundamental role in the government, mainly at frontiers.

  17. Bike Map Lines

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Chapel Hill Bike Map Lines from KMZ file.This data came from the wiki comment board for the public, not an “official map” showing the Town of Chapel Hill's plans or...

  18. The interpretation of the figure of the prophet Jonah by Michelangelo on the ceiling of the Sistine Chapel: anatomical urological vision.

    Science.gov (United States)

    Reis, Leonardo Oliveira; Zani, Emerson Luis; Alonso, Joao Carlos; Simoes, Fabiano Andre; Rejowski, Ronald Finamore; Barreto, Gilson

    2012-01-01

    A detailed analysis in the iconography and pictorial appearance of the scene of the "Prophet Jonah" painted by the artist Michelangelo Buonarroti (1475-1564) on the ceiling of the Sistine Chapel between the years 1508 and 1512. Literature review on the Italian Renaissance period and the life of Michelangelo Buonarroti and analysis of historical aspects of the evolution of studies of human anatomy in this period and the works of the artist. A comparative analysis of the representation of the figure of the fish on the left thigh of "Jonah " with a cross section of penis shows a curious similarity. The pictorial and iconographic analysis reveals an intensity of light on the pubic area and the position of the prophet with the legs spread apart and left hand placed on this region. A tube-shaped cloth covers the region and the angel at the side seems to be looking at this anatomical region of "Jonah". In fact, sets of iconographic and pictorial relate to the deciphered code. This description helps to confirm the relationship of the Renaissance art with the human anatomy; science has been much studied in this period. The design of a cross section of the penis is revealed with the two cavernous bodies with the septum between them and the spongy body. Considering the circumstances in which Michelangelo had painted, subjectivity was fundamental due to religious motivations added to the vigorous implications of a limited scientific knowledge typical of that era.

  19. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  20. Midwest nukes tumble, rock industry: Byron, Marble Hill, Zimmer

    International Nuclear Information System (INIS)

    Nogee, A.

    1984-01-01

    The nuclear industry is suffering from a lack of investor confidence because of cancelled projects and the unprecedented rejection of an operating license for Commonwealth Edison's Byron plant on grounds that the utility failed to meet quality assurance responsibilities. When plans to complete the Zimmer and Marble Hill nuclear plants were abandoned, Bechtel came forward with a financing plan that, while rejected for Zimmer and Marble Hill, could lead to future bailouts. Both Zimmer and Marble Hill plants could be partially converted to coal. The loss of investor confidence in nuclear plants is largely due to political pressures brought on by a combination of citizen intervenors, whistle blowers on construction sites and disagreements between participating utilities. A rise in stock prices followed the cancellation announcements and the lowered investment security ratings

  1. 2013 strategic petroleum reserve big hill well integrity grading report.

    Energy Technology Data Exchange (ETDEWEB)

    Lord, David L.; Roberts, Barry L.; Lord, Anna C. Snider; Bettin, Giorgia; Sobolik, Steven Ronald; Park, Byoung Yoon; Rudeen, David Keith; Eldredge, Lisa; Wynn, Karen; Checkai, Dean; Perry, James Thomas

    2014-02-01

    This report summarizes the work performed in developing a framework for the prioritization of cavern access wells for remediation and monitoring at the Big Hill Strategic Petroleum Reserve site. This framework was then applied to all 28 wells at the Big Hill site with each well receiving a grade for remediation and monitoring. Numerous factors affecting well integrity were incorporated into the grading framework including casing survey results, cavern pressure history, results from geomechanical simulations, and site geologic factors. The framework was developed in a way as to be applicable to all four of the Strategic Petroleum Reserve sites.

  2. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  3. Eagle Hill, Kenya: changes over 60 years | Thomsett | Scopus ...

    African Journals Online (AJOL)

    Eagle Hill, the study site of the late Leslie Brown, was first surveyed over 60 years ago in 1948. The demise of its eagle population was near-complete less than 50 years later, but significantly, the majority of these losses occurred in the space of a few years in the late 1970s. Unfortunately, human densities and land use ...

  4. 78 FR 76100 - Black Hills National Forest Advisory Board

    Science.gov (United States)

    2013-12-16

    ...: The Black Hills National Forest Advisory Board (Board) will meet in Rapid City, South Dakota. The... Ranger District, 8221 South Highway 16, Rapid City, South Dakota. Written comments may be submitted as... the public. The agenda will include time for people to make oral statements of three minutes or less...

  5. Correct thermodynamic forces in Tsallis thermodynamics: connection with Hill nanothermodynamics

    International Nuclear Information System (INIS)

    Garcia-Morales, Vladimir; Cervera, Javier; Pellicer, Julio

    2005-01-01

    The equivalence between Tsallis thermodynamics and Hill's nanothermodynamics is established. The correct thermodynamic forces in Tsallis thermodynamics are pointed out. Through this connection we also find a general expression for the entropic index q which we illustrate with two physical examples, allowing in both cases to relate q to the underlying dynamics of the Hamiltonian systems

  6. Key tiger habitats in the Garo Hills of Meghalaya

    Science.gov (United States)

    Ashish Kumar; Bruce G. Marcot

    2010-01-01

    We describe assumed tiger habitat characteristics and attempt to identify potential tiger habitats in the Garo Hills region of Meghalaya, North East India. Conserving large forest tracts and protected wildlife habitats provides an opportunity for restoring populations of wide-ranging wildlife such as tigers and elephants. Based on limited field observations coupled...

  7. Some noteworthy distributional records from the Gwassi Hills area ...

    African Journals Online (AJOL)

    A preliminary inventory of birds occurring in the Gwassi Hills area was compiled by Bradley et .... Woodpecker by some), on the basis of a paler grey head and underparts, and the absence of .... Bay, 50 km to the northeast (Lewis & Pomeroy 1989, D. Turner pers. ... These birds appeared slightly darker with more slaty tones.

  8. State of conservation of Santa Martha's hills, Colombia

    International Nuclear Information System (INIS)

    Lopez Salgado, Hector Jaime; Carbono Delahoz, Eduino

    2006-01-01

    The urban growth of Santa Marta and the occupation without planning of their surrounding hills, affect their natural conditions. The hills are part of the scenic beauty of the city and its conservation is indispensable to maintain the standard of life in her the vegetal cover corresponds to forests and scrubs of isomegathermic floor with xeromorphic characters, due to the low pluvial precipitation, this landscape characterizes the Colombian Caribbean coast in a narrow strip that extends from the south of the Guajira to the gulf of Morrosquillo. At the present time, only they are left surpluses in natural state, due to the floristic simplification of the vegetation, the introduction of invading species and modification of the landscape. The responsibility of the suitable handling of the urban space is imperative for the official, private sector and citizen institutions. The objective is to make an evaluation of the environmental conditions of hills of the city, in order to obtain basic elements, for the design of appropriate strategies of handling and its conservation. By means of the use of the GIS, with verification and aerial photo interpretation of field a multi-temporary study (1955-1993-2003) of the vegetal cover of the hills was elaborated that allowed to establish the happened changes. The execution of inventors allowed knowing the wealth and the structure floristic the vegetal cover of the area. The work was executed between May of the 2004 and May of the 2005

  9. Dental disease control in Pine Hill, New Mexico.

    Science.gov (United States)

    Carberry, Frank J; Cloud, Bill; Finster, Carolyn

    2004-02-01

    One-year results of a community-operated dental disease control project in Pine Hill, New Mexico. The program uses fluoride, chiefly rinse, and has not only reduced the amount of decay in permanent teeth, but has markedly reduced the need for restorative care of primary teeth.

  10. Amphibian diversity in Shimba Hills National Reserve, Kenya: A ...

    African Journals Online (AJOL)

    We present the first annotated amphibian checklist of Shimba Hills National Reserve (SHNR). The list comprises of 30 currently known amphibians (28 anurans and two caecilians), which includes 11 families and 15 genera. In addition, individual records per species, distribution in the reserve and brief remarks about the ...

  11. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  12. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  13. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  7. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  8. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  9. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  10. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  11. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  12. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  13. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  14. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  15. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  16. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  17. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  18. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  19. ORF Alignment: NC_006569 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  20. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  1. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  2. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  3. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  4. ORF Alignment: NC_006371 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  5. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  6. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  7. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  8. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  9. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  10. ORF Sequence: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  11. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  12. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  13. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  14. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  15. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  16. ORF Sequence: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  17. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  18. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  19. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  20. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  1. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  2. ORF Alignment: NC_003064 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  3. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  4. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  5. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  6. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  7. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  8. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  9. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  10. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  11. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  12. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  13. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  14. The interpretation of the figure of the prophet Jonah by Michelangelo on the ceiling of the sistine chapel: anatomical urological vision

    Directory of Open Access Journals (Sweden)

    Leonardo Oliveira Reis

    2012-06-01

    Full Text Available PURPOSE:A detailed analysis in the iconography and pictorial appearance of the scene of the "Prophet Jonah" painted by the artist Michelangelo Buonarroti (1475-1564 on the ceiling of the Sistine Chapel between the years 1508 and 1512. MATERIALS AND METHODS:Literature review on the Italian Renaissance period and the life of Michelangelo Buonarroti and analysis of historical aspects of the evolution of studies of human anatomy in this period and the works of the artist. RESULTS:A comparative analysis of the representation of the figure of the fish on the left thigh of "Jonah" with a cross section of penis shows a curious similarity. The pictorial and iconographic analysis reveals an intensity of light on the pubic area and the position of the prophet with the legs spread apart and left hand placed on this region. A tube-shaped cloth covers the region and the angel at the side seems to be looking at this anatomical region of "Jonah". In fact, sets of iconographic and pictorial relate to the deciphered code. CONCLUSIONS: This description helps to confirm the relationship of the Renaissance art with the human anatomy; science has been much studied in this period. The design of a cross section of the penis is revealed with the two cavernous bodies with the septum between them and the spongy body. Considering the circumstances in which Michelangelo had painted, subjectivity was fundamental due to religious motivations added to the vigorous implications of a limited scientific knowledge typical of that era.

  15. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  16. Measurements of the near-surface flow over a hill

    Science.gov (United States)

    Vosper, S. B.; Mobbs, S. D.; Gardiner, B. A.

    2002-10-01

    The near-surface flow over a hill with moderate slope and height comparable with the boundary-layer depth is investigated through field measurements of the mean flow (at 2 m), surface pressure, and turbulent momentum flux divergence between 8 and 15 m. The measurements were made along an east-west transect across the hill Tighvein (height 458 m, approximate width 8 km) on the Isle of Arran, south-west Scotland, during two separate periods, each of around three-weeks duration. Radiosonde ascents are used to determine the variation of a Froude number, FL = U/NL, where U is the wind speed at the middle-layer height, hm, N is the mean Brunt-Väisälä frequency below this height and L is a hill length-scale. Measurements show that for moderately stratified flows (for which FL 0.25) a minimum in the hill-induced surface-pressure perturbation occurs across the summit and this is accompanied by a maximum in the near-surface wind speed. In the more strongly stratified case (FL 0.25) the pressure field is more asymmetric and the lee-slope flow is generally stronger than on the windward slope. Such a flow pattern is qualitatively consistent with that predicted by stratified linear boundary-layer and gravity-wave theories. The near-surface momentum budget is analysed by evaluating the dominant terms in a Bernoulli equation suitable for turbulent flow. Measurements during periods of westerly flow are used to evaluate the dominant terms, and the equation is shown to hold to a reasonable approximation on the upwind slope of the hill and also on the downwind slope, away from the summit. Immediately downwind of the summit, however, the Bernoulli equation does not hold. Possible reasons for this, such as non-separated sheltering and flow separation, are discussed.

  17. Phosphorus forms in soils of Oban Hills, Akamkpa, Cross River State ...

    African Journals Online (AJOL)

    Oban Hills is located at Akamkpa in the Southern Senatorial District of Cross River, State, Nigeria. Phosphorus (P)-rich soil from the Hills is expected to have an effect on retention and distribution in the highly acidic soils surrounding the area inundated for several years. Phosphorus forms in the soils of the Hills varied with ...

  18. Multi-scale habitat use of male ruffed grouse in the Black Hills National Forest

    Science.gov (United States)

    Cassandra L. Mehls; Kent C. Jensen; Mark A. Rumble; Michael C. Wimberly

    2014-01-01

    Ruffed grouse (Bonasa umbellus) are native upland game birds and a management indicator species (MIS) for aspen (Populus tremuloides) in the Black Hills National Forest (Black Hills). Our objective was to assess resource selection of male ruffed grouse to identify the most appropriate scale to manage for aspen and ruffed grouse in the Black Hills. During spring 2007...

  19. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  20. A language for image processing HILLS and its supporting system SDIP

    International Nuclear Information System (INIS)

    Suzuki, H.; Toriwaki, J.

    1984-01-01

    This paper presents a language HILLS and its supporting system SDIP for image processing. HILLS is a key-word type language for describing image processing procedures by using subroutine packages SLIP and SPIDER. SDIP, written in FORTRAN to keep portability, supports programming by HILLS in interactive mode including functions such as editing, translating HILLS into FORTRAN, error detection, and providing manual information. Results of preliminary experiments suggest that HILLS and SDIP are very useful tools for beginners and researchers in application fields of image processing to develop desired image analysis procedures

  1. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  2. EMG activities and plantar pressures during ski jumping take-off on three different sized hills.

    Science.gov (United States)

    Virmavirta, M; Perttunen, J; Komi, P V

    2001-04-01

    Different profiles of ski jumping hills have been assumed to make the initiation of take-off difficult especially when moving from one hill to another. Neuromuscular adaptation of ski jumpers to the different jumping hills was examined by measuring muscle activation and plantar pressure of the primary take-off muscles on three different sized hills. Two young ski jumpers volunteered as subjects and they performed several trials from each hill (K-35 m, K-65 m and K-90 m) with the same electromyographic (EMG) electrode and insole pressure transducer set-up. The results showed that the differences in plantar pressure and EMGs between the jumping hills were smaller than expected for both jumpers. The small changes in EMG amplitudes between the hills support the assumption that the take-off was performed with the same intensity on different jumping hills and the timing of the gluteus EMG demonstrates well the similarity of the muscle activation on different hills. On the basis of the results obtained it seems that ski jumping training on small hills does not disturb the movement patterns for bigger hills and can also be helpful for special take-off training with low speed.

  3. Profiles in medical courage: causation and Austin Bradford Hill

    Directory of Open Access Journals (Sweden)

    Robbins RA

    2012-09-01

    Full Text Available Austin Bradford Hill was a British epidemiologist and statistician who is best remembered for two landmark pulmonary studies. He was the statistician on the Medical Research Council Streptomycin in Tuberculosis Trial. This is regarded as the first randomized clinical trial. The second was the demonstration of the connection between cigarette smoking and lung cancer. However, Hill’s most lasting contribution may be his establishment of a group of conditions necessary to provide adequate evidence of a causal relationship between an incidence and a consequence, widely known as the Bradford Hill Criteria of Causation. In this profile of medical courage we examine his remarkable background that led to the epidemiological equivalent of Koch’s postulates.

  4. Environmental protection and regulatory compliance at the Elk Hills field

    International Nuclear Information System (INIS)

    Chappelle, H.H.; Donahoe, R.L.; Kato, T.T.; Ordway, H.E.

    1991-01-01

    Environmental protection has played an integral role in the development and operation of the Elk Hills field since production at the maximum efficient rate was authorized in 1976. The field is located in a non-attainment area for California and National Ambient Air Quality Standards for two criteria pollutants and their associated precursors, is home to four endangered species, and operates within the California regulatory framework. Environmental protection and regulatory compliance is a multi-faceted program carried out through a substantial commitment of resources and workforce involvement. This paper describes the actions taken and resources employed to protect the environment, specific technologies and projects implemented, and the ongoing nature of these efforts at Elk Hills

  5. Meteorological observations in support of a hill cap cloud experiment

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Morten

    1998-06-01

    Humid air flows form a hill cap cloud over the Agana mountain ridge in the north-east of Tenerife. The HILLCLOUD project utilised this cloud formation to investigate the chemical and physical properties of cloud aerosols by land based observations. The project was part of the second Aerosol characterisation Experiment (ACE-2) of the International Global Atmospheric chemistry project (IGAC). The present report describes meteorological observations in support of the hill cap cloud experiment. Time-series of wind speed, wind direction, temperature and humidity were collected at ground-based meteorological stations during a period starting one year in advance of the main campaign. A series of radiosonde detecting the upstream stability and wind profile were launched during the main campaign. (au) 5 tabs., 32 ills., 6 refs.

  6. Topographical Hill Shading Map Production Based Tianditu (map World)

    Science.gov (United States)

    Wang, C.; Zha, Z.; Tang, D.; Yang, J.

    2018-04-01

    TIANDITU (Map World) is the public version of National Platform for Common Geospatial Information Service, and the terrain service is an important channel for users on the platform. With the development of TIANDITU, topographical hill shading map production for providing and updating global terrain map on line becomes necessary for the characters of strong intuition, three-dimensional sense and aesthetic effect. As such, the terrain service of TIANDITU focuses on displaying the different scales of topographical data globally. And this paper mainly aims to research the method of topographical hill shading map production globally using DEM (Digital Elevation Model) data between the displaying scales about 1 : 140,000,000 to 1 : 4,000,000, corresponded the display level from 2 to 7 on TIANDITU website.

  7. Generation of terrestrial radiation database in the Larsemann Hills, Antarctica

    International Nuclear Information System (INIS)

    Pal, Rupali; Dhabekar, Bhushan; Jose, Jis Romal; Chinnaesakki, S.; Bakshi, A.K.; Datta, D.; Pradeepkumar, K.S.

    2018-01-01

    Natural background radiation in the environment includes terrestrial radiation, cosmic radiation from space and air activity due to radon/thoron. It is known that cosmic contribution increases near the poles. The terrestrial component is largely due to 232 Th and 238 U series and 40 K. BARC under the cosmic ray dosimetry project with National Centre for Antarctic and Ocean Research (NCAOR) has taken up measurement of natural background radiation at Larsemann Hills, Antarctica. The project includes generation of baseline data on terrestrial radioactivity in water, soil and rock and estimation of cosmic ray doses. Extensive radiation surveys were carried out by the BARC team in the 35 th and 36 th expedition in and around Larsemann hills in East Antarctica where the third Indian station 'Bharati' is situated. This paper presents mapping of terrestrial radiation levels in Antarctica which will help in strengthening the background radiation database and develop a Radiation Informatics System (RIS)

  8. Diversity and biogeography of land snails (Mollusca, Gastropoda) in the limestone hills of Perak, Peninsular Malaysia

    Science.gov (United States)

    Foon, Junn Kitt; Clements, Gopalasamy Reuben; Liew, Thor-Seng

    2017-01-01

    Abstract Limestone hills are now gaining global conservation attention as hotspots for short-range endemic species. Levels of land snail endemism can be high at limestone hills, especially at hill clusters that are geographically isolated. In the State of Perak, Peninsular Malaysia, limestone hills have been opportunistically surveyed for land snails in the past, but the majority have yet to be surveyed. To address this knowledge gap, we systematically surveyed the terrestrial malacofauna of 12 limestone hills that, based on our opinion, are a representation of the limestone land snail assemblages within the State. Our inventory yielded high sampling completeness (>85%). We found 122 species of land snails, of which 34 species were unique to one of the surveyed hills. We identified 30 species that are potentially new to science. The number of land snail species recorded at each hill ranged between 39 and 63 species. Four of the sampled limestone hills namely, Prk 01 G. Tempurung, Prk 55 G. Pondok, Prk 47 Kanthan, and Prk 64 Bt Kepala Gajah, have high levels of species richness and unique species, representing 91% of the total species recorded in this study. We identified two clusters of limestone hills in central Perak with distinct differences in land snail species composition – a northern hill cluster on elevated granite bedrock and southern hill cluster in a low-lying valley surrounded by alluvial soils. As limestone hills continue to be quarried to meet the cement demand, the four identified limestone hills, along with other hills from the two clusters, warrant urgent conservation attention in order to maintain high species diversity within Perak’s terrestrial malacofauna. PMID:28769723

  9. Susceptibility of Shallow Landslide in Fraser Hill Catchment, Pahang Malaysia

    Directory of Open Access Journals (Sweden)

    Wan Nor Azmin Sulaiman

    2010-01-01

    Full Text Available In tropical areas especially during monsoon seasons intense precipitation is the main caused that trigger the natural shallow landslide phenomena. This phenomenon can be disastrous and widespread in occurrence even in undisturbed forested catchment. In this paper, an attempt has been made to evaluate the susceptibility of natural hill slopes to failure for a popular hill resort area, the Fraser Hill Catchment under different rainfall regimes and soil thickness. A Digital Elevation Model (DEM was prepared for the 8.2 km2 catchment. A GIS based deterministic model was then applied to predict the spatial landslide occurrence within catchment. Model input parameters include bulk density, friction angle, cohesion and hydraulic conductivity were gathered through in situ and lab analysis as well as from previous soil analysis records. Landslides locations were recorded using GPS as well as previous air photos and satellite imagery to establish landslide source areas inventory. The landslide susceptibility map was produced under different precipitation event’s simulation to see the effects of precipitation to stability of the hill slopes of the catchment. The results were categorized into naturally unstable (Defended, Upper Threshold, Lower Threshold, marginal instability (Quasi Stable and stable area (Moderately Stable and Stable. Results of the simulation indicated notable change in precipitation effect on Defended area is between 10mm to 40mm range in a single storm event. However, when storm event is exceeded 120mm, the result on Defended area produced by the model tends to be constant further on. For area categorized as naturally unstable (Factor of Safety, SF<1, with 110 mm of precipitation in a single storm event and soil depth at 2 meters and 4 meters could affect 69.51% and 69.88% respectively of the catchment area fall under that class. In addition, the model was able to detect 4% more of the landslide inventory under shallower soil depth of

  10. Do Welsh hill farmers dream of radioactive sheep?

    International Nuclear Information System (INIS)

    Roberts, Gwyn; Williams, Aled; Last, D.

    1993-01-01

    A low-power portable device is being used successfully in North Wales to provide precise position-logging of sheep grazing on upland hill pastures following irradiation by fallout from the Chernobyl reactor. This follows the discovery that radiation levels appear to vary significantly among sheep from the same flock, suggesting hot-spots of radiation. The design and execution of the system is described. (UK)

  11. The Lister Hill National Center for Biomedical Communications.

    Science.gov (United States)

    Smith, K A

    1994-09-01

    On August 3, 1968, the Joint Resolution of the Congress established the program and construction of the Lister Hill National Center for Biomedical Communications. The facility dedicated in 1980 contains the latest in computer and communications technologies. The history, program requirements, construction management, and general planning are discussed including technical issues regarding cabling, systems functions, heating, ventilation, and air conditioning system (HVAC), fire suppression, research and development laboratories, among others.

  12. Mammals of Kalimpong Hills, Darjeeling District, West Bengal, India

    Directory of Open Access Journals (Sweden)

    J.K. Mallick

    2012-10-01

    Full Text Available Neora Valley National Park (NVNP in the Kalimpong Hills, Darjeeling District, having a wide range of altitudinal variations (183-3,200 m and climatic conditions and forming an ecological trijunction with Sikkim and Bhutan, is the last virgin wilderness in West Bengal. It is a global hotspot for the unique ecosystem, where tropical, sub-tropical, temperate and sub-temperate forests represent a wealth of biodiversity including many threatened and rare mammals. It is the prime habitat of Ailurus fulgens (estimated population 28-32, Neofelis nebulosa (population unassessed, Ursus thibetanus (18, Bos gaurus (81, Hemitragus jemlahicus (32, Naemorhedus goral (73, Capricornis sumatraensis (89, Rusa unicolor (286, Muntiacus vaginalis (590 and Sus scrofa (615. Discovery of Panthera tigris (20 in 1998 prompted the forest department to include NVNP as a sensitive wildlife zone. Many authors recorded the mammalian diversity in Darjeeling District since the mid-nineteenth century, but most of them referred to the Darjeeling Hills. The documentations on Kalimpong Hills are scarce because of the dense canopy, thick undergrowth and inaccessible terrain, particularly in the pristine forests of Neora Valley. Consequently, a comprehensive compendium of the mammals in this region was not prepared. A study was undertaken in 2008-2009 with a view to bridging this knowledge-gap and presenting an updated account of the mammalian species in this new short-listed World Heritage Site and surrounding forests of the Kalimpong Hills based on literature review, questionnaire survey, direct sighting and indirect evidences. During June-October 1916, N.A. Baptista recorded 29 mammalian species (22 genera out of 563 specimens collected, from the region. The present study registered 99 species (68 genera after 94 years.

  13. Antimicrobial activity of Davilla elliptica St. Hill (Dilleniaceae

    Directory of Open Access Journals (Sweden)

    D.C. Michelin

    Full Text Available Davilla elliptica St. Hill ("lixinha", family Dilleniaceae, is commonly used in the Brazilian folk medicine as purgative and stimulant. This work evaluated the antimicrobial activity of the methanol and chloroform extracts of the leaves and barks of D. elliptica using the disc-diffusion method. The results obtained showed that the methanolic extracts of the leaves and barks presented antimicrobial activity against the tested microorganisms.

  14. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  15. DOE to accept bids for Elk Hills crude

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This paper reports that the Department of Energy will accept bids in a reoffering sale covering 53,400 b/d of Elk Hills field oil but later may exercise an option to cut sales volumes and ship 20,000 b/d to Strategic Petroleum Reserve sites in Texas. DOE rejected all 19 bids submitted in an earlier semiannual sale of crude oil from the California naval petroleum reserve, saying they were too low. DOE the, The unique combination of federal and state government policies affecting the movement of oil into and out of the California market has contributed to a situation in which it apparently is very difficult for the government to receive a price for Elk Hills oil that satisfies the minimum price tests that govern the sale of Elk Hills oil. The 12 winning bids in the reoffering sale averaged $13.58/bbl, with bids for the higher quality Stevens zone crude averaging $13.92/bbl, about 67 cents/bbl higher than bids rejected last month. DOE the 20,000 b/d is all local pipelines can ship to the interstate All-American pipeline for transfer to Texas beginning in June

  16. ACCOMMODATION INFRASTRUCTURE AND TOURISM FLOWS ON FELEACU HILL (CLUJ COUNTY

    Directory of Open Access Journals (Sweden)

    DANIELA-LIVIA GHEORGHIEȘ

    2016-06-01

    Full Text Available Accommodation Infrastructure and Tourism Flows on Feleacu Hill (Cluj County. Feleacu Hill experienced tourism development between 2001 and 2015. The INS data indicates that the number of accommodation units increased from one (2001 to four (2015 and there are a few more which are not registered in the INS database. The accommodation capacity increases, as many guesthouses are expanding their premises to receive more tourists and new accommodation units emerge, such as Hotel Premier in Vâlcele (Feleacu commune. Tourism flows also registered a highly positive trend. The number of arrivals increased from 95 tourists in 2002 to 7791 tourists in 2015. However, there was a downturn between 2009 and 2012, due to the economic crisis and the opening of the Turda – Gilău motorway (A3, which redirected transit routes outside the region and led to the closure of Paradis Hotel in 2012. Since 2012, the number of arrivals and overnight stays increased steadily due to the development of new forms of tourism – rural tourism, agrotourism, extreme tourism and complex tourism, materialized in growing numbers of tourists at the two guesthouses in Ciurila commune (“La Mesteceni” and “Domeniul Regilor”. Tourism brings obvious benefits to the rural communities on Feleacu Hill, even if the average duration of stay is still low.

  17. Geologic map of the Bodie Hills, California and Nevada

    Science.gov (United States)

    John, David A.; du Bray, Edward A.; Box, Stephen E.; Vikre, Peter G.; Rytuba, James J.; Fleck, Robert J.; Moring, Barry C.

    2015-01-01

    The Bodie Hills covers about 1,200 km2 straddling the California-Nevada state boundary just north of Mono Lake in the western part of the Basin and Range Province, about 20 km east of the central Sierra Nevada. The area is mostly underlain by the partly overlapping, middle to late Miocene Bodie Hills volcanic field and Pliocene to late Pleistocene Aurora volcanic field (John and others, 2012). Upper Miocene to Pliocene sedimentary deposits, mostly basin-filling sediments, gravel deposits, and fanglomerates, lap onto the west, north, and east sides of the Bodie Hills, where they cover older Miocene volcanic rocks. Quaternary surficial deposits, including extensive colluvial, fluvial, glacial, and lacustrine deposits, locally cover all older rocks. Miocene and younger rocks are tilted ≤30° in variable directions. These rocks are cut by several sets of high-angle faults that exhibit a temporal change from conjugate northeast-striking left-lateral and north-striking right-lateral oblique-slip faults in rocks older than about 9 Ma to north- and northwest-striking dip-slip faults in late Miocene rocks. The youngest faults are north-striking normal and northeast-striking left-lateral oblique-slip faults that cut Pliocene-Pleistocene rocks. Numerous hydrothermal systems were active during Miocene magmatism and formed extensive zones of hydrothermally altered rocks and several large mineral deposits, including gold- and silver-rich veins in the Bodie and Aurora mining districts (Vikre and others, in press).

  18. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  19. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    National Research Council Canada - National Science Library

    Kim, Byung

    1997-01-01

    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  20. The proterozoic Georgetown Province - a Broken Hill analogue

    International Nuclear Information System (INIS)

    Carr, G.R.

    2000-01-01

    Collaborative work between CSIRO and AGSO has resulted in the development of a Pb isotope model that attempts to place relatively precise (∼5 Ma) age constraints on Proterozoic mineralisation in the Mount Isa and McArthur River terrains (Sun et al., 1994). Although this model was developed for sediment hosted mineralisation in low grade metamorphic terrains, the CSIRO-AGSO model ages for other mineralisation in high-grade terrains such as Broken Hill appear to be consistent with the U-Pb zircon ages obtained for the high-grade host sequences. Without independent evidence that the model is applicable to such terrains, the observations cannot be used to indicate the age of the mineralisation. Lead isotope data obtained on potassium feldspar separates from five felsic intrusive samples in the Georgetown terrain show a wide range of Pb isotope ratios. The lowest 206 Pb/ 204 Pb analyses are considered to approximate to the Proterozoic initial ratio and indicate a model age of ∼1510 Ma based on the CSIRO-AGSO model. This age is 45 Ma younger than the crystallisation age of the granite, but must be considered a minimum as the initial 206 Pb/ 204 Pb ratio may well prove to be lower after more comprehensive analysis. Sulfide mineralisation within the Einasleigh Metamorphics has a wide range of 206 Pb/ 204 Pb ratios that lie between this granite value and the relatively homogeneous population from Railway Flat. The Railway Flat data are very similar to values for Broken Hill and also the Broken Hill-type Pegmont mineralisation in the Mount Isa Eastern Succession. These data all have significantly lower 207 Pb/ 204 Pb ratios than the CSIRO-AGSO model, suggesting a significantly different source rock environment for this style of mineralisation from that for the sediment hosted deposits

  1. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

  2. ORF Alignment: NC_002570 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

  3. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  4. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  5. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  6. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  7. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  8. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  9. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  10. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  11. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  12. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  13. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  14. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

  15. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  16. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  17. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  18. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

  19. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

  20. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  1. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

  2. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

  3. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

  4. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  5. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  6. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  7. ORF Alignment: NC_003237 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  8. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

  9. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  10. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  11. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  12. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  13. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  14. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  15. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  16. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

  17. ORF Alignment: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  18. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

  19. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

  20. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  1. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  2. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

  3. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

  4. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

  5. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  6. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

  7. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

  8. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

  9. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

  10. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

  11. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  12. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  13. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  14. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  15. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

  16. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

  17. ORF Alignment: NC_005861 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

  18. ORF Alignment: NC_005070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

  19. ORF Alignment: NC_003233 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

  20. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

  1. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

  2. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  3. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

  4. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  5. ORF Alignment: NC_003364 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  6. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  7. ORF Alignment: NC_005787 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  8. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  9. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

  10. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

  11. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  12. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

  13. ORF Alignment: NC_003232 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

  14. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    African Journals Online (AJOL)

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  15. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  16. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

  17. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

  18. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

  19. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  20. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  1. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  2. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  3. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  4. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  5. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  6. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  7. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  8. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  9. ORF Alignment: NC_004331 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

  10. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

  11. Large-Nc quantum chromodynamics and harmonic sums

    Indian Academy of Sciences (India)

    2012-06-08

    Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

  12. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  13. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  14. ORF Alignment: NC_002771 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

  15. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  16. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

  17. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  18. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  19. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  20. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  1. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923033 >1sd4A 3 117 7 121 9e-28 ... dbj|BAB56205.1| methicillin resist...ance regulatory protein [Staphylococcus aureus ... subsp. aureus Mu50] sp|Q932L5|MECI_STAAM Methicill...in ... resistance regulatory protein mecI ref|NP_370567.1| ... methicillin resistance regulato

  2. ORF Alignment: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15600953 >1cqxA 1 398 1 388 e-107 ... gb|AAF96096.1| ferrisiderophore re...ductase [Vibrio cholerae O1 biovar eltor str. ... N16961] ref|NP_232583.1| ferrisiderophore reductase... ... [Vibrio cholerae O1 biovar eltor str. N16961] ... pir||F82491 ferrisiderophore reductase

  3. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

  4. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

  5. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

  6. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16121259 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  7. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

  8. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15890948 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  9. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45443224 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  10. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

  11. ORF Alignment: NC_004088 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004088 gi|22127219 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  12. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

  13. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17937718 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  14. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  15. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  16. ORF Alignment: NC_003284 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

  17. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800390 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  18. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062138 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  19. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26246664 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  20. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829972 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  1. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56479698 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  2. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|24115225 >1e94E 1 443 7 449 e-162 ... pdb|1E94|F Chain F, Hslv-Hslu From E.Coli... pdb|1E94|E Chain E, Hslv-Hslu From ... E.Coli pdb|1HQY|F Chain F, Nucleotide-Dependent ...

  3. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  4. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  5. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

  6. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

  7. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

  8. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

  9. ORF Alignment: NC_004350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

  10. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  11. ORF Alignment: NC_000907 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae

  12. ORF Alignment: NC_002528 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002528 gi|15617004 >1etoB 1 98 1 98 1e-23 ... ref|NP_240217.1| factor-for-inversion... ... DNA-binding protein fis dbj|BAB13103.1| ... factor-for-inversion stimulation protein [Buchnera ... ... aphidicola str. APS (Acyrthosiphon pisum)] pir||G84976 ... factor-for-inversion

  13. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  14. ORF Alignment: NC_004603 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  15. ORF Alignment: NC_004061 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

  16. ORF Alignment: NC_006512 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion

  17. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  18. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  19. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  20. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent

  1. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  2. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  3. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

  4. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

  5. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

  6. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

  7. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  8. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  9. ORF Alignment: NC_000918 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

  10. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  11. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  12. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

  13. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  14. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  15. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

  16. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

  17. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  18. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

  19. ORF Alignment: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

  20. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

  1. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

  2. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

  3. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01

  4. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000917 gi|11498586 >1b0uA 5 258 11 250 4e-55 ... ref|NP_069814.1| osmoprotection p...rotein (proV) [Archaeoglobus fulgidus DSM 4304] ... gb|AAB90260.1| osmoprotection protein (proV) ... ... ... [Archaeoglobus fulgidus DSM 4304] pir||E69372 ... osmoprotection protein (proV) homolog - Arch

  5. ORF Alignment: NC_000915 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000915 gi|15645437 >1r9lA 6 291 286 549 7e-39 ... gb|AAD07866.1| osmoprotection pr...otein (proWX) [Helicobacter pylori 26695] ... pir||B64622 osmoprotection protein - Helicobacter pylor...i ... (strain 26695) ref|NP_207611.1| osmoprotection protein ... (proWX) [Helicobacter pylori

  6. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  7. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  8. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  9. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

  10. ORF Alignment: NC_000912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  11. ORF Alignment: NC_003304 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003304 gi|17934663 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  12. ORF Alignment: NC_003062 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003062 gi|15888096 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  13. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu

  14. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

  15. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID

  16. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  17. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  18. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  19. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  20. ORF Alignment: NC_003198 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  1. ORF Alignment: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  2. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  3. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  4. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  5. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  6. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  7. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  8. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  9. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601919 >1n62B 44 802 1 748 0.0 ... ref|NP_148464.1| nicotine dehydroge...nase chain C [Aeropyrum pernix K1] ... dbj|BAA81228.1| 750aa long hypothetical nicotine ... de...hydrogenase chain C [Aeropyrum pernix K1] pir||D72530 ... probable nicotine dehydrogenase chain C APE

  10. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601920 >1n62C 1 286 1 287 2e-71 ... ref|NP_148465.1| nicotine dehydrog...enase chain A [Aeropyrum pernix K1] ... dbj|BAA81231.1| 292aa long hypothetical nicotine ... d...ehydrogenase chain A [Aeropyrum pernix K1] pir||G72530 ... probable nicotine dehydrogenase chain A AP

  11. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

  12. ORF Alignment: NC_006509 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

  13. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

  14. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote

  15. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  16. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  17. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  18. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  19. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

  20. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

  1. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

  2. ORF Alignment: NC_002737 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

  3. ORF Alignment: NC_003485 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

  4. ORF Alignment: NC_003485 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

  5. ORF Alignment: NC_002737 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

  6. ORF Alignment: NC_004350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004350 gi|24379337 >1g5aA 90 627 3 535 7e-83 ... gb|AAN58598.1| dextran glucosidas...e DexB [Streptococcus mutans UA159] ... ref|NP_721292.1| dextran glucosidase DexB [Streptococcus ... ... ... (Exo-1,6-alpha-glucosidase) (Glucodextranase) ... Length = 533 ... Que

  7. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  8. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne

  9. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

  10. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

  11. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

  12. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

  13. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  14. ORF Alignment: NC_006322 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006322 gi|52786856 >4uagA 8 419 4 423 5e-47 ... ref|YP_092685.1| MurC [Bacillus li...cheniformis ATCC 14580] gb|AAU41992.1| MurC ... [Bacillus licheniformis DSM 13] sp|Q65G22|MURC_BACLD

  15. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

  16. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  17. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

  18. ORF Alignment: NC_002976 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

  19. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

  20. ORF Alignment: NC_002951 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

  1. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

  2. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  3. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

  4. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  5. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  6. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  7. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

  8. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

  10. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

  11. ORF Alignment: NC_002679 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

  12. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  13. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  14. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  15. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  17. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  18. ORF Alignment: NC_004088 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  19. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

  20. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy