WorldWideScience

Sample records for cha verde camellia

  1. Estudo prospectivo, duplo cego e cruzado da Camellia sinensis (chá verde nas dislipidemias Estudio prospectivo, doble ciego y cruzado de la Camellia sinensis (té verde en las dislipidemias Prospective double-blind crossover study of Camellia sinensis (green tea in dyslipidemias

    Directory of Open Access Journals (Sweden)

    Gesiani de Almeida Pierin Batista

    2009-08-01

    Full Text Available FUNDAMENTO: Estudos epidemiológicos estabeleceram uma associação entre dislipidemias e aterosclerose. A terapia nutricional é um ponto central da estratégia preventiva em indivíduos que apresentam fatores de risco para doença aterosclerótica. OBJETIVOS: Investigar os efeitos do chá verde (Camellia sinensis em pacientes portadores de dislipidemias. MÉTODOS: O estudo envolveu 33 pacientes, com idade entre 21 e 71 anos, que consumiam uma dieta com baixo teor de gorduras (25% a 35% das calorias totais e 200 mg de colesterol por dia. Foram randomizados para dois tratamentos sequenciais: cápsulas contendo 250 mg de extrato seco do chá verde ou placebo, administradas por um período total de 16 semanas, tendo cada paciente utilizado chá verde (Camellia sinensis por oito semanas e placebo em igual período. RESULTADOS: Os valores lipídicos basais (mg/dl foram os seguintes: HDL-colesterol 60,7 ± 7,3; colesterol total 255 ± 30,9; LDL-colesterol 158,8 ± 29,0; triglicerídeos 169,0 ± 61,3 e Apo-B 120,2 ± 18,9. As variações lipídicas médias, provocadas pelo uso do chá verde (Camellia sinensis, mostraram uma redução de 3,9 % (p = 0,006 nas concentrações do colesterol total e uma redução de 4,5 % (p = 0,026 do LDL-colesterol. A ingestão de chá verde não influenciou significativamente os níveis de HDL-colesterol, dos triglicerídeos e do Apo-B. Resultados não significativos foram observados na avaliação dos lipídeos sanguíneos (colesterol total e LDL-colesterol com o uso do placebo. CONCLUSÃO: Foi demonstrado o efeito benéfico do chá verde (Camellia sinensis, que reduziu significativamente, em oito semanas, os níveis de colesterol total e LDL-colesterol nesse grupo de pacientes.FUNDAMENTO: Estudios epidemiológicos establecieron una asociación entre dislipidemias y aterosclerosis. La terapia nutricional es un punto central de la estrategia preventiva en individuos que presentan factores de riesgo para enfermedad

  2. O papel coadjuvante das catequinas do chá verde (Camellia sinensis na redução da adiposidade

    Directory of Open Access Journals (Sweden)

    Mirza de Souza Conceição

    2015-03-01

    Full Text Available O chá é uma das bebidas mais consumidas no mundo, vem sendo utilizado pela população como coadjuvante no tratamento da redução de peso, uma vez que aumenta a termogênese e em muitos casos promove a saciedade. O objetivo deste trabalho foi mostrar como as catequinas do chá verde auxiliam no tratamento da obesidade. Foram realizadas buscas por artigos científicos nas bases de dados Science Direct, Google Acadêmico, Scielo, BVS, Medline e Wilson. Os artigos escolhidos foram publicados no período de 2000 a 2014. Observa-se que o tratamento da obesidade envolve necessariamente a reeducação alimentar, o aumento da atividade física e eventualmente, o uso de algumas medicações auxiliares. Outra alternativa, é o uso de fitoterápicos como por exemplo o chá verde. Estudos têm mostrado que este chá, que é obtido pela infusão da erva Camellia sinensis é rico em catequinas, responsáveis na redução de peso, pois promovem a termogênese e aumentam a saciedade. A epigalocatequina (EGCG, é a catequina mais abundante e mais forte do chá verde. É importante ressaltar que o chá usado de maneira inadequada pode causar hepatotoxicidade. O uso do chá associado a um plano alimentar equilibrado pode trazer benefícios à saúde além da perda de peso. Porém os estudos ainda não são conclusivos, sendo necessários mais estudos para que possa confirmar a eficácia do chá verde na obesidade e a quantidade a ser utilizada. Entretanto, a reeducação alimentar, exercício físico continuam sendo os fatores mais importantes no tratamento da obesidade, Onde o consumo de chá verde deve está associado a uma alimentação saudável.

  3. EXTRATO DE CHÁ VERDE (Camellia sinensis PROMOVE AÇÃO ANTIMICROBIANA SOBRE Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Leandro Wagner Figueira

    2017-01-01

    Full Text Available É de grande importância ampliar as pesquisas científicas com plantas medicinais sobre micro-organismos. Foi verificado o efeito antimicrobiano do extrato de C. sinensis , sobre cultura planctônica e biofilme de S. aureus. Neste estudo foi verificada ação do extrato entre 50 a 0,09 mg/mL sobre cultura planctônica, para determinação da CIM e CBM. A ação do extrato sobre biofilme foi analisada pela exposição de 5 min ao produto vegetal a 200mg/mL. Foi utilizado o método de MTT para determinar a redução da viabilidade do biofilme. Nos grupos controles foram utilizadas clorexidina (+ e solução salina (-, sendo n = 12/grupo. A redução do biofilme foi analisada por ANOVA e Tukey Test (p ≤ 0,05. Em cultura planctônica as concentrações avaliadas não foram efetivas, contudo, utilizando-se a concentração de 200 mg/mL sobre o biofilme, foi verificada redução significativa. Com isso, concluiu-se que o extrato de chá verde demonstrou ação sobre biofilme de S. aureus provendo redução significativa em sua viabilidade.

  4. Preparo e caracterização de tinturas das folhas de chá verde [Camellia sinensis (L. O. Kuntze] Theaceae

    Directory of Open Access Journals (Sweden)

    C.B. Santos

    2014-12-01

    Full Text Available Tinturas preparadas com as folhas de Camellia sinensis (chá verde, foram caracterizadas visando a obtenção de extratos enriquecidos em polifenóis. As tinturas foram obtidas por meio de maceração estática da droga pulverizada, com diferentes misturas de 60, 70, 80 e 94,5% de etanol em água. Em seguida foram filtradas e, após 8 dias de extração, realizaram-se as analises: organoléptica, pH, densidade, determinação do resíduo seco, perfil cromatográfico por camada delgada, e teor de polifenóis. Os resultados demonstraram que o solvente (mistura hidroalcoólica a 60 ou 70% extraiu a maior quantidade de constituintes químicos do chá verde; também foi o mais seletivo ao extrair, especificamente os polifenóis. Estes dados sugerem que a utilização de álcool etílico a 60 ou 70% conduz à obtenção de tinturas mais ricas em polifenóis, a partir das folhas do chá verde (C. sinensis.

  5. Polifenóis totais e flavonoides em amostras de chá verde (Camellia sinensis L. de diferentes marcas comercializadas na cidade de Salvador-BA

    Directory of Open Access Journals (Sweden)

    L.A. FIRMINO

    2015-09-01

    Full Text Available RESUMO Camellia sinensis é amplamente conhecida por seus efeitos benéficos à saúde humana. Dentre as diversas formas de processamento desta erva, o chá verde e chá preto são os mais populares. Neste trabalho objetivou-se avaliar os teores de fenólicos totais e flavonoides em amostras de 25 diferentes marcas disponíveis à venda em farmácias e supermercados de Salvador-Ba. Os resultados obtidos apresentaram diferenças significativas na concentração dos compostos fenólicos entre as marcas de chá verde estudadas. No estudo também ficou comprovado que, no preparo do chá verde, as amostras obtidas por infusão aquosa com agitação mecânica apresentaram maiores teores de polifenóis e flavonoides em relação àquelas que não foram submetidas à agitação.

  6. Atividade hepatoprotetora do extrato alcoólico da Camellia sinensis (L. Kuntze (chá-verde em ratos Wistar tratados com dietilnitrosamina

    Directory of Open Access Journals (Sweden)

    Wanderlei Onofre Schmitz

    Full Text Available O chá-verde (Camellia sinensis (L. Kuntze é utilizado por suas propriedades: antioxidante, quimioprotetora e antiinflamatória em varias situações patológicas, principalmente frente a compostos químicos cancerígenos. Para tanto se avaliou o efeito hepatoprotetor do extrato de chá verde (ECV sobre a lipoperoxidação e necrose provocada pelo agente cancerígeno Dietilnitrosamina (DEN no fígado de ratos machos Wistar. Os ratos foram expostos a dose única de 200 mg/kg de DEN via intra peritoneal e tratados por via oral de 120 mg/kg de ECV em diferentes momentos experimentais. Após 24 h em relação a exposição ao DEN, os animais foram sacrificados sendo avaliado: os níveis de AST/ALT no plasma, a lipoperoxidação por quantificação de TBARS e FOX no fígado e a ocorrência de necrose e hemorragia hepática através do estudo histopatológico. A ação quimioprotetora e a diminuição da lipoperoxidação foram verificadas pela diminuição das transaminases, TBARS, FOX e redução da necrose hepática. A avaliação confirmou a importância de se utiliza o chá verde como agente quimioprotetor, principalmente na forma preventiva.

  7. O papel coadjuvante das catequinas do chá verde (Camellia sinensis) na redução da adiposidade

    OpenAIRE

    Conceição, Mirza de Souza; Centro Universitário de Volta Redonda – UniFOA.; Ferreira, Célia Cristina Diogo; UFRJ; Nascimento, Kamila de Oliveira do; UFRRJ

    2015-01-01

    O chá é uma das bebidas mais consumidas no mundo, vem sendo utilizado pela população como coadjuvante no tratamento da redução de peso, uma vez que aumenta a termogênese e em muitos casos promove a saciedade. O objetivo deste trabalho foi mostrar como as catequinas do chá verde auxiliam no tratamento da obesidade. Foram realizadas buscas por artigos científicos nas bases de dados Science Direct, Google Acadêmico, Scielo, BVS, Medline e Wilson. Os artigos escolhidos foram publicados no período...

  8. Contenido de catequinas en cultivares argentinos de té (Camellia sinensis, elaborados como té verde Sencha

    Directory of Open Access Journals (Sweden)

    PRAT KRICUN, S.D

    2011-12-01

    Full Text Available ResumenEl presente proyecto tuvo como objetivo determinar el contenido de las siguientes catequinas, epigalocatequina-3-galato (EGCG, epigalocatequina (EGC, epicatequina (EC, catequina (C y catequina galato (CG, en los cultivares de té CH 14 INTA, CH 112 INTA, CH 318 INTA, CH 410 INTA y CH 732 INTA elaborados como té verde Sencha, durante tres épocas de zafra. Se empleó un sistema de extracción acuosa y la determinación se efectuó por cromatografía líquida de alta resolución (HPLC con elución isocrática. Los contenidos de catequinas determinados se estudiaron por análisis de variancia (P<0,05 y se investigaron las diferencias entre cultivares y la población control, épocas e interacciones. Se compararon las medias entre cultivares y la población control por medio de la prueba de Comparación Múltiple (P<0,05. Los resultados obtenidos permiten establecer las siguientes conclusiones. El contenido total promedio de todas las catequinas analizadas, alcanzó a 12,6% de materia seca. EGCG fue la catequina con más alta concentración, alcanzado un promedio de 6,68% ± 0,79, no registrando diferencias significativas entre cultivares. EGC alcanzó un segundo nivel con una concentración de 3,73% ± 0,42. Para EC, C y CG las concentraciones fueron de 1,13% ± 0,12; 0,34% ± 0,05 y 0,20% ± 0,04, respectivamente. Entre los cultivares elaborados que presentaron diferencias significativas respecto al resto, se incluye el cultivar CH 318 INTA que presentó la mayor concentración de EGCG y CG, con contenidos de 7,86 y 0,26%, respectivamente; para EGC los cultivares CH 410 INTA y CH 732 INTA, con un contenido de 4,4 y 4,1% respectivamente, en tanto que para EC y C el cultivar CH 732 INTA presentó los mayores contenidos con 1,69 y 0,55%. Entre las épocas de zafra, se registraron diferencias significativas, los mayores contenidos promedio de EGCG y EGC se presentaban al fin de zafra con 7,5 y 4,43%, en tanto que para EC, C y CG se presentaban

  9. Determinação de compostos fenólicos em amostras comerciais de chás verde e preto - Camellia sinensis (L. Kuntze, Theaceae = Determination of phenolic componds in commercial samples of green and black tea - Camellia sinensis (L. Kuntze, Theaceae

    Directory of Open Access Journals (Sweden)

    Airton Vicente Pereira

    2009-04-01

    Full Text Available O chá de Camellia sinensis é rico em compostos fenólicos antioxidantes, responsáveis por efeitos benéficos à saúde humana. Neste trabalho, foram realizadas as determinações da concentração de fenóis totais e flavonoides de sete amostras comerciais dos chás preto e verde. Os teores de fenóis totais variaram de 4,80 a 26,60 mg de pirogalol g-1 de amostra e os de flavonoides, de 0,46 a 1,10 mg de quercetina g-1 de amostra. A análise anatômica do conteúdo das amostras permitiu caracterizar a autenticidade dos produtos,observando-se os marcadores anatômicos típicos da espécie (estômatos anomocíticos, tricomas tectores unicelulares, mesofilo dorsiventral, drusas de oxalato de cálcio e esclereides.The tea from Camellia sinensis (green tea and black tea is rich in antioxidant phenolic compounds, responsible for beneficial effects to human health. In this work, determinations were carried out on theconcentration of total phenols and flavonoids in seven commercial samples of black tea and green tea. The samples presented concentrations of total phenols varying between 4.80 and 26.60 mg of pyrogallol g-1 and concentrations of flavonoids from 0.46 to 1.10 mg of quercetin g-1. With the purpose of characterizing the authenticity of the product contained in the sachets, the samples were fixed for histological studies. The samples presented the typical anatomical markers of the species (anomocytic stomata, unicellular non-glandulartrichomes, dorsiventral mesophyll, calcium oxalate druses and sclereids.

  10. AVALIAÇÃO DE POTENCIAL DE ERVAS MEDICINAIS: CAPIM-LIMÃO (Cymbopogon citratus D.C., CHÁ VERDE (Camellia sinensis L. E HIBISCO (Hibiscus sabdariffa L. PARA OBTENÇÃO DE CHÁS SOLÚVEIS

    Directory of Open Access Journals (Sweden)

    Uellison dos Santos

    2014-12-01

    Full Text Available Este trabalho foi realizado com o objetivo de avaliar características físico-químicas de extrato aquoso e liofilizado de capim-limão (Cymbopogon citratus D.C., chá verde (Camellia sinensis L. e hibisco (Hibiscus sabdariffa L., foram realizadas analises em triplicata  de teor de sólidos solúveis, acidez titulável, pH, atividade de água e solubilidade em água. Os resultados do extrato aquoso e liofilizado para o capim limão apresentaram (SST variando de 3,0333 a 38,3066, valores de pH variando de 5,08 e 6,32 além de atividade de água características para os estados em que os extratos se encontravam, para o resultado do chá verde obtivemos teor de (SST variando de 2,81 a 45,52, pH entre 5,04 e 6,28 além de atividade de água característica. Os extratos de hibisco também apresentaram resultados satisfatórios com teor (SST entre 3,28 e 34,16, pH de 2,34 e 3,16 e atividade de água característica.  Os resultados obtidos revelaram a importância do processo de liofilização nas amostras, uma vez que houve um aumento da qualidade dos chás sem que houvesse danos na sua qualidade sensorial.

  11. Chá verde (Camellia sinensis) e suas propriedades funcionais nas doenças crônicas não transmissíveis = Green tea (Camellia sinensis) and its functionals properties on transmissible chronic diseases

    OpenAIRE

    Senger, Ana Elisa Vieira; Schwanke, Carla Helena Augustin; Gottlieb, Maria Gabriela Valle

    2010-01-01

    Objetivos: fazer uma revisão sobre as principais propriedades do chá verde para a saúde humana Fonte de dados: artigos científicos das bases de dados Medline/Pubmed e SciELO Síntese dos dados: o chá é a bebida mais consumida no mundo depois da água. Devido ao seu processo de produção, o chá verde contém mais catequinas do que o chá preto ou chá oolong. Existem evidências científicas de que as catequinas são in vitro e in vivo potentes antioxidantes. Recentes estudos em humanos sugerem q...

  12. Chá verde (Camellia sinensis e suas propriedades funcionais nas doenças crônicas não transmissíveis = Green tea (Camellia sinensis and its functionals properties on transmissible chronic diseases

    Directory of Open Access Journals (Sweden)

    Senger, Ana Elisa Vieira

    2010-01-01

    Conclusões: apesar de todas as evidências promissoras sobre as propriedades funcionais do chá verde nas doenças crônicas não transmissíveis, investigações adicionais são necessárias para a compreensão da sua real contribuição para a saúde humana

  13. Determinação de compostos fenólicos em amostras comerciais de chás verde e preto - Camellia sinensis (L. Kuntze, Theaceae - DOI: 10.4025/actascihealthsci.v31i2.6233

    Directory of Open Access Journals (Sweden)

    Maria Eugênia Costa

    2009-09-01

    Full Text Available O chá de Camellia sinensis é rico em compostos fenólicos antioxidantes, responsáveis por efeitos benéficos à saúde humana. Neste trabalho, foram realizadas as determinações da concentração de fenóis totais e flavonoides de sete amostras comerciais dos chás preto e verde. Os teores de fenóis totais variaram de 4,80 a 26,60 mg de pirogalol g-1 de amostra e os de flavonoides, de 0,46 a 1,10 mg de quercetina g-1 de amostra. A análise anatômica do conteúdo das amostras permitiu caracterizar a autenticidade dos produtos, observando-se os marcadores anatômicos típicos da espécie (estômatos anomocíticos, tricomas tectores unicelulares, mesofilo dorsiventral, drusas de oxalato de cálcio e esclereides.

  14. Restoran Cha Dao = Restaurant Cha Dao

    Index Scriptorium Estoniae

    2012-01-01

    Tallinnas Suur-Patarei 2 asuva Hiina restorani Cha Dao sisekujundusest. Restorani mööbel, v.a toolid, projekteeriti eritellimusena. Sisearhitekt Dmitri Pisarenko (DM3 OÜ), loetletud tema töid. Arhitekt Meeli Truu

  15. Chá verde brasileiro (Camellia sinensis var assamica: efeitos do tempo de infusão, acondicionamento da erva e forma de preparo sobre a eficiência de extração dos bioativos e sobre a estabilidade da bebida Brazilian green tea (Camellia sinensis var assamica: effect of infusion time, mode of packaging and preparation on the extraction efficiency of bioactive compounds and on the stability of the beverage

    Directory of Open Access Journals (Sweden)

    Márcia Fernandes Nishiyama

    2010-05-01

    Full Text Available Os estudos do chá verde brasileiro (Camellia sinensis var assamica ainda são escassos quando comparados aos realizados com chás verdes produzidos em outros países. Os objetivos deste trabalho foram avaliar os efeitos do tempo de infusão, forma de acondicionamento da erva (a granel ou em sachês e forma de preparo da bebida na extração dos biativos do chá verde brasileiro e na estabilidade da bebida obtida. Foram avaliados os parâmetros sólidos solúveis e compostos fenólicos extraídos, bem como as propriedades antioxidantes da bebida pelo método DPPH (radicais 2,2-difenil-1-picrilhidrazil. Os dados obtidos evidenciam que o uso da erva a granel sob agitação e tempo de infusão de 5 minutos foi a condição mais propícia para a extração dos bioativos do chá verde. Aumentando-se o volume de preparação da bebida sem alteração da razão erva:água, aumentou-se a eficiência da extração dos bioativos, devido ao fato de que o resfriamento de volumes maiores é mais demorado que o resfriamento de volumes menores. As bebidas obtidas foram estáveis por 24 horas em temperatura ambiente e em geladeira, visto não terem sido detectadas redução das propriedades antioxidantes e variações significativas dos seus principais bioativos epigalocatequina galato, epicatequina, catequina e cafeína.Studies on the Brazilian green tea (Camellia sinensis var assamica are still scarce when compared with the great number of investigations conducted on the green tea produced in other countries. The purposes of the present study were to evaluate the effects of infusion time, mode of packaging (tea in bulk or in tea bags and preparation on the extraction of bioactive compounds from the Brazilian green tea and on the stability of the beverage. The evaluated parameters were: the amounts of soluble solutes and phenolic compounds that were extracted as well as the antioxidant properties of the beverage using the DPPH method (2,2-diphenyl-1

  16. Gamma radiation effects on the frequency of toxigenic fungus on sene (Cassia angustifolia) and green tea (Camelia sinensis) samples; Efeito da radiacao gama na frequencia de fungos toxigenicos em amostras de sene (Cassia angustifolia) e cha verde (Camellia sinensis)

    Energy Technology Data Exchange (ETDEWEB)

    Aquino, S.; Villavicencio, A.L.C.H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Tecnologia das Radiacoes]. E-mail: siaq06@hotmail.com; Reis, T.A.; Zorzete, P.; Correa, B. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Ciencias Biomedicas. Dept. de Microbiologia; Goncalez, E.; Rossi, M.H. [Instituto Biologico, Sao Paulo, SP (Brazil)

    2006-11-15

    The levels of contamination and gamma radiation effects were analyzed in the reduction of toxigenic filamentous fungus in two types of medicinal plants. Aspergillus and Penicillium were the predominant genders and 73,80% of the samples showed high levels of fungus contamination.

  17. Quantification of catechins and caffeine from green tea (Camellia sinensis infusions, extract, and ready-to-drink beverages Quantificação de catequinas e cafeína do chá verde (Camellia sinensis infusão, extrato e bebida pronta

    Directory of Open Access Journals (Sweden)

    Rafaela Macedo Mendes De Oliveira

    2012-03-01

    Full Text Available This study aimed to quantify the levels of catechins and caffeine in various forms of presentation of green tea: infusion tea bags, extract, and ready-to-drink beverage and, based on their content, identify the most suitable for consumption. High Performance Liquid Chromatography (HPLC analytical method was used for the quantification of catechins and caffeine. The tea bags had the highest concentration of total catechins with 5 to 9.5% followed by the extract with 3.64 to 4.88%, and ready-to-drink green tea beverage showed low levels of catechins, from 0.14 to 0.26%. As for caffeine content, green tea extract had higher concentration (1.96 to 3.54% compared to the tea bags (1.39 to 1.57%. Tea bags were found the most suitable for consumption because it contains higher amounts of catechins and smaller amounts of caffeine.O presente estudo teve como objetivo quantificar os teores de catequinas e cafeína em diferentes formas de apresentação do chá verde -infusão, extrato e bebida pronta - e, baseado no teor destes constituintes, identificar aquela mais apropriada para consumo. A cromatografia Líquida de Alta Eficiência (CLAE foi a metodologia analítica utilizada para a quantificação das catequinas e cafeína. O chá verde sachê obteve maior concentração de catequinas totais com 5 a 9,5%, seguido do extrato com 3,64 a 4,88%, o chá verde bebida pronta apresentou baixos teores de catequinas, 0,14 a 0,26%. Quanto ao teor de cafeína, o chá verde na forma de extrato obteve maior concentração, 1,96 a 3,54%, quando comparado ao sachê, 1,39 a 1,57%. O chá verde na forma de sachê mostrou-se mais indicado para consumo por conter maiores quantidades de catequinas e menores quantidades de cafeína.

  18. Growth inhibition of Walker carcinosarcoma 256 with alcoholic extract of green tea leaves (Camellia sinensis Inibição do crescimento do carcinossarcoma 256 de Walker pelo extrato alcoólico de folhas de chá verde(Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Mauriclécio Franco Ponte

    2012-09-01

    Full Text Available PURPOSE: To evaluate the antitumor activity of alcoholic extracts of green tea (Camella sinensis. METHODS: Four groups of six Wistar rats were inoculated intramuscularly with 10(6 Walker tumor cells/mL. During 10 days, the animals received by gavage either 0.9% saline solution (Group I; negative control, solution containing 20 mg/Kg of tamoxifen (Group II; positive control, solution containing 0.07 g/Kg alcoholic extract of C. sinensis (Group III, or solution containing 0.14 g/Kg alcoholic extract of C. sinensis (Group IV. Following euthanasia on the tenth day, the tumor, liver, kidneys and spleen were excised and weighed, and tumor volume and tumor growth inhibition were quantified. RESULTS: The average weight of the animals was greater in Group IV than in Group II (p=0.0107. Tumor weight was smaller in Group IV than in Group I (p=0.0062, but did not differ from Group II. Tumor volume was smaller in Groups II and IV than in Group I (p=0.0131. Tumor growth inhibition was observed in Groups II (44.67% ± 32.47, III (16.83% ± 53.02 and IV (66.4% ± 25.82 (p>0.05. The groups did not differ with regard to the weight of the excised organs. CONCLUSION: Alcoholic extracts of green tea have antitumor activity.OBJETIVO: Avaliar a atividade antitumoral do extrato alcoólico do chá verde (C. sinensis. MÉTODOS: Quatro grupos de seis ratos Wistar foram inoculados com 1x10(6 células/mL do tumor de Walker por via intramuscular. Os grupos foram tratados durante 10 dias, por gavagem, com salina 0,9 % (Grupo I, controle negativo, 20 mg/Kg de tamoxifeno (Grupo II, controle positivo e extrato alcoólico de C. sinensis nas doses de 0,07 g/Kg (Grupo III ou 0,14 g/Kg (Grupo IV. O volume e a inibição do crescimento tumoral foram calculados. RESULTADOS: A média dos pesos dos animais foi maior no Grupo IV do que no Grupo II (p=0,0107. O peso tumoral do Grupo IV foi menor do que o Grupo I (p=0,0062, mas não houve diferença quando comparado ao Grupo II. O volume

  19. Cape Verde

    Science.gov (United States)

    2007-01-01

    This Mars Exploration Rover Opportunity Pancam 'super resolution' mosaic of the approximately 6 m (20 foot) high cliff face of the Cape Verde promontory was taken by the rover from inside Victoria Crater, during the rover's descent into Duck Bay. Super-resolution is an imaging technique which utilizes information from multiple pictures of the same target in order to generate an image with a higher resolution than any of the individual images. Cape Verde is a geologically rich outcrop and is teaching scientists about how rocks at Victoria crater were modified since they were deposited long ago. This image complements super resolution mosaics obtained at Cape St. Mary and Cape St. Vincent and is consistent with the hypothesis that Victoria crater is located in the middle of what used to be an ancient sand dune field. Many rover team scientists are hoping to be able to eventually drive the rover closer to these layered rocks in the hopes of measuring their chemistry and mineralogy. This is a Mars Exploration Rover Opportunity Panoramic Camera image mosaic acquired on sols 1342 and 1356 (November 2 and 17, 2007), and was constructed from a mathematical combination of 64 different blue filter (480 nm) images.

  20. Evaluating Community Health Advisor (CHA) Core Competencies: The CHA Core Competency Retrospective Pretest/Posttest (CCCRP).

    Science.gov (United States)

    Story, Lachel; To, Yen M

    2016-05-01

    Health care and academic systems are increasingly collaborating with community health advisors (CHAs) to provide culturally relevant health interventions that promote sustained community transformation. Little attention has been placed on CHA training evaluation, including core competency attainment. This study identified common CHA core competencies, generated a theoretically based measure of those competencies, and explored psychometric properties of that measure. A concept synthesis revealed five CHA core competencies (leadership, translation, guidance, advocacy, and caring). The CHA Core Competency Retrospective Pretest/Posttest (CCCRP) resulted from that synthesis, which was administered using multiple approaches to individuals who previously received CHA training (N= 142). Exploratory factor analyses revealed a two-factor structure underlying the posttraining data, and Cronbach's alpha indicated high internal consistency. This study suggested some CHA core competencies might be more interrelated than previously thought, and two major competencies exist rather than five and supported the CCCRP's use to evaluate core competency attainment resulting from training. © The Author(s) 2014.

  1. Dicty_cDB: CHA557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT

  2. Cabo Verde - Private Sector Development

    Data.gov (United States)

    Millennium Challenge Corporation — The objective of the Private Sector Development Project activities of the 2005-2010 Cabo Verde Compact was to support Cabo Verde's long-term economic transformation...

  3. Menopause and big data: Word Adjacency Graph modeling of menopause-related ChaCha data.

    Science.gov (United States)

    Carpenter, Janet S; Groves, Doyle; Chen, Chen X; Otte, Julie L; Miller, Wendy R

    2017-07-01

    To detect and visualize salient queries about menopause using Big Data from ChaCha. We used Word Adjacency Graph (WAG) modeling to detect clusters and visualize the range of menopause-related topics and their mutual proximity. The subset of relevant queries was fully modeled. We split each query into token words (ie, meaningful words and phrases) and removed stopwords (ie, not meaningful functional words). The remaining words were considered in sequence to build summary tables of words and two and three-word phrases. Phrases occurring at least 10 times were used to build a network graph model that was iteratively refined by observing and removing clusters of unrelated content. We identified two menopause-related subsets of queries by searching for questions containing menopause and menopause-related terms (eg, climacteric, hot flashes, night sweats, hormone replacement). The first contained 263,363 queries from individuals aged 13 and older and the second contained 5,892 queries from women aged 40 to 62 years. In the first set, we identified 12 topic clusters: 6 relevant to menopause and 6 less relevant. In the second set, we identified 15 topic clusters: 11 relevant to menopause and 4 less relevant. Queries about hormones were pervasive within both WAG models. Many of the queries reflected low literacy levels and/or feelings of embarrassment. We modeled menopause-related queries posed by ChaCha users between 2009 and 2012. ChaCha data may be used on its own or in combination with other Big Data sources to identify patient-driven educational needs and create patient-centered interventions.

  4. Dicty_cDB: CHA851 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT

  5. Induction of mutation with gamma irradiation in camellia (Camellia Japonica L.)

    International Nuclear Information System (INIS)

    Zhou Diying; Shen Shoujiang; Wang Yanjun

    1990-01-01

    Studies on the radiosensitivity and mutagenic effects in Camellia (Camellia Japonica L.) were carried out with the shoot cuttings, one-year seedlings and three or four-year plants irradiated with 60 Co-γ rays. Results obtained showed that the radiosensitivities varied greatly in cultivars and in different parts of the plant. The suitable irradiation doses for shoot cuttings are 1-3 krad. The treatment of low doses (bellow 2 kard) resulted in higher frequency of mutation with plants of high sensitivity to γ-rays. The frequencies of mutation in flower color and type were 2.5-12.0%. The mutant with ornamental value has been obtained

  6. Efficient extraction of RNA from various Camellia species rich in ...

    African Journals Online (AJOL)

    use

    2011-11-23

    Nov 23, 2011 ... of Camellia sinensis, embodied by GenBank, showed that the homology was more than 90%. It preliminarily confirmed that the Chs gene was a functional gene, whose sequen-ces were conserved among Camellias. As another important gene, fatty acid desaturase 2. (Fad2) is involved in the conversion of ...

  7. Commercialized non-Camellia tea: traditional function and molecular identification

    Directory of Open Access Journals (Sweden)

    Ping Long

    2014-06-01

    Full Text Available Non-Camellia tea is a part of the colorful Chinese tea culture, and is also widely used as beverage and medicine in folk for disease prevention and treatment. In this study, 37 samples were collected, including 33 kinds of non-Camellia teas and 4 kinds of teas (Camellia. Traditional functions of non-Camellia teas were investigated. Furthermore, non-Camellia teas of original plants were characterized and identified by molecular methods. Four candidate regions (rbcL, matK, ITS2, psbA-trnH were amplified by polymerase chain reaction. In addition, DNA barcodes were used for the first time to discriminate the commercial non-Camellia tea and their adulterants, and to evaluate their safety. This study showed that BLASTN and the relevant phylogenetic tree are efficient tools for identification of the commercial non-Camellia tea and their adulterants. However, some sequences from original plants have not been found and there is a limitation of sequence number of original plants in GenBank. Submitting more original plant sequences to the GenBank will be helpful for evaluating the safety of non-Camellia teas.

  8. Protective effect of Camellia oleifera Abel. on silica-induced ...

    African Journals Online (AJOL)

    Background: Camellia oleifera Abel. belongs to the family Theaceae and genus Camellia. It is commonly cultivated in southern China. The seeds of C. oleifera have been reported to exhibit a diversity of pharmacological activities which include, but are not limited to, antioxidant, anti-cancer and antimicrobial. Pulmonary ...

  9. CHaMP metrics - Columbia Habitat Monitoring Program

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of CHaMP is to generate and implement a standard set of fish habitat monitoring (status and trend) methods in up to 26 watersheds across the Columbia River...

  10. Dicty_cDB: CHA362 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

  11. Camellia v1.0 Manual: Part I

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, Nathan V. [Argonne National Lab. (ANL), Argonne, IL (United States). Argonne Leadership Computing Facility

    2016-09-28

    Camellia began as an effort to simplify implementation of efficient solvers for the discontinuous Petrov-Galerkin (DPG) finite element methodology of Demkowicz and Gopalakrishnan. Since then, the feature set has expanded, to allow implementation of traditional continuous Galerkin methods, as well as discontinuous Galerkin (DG) methods, hybridizable DG (HDG) methods, first-order-system least squares (FOSLS), and the primal DPG method. This manual serves as an introduction to using Camellia. We begin, in Section 1.1, by describing some of the core features of Camellia. In Section 1.2 we provide an outline of the manual as a whole.

  12. MoCha: Molecular Characterization of Unknown Pathways.

    Science.gov (United States)

    Lobo, Daniel; Hammelman, Jennifer; Levin, Michael

    2016-04-01

    Automated methods for the reverse-engineering of complex regulatory networks are paving the way for the inference of mechanistic comprehensive models directly from experimental data. These novel methods can infer not only the relations and parameters of the known molecules defined in their input datasets, but also unknown components and pathways identified as necessary by the automated algorithms. Identifying the molecular nature of these unknown components is a crucial step for making testable predictions and experimentally validating the models, yet no specific and efficient tools exist to aid in this process. To this end, we present here MoCha (Molecular Characterization), a tool optimized for the search of unknown proteins and their pathways from a given set of known interacting proteins. MoCha uses the comprehensive dataset of protein-protein interactions provided by the STRING database, which currently includes more than a billion interactions from over 2,000 organisms. MoCha is highly optimized, performing typical searches within seconds. We demonstrate the use of MoCha with the characterization of unknown components from reverse-engineered models from the literature. MoCha is useful for working on network models by hand or as a downstream step of a model inference engine workflow and represents a valuable and efficient tool for the characterization of unknown pathways using known data from thousands of organisms. MoCha and its source code are freely available online under the GPLv3 license.

  13. Implicit Reasons for Disclosure of the Use of Complementary Health Approaches (CHA): a Consumer Commitment Perspective.

    Science.gov (United States)

    Sirois, Fuschia M; Riess, Helene; Upchurch, Dawn M

    2017-10-01

    Disclosure of the use of complementary health approaches (CHA) is an important yet understudied health behavior with important implications for patient care. Yet research into disclosure of CHA has been atheoretical and neglected the role of health beliefs. Using a consumer commitment model of CHA use as a guiding conceptual framework, the current study tests the hypotheses that perceived positive CHA outcomes (utilitarian values) and positive CHA beliefs (symbolic values) are associated with disclosure of CHA to conventional care providers in a nationally representative US sample. From a sample of 33,594 with CHA use information from the 2012 National Health Interview Survey (NHIS), a subsample of 7348 who used CHA within the past 12 months was analyzed. The 2012 NHIS is a cross-sectional survey of the non-institutionalized US adult population, which includes the most recent nationally representative CHA use data. The 63.2% who disclosed CHA use were older, were less educated, and had visited a health care provider in the past year. Weighted logistic regression analyses controlling for demographic variables revealed that those who disclosed were more likely to report experiencing positive psychological (improved coping and well-being) and physical outcomes (better sleep, improved health) from CHA and hold positive CHA-related beliefs. CHA users who perceive physical and psychological benefits from CHA use and who hold positive attitudes towards CHA are more likely to disclose their CHA use. Findings support the relevance of a consumer commitment perspective for understanding CHA disclosure and suggest CHA disclosure as an important proactive health behavior that warrants further attention.

  14. Consumo de Camellia sinensis em população de origem oriental e incidência de doenças crônicas Camellia sinensis consumption by an Asian-Brazilian population and incidence of chronic diseases

    Directory of Open Access Journals (Sweden)

    Fernanda Faria

    2006-04-01

    Full Text Available Investigar os prováveis benefícios dos hábitos culturais orientais, incluindo o consumo de Camellia sinensis (chá verde na prevenção de doenças crônicas. Trinta e quatro indivíduos entre 25 e 84 anos, de ambos os sexos, pertencentes à comunidade nipônica do Rio de Janeiro, RJ, foram submetidos a anamnese alimentar e questionário socio-econômico-cultural. Dos indivíduos, 76% consumiam chá verde, sendo que 35% o ingeriam diariamente e 27% esporadicamente. Verificou-se que o consumo regular de álcool era predominante nos não usuários de chá verde, quando comparados com os apreciadores da bebida (50% e 35%, respectivamente, faziam uso de álcool. Não foi observado sedentarismo na amostra. Dos apreciadores do chá, 81% não apresentavam doenças crônicas. Já entre os consumidores, observamos um menor percentual de doenças crônicas, especialmente, de hipertensão, porém sem significância estatística.To investigate the probable benefits of Asian dietary habits, including the intake of Camellia sinensis (green tea, in preventing chronic-degenerative diseases. Thirty-four individuals aging from 25 to 84 years from a Japanese community in Rio de Janeiro answered a socioeconomic-cultural questionnaire. Seventy-six percent of the individuals consumed green tea, where 35% consumed it daily and 27% consumed it sporadically. The regular intake of alcohol predominated among the non-consumers of green tea, when compared with green tea consumers (50% and 35%, respectively consumed alcoholic beverages. None of the individuals in the sample had a sedentary lifestyle. Among the individuals who consumed green tea, 81% did not have any chronic illnesses. The consumers of tea presented a lower incidence of chronic diseases, especially hypertension, but it was not statistically significant.

  15. Morfodiagnose da anatomia foliar e caulinar de Camellia sinensis (L. Kuntze, Theaceae

    Directory of Open Access Journals (Sweden)

    Márcia R. Duarte

    Full Text Available Camellia sinensis é um arbusto ou árvore de pequeno porte, de origem asiática, denominado de chá-da-índia, chá-verde ou chá-preto. Possui atividades antioxidante, antiinflamatória, antimicrobiana e hepatoprotetora. A comercialização dessa espécie é relevante, como droga farmacognóstica e insumo na indústria de bebidas. O presente trabalho trata da caracterização estrutural de folha e caule, de modo a contribuir na morfodiagnose para o controle de qualidade. Amostras do material vegetal foram fixadas, seccionadas e coradas com azul de astra e fucsina básica. Testes microquímicos usuais foram realizados. A folha apresenta estômatos anomocíticos na face abaxial, tricomas tectores unicelulares em ambas as superfícies, mesofilo dorsiventral, drusas de oxalato de cálcio, nervura central biconvexa e pecíolo plano-convexo, ambos percorridos por feixe vascular colateral. O caule, no nível analisado, possui epiderme unisseriada, camada subepidérmica de células colabadas, bainha esclerenquimática, estrato de células com paredes espessadas em U, organização vascular colateral e medula com células parenquimáticas e esclerenquimáticas. Esclereídes são encontradas na folha e no caule.

  16. Palo Verde College Facts, 2001.

    Science.gov (United States)

    Palo Verde Coll., Blythe, CA.

    This is a 2001 report on Palo Verde College (PVC) (California) student demographics, enrollment status, citizenship, educational goals, and academic persistence. Student data were collected and analyzed to meet accrediting standards, improve institutional effectiveness, and fulfill the local district's mission. The report discusses enrollment…

  17. Nucleosome structure of the yeast CHA1 promoter

    DEFF Research Database (Denmark)

    Moreira, José Manuel Alfonso; Holmberg, S

    1998-01-01

    conditions. Five yeast TBP mutants defective in different steps in activated transcription abolished CHA1 expression, but failed to affect induction-dependent chromatin rearrangement of the promoter region. Progressive truncations of the RNA polymerase II C-terminal domain caused a progressive reduction...

  18. Saponins from seeds of Genus Camellia: Phytochemistry and bioactivity.

    Science.gov (United States)

    Guo, Na; Tong, Tuantuan; Ren, Ning; Tu, Youying; Li, Bo

    2018-05-01

    Camellia seeds have been traditionally used as oil raw materials in Asia, and are known for a wide spectrum of applications. Oleanane-type triterpene saponins are the major specialised metabolites in Camellia seeds, and more than seventy saponins have been isolated and characterized. These natural compounds have caught much attention due to their various biological and pharmacological activities, including modulation of gastrointestinal system, anti-cancer, anti-inflammation, anti-microorganism, antioxidation, neuroprotection, hypolipidemic effects, foaming and detergence, as well as helping the accumulation of pollutants by plants. These compounds have a promising application in medicine, agriculture, industry and environmental protection. The present paper summarized the information from current publications on Camellia seed saponins, with a focus on the advances made in chemical structures, determination methods, bioactivities and toxicity. We hope this article will stimulate further investigations on these compounds. Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Avaliação da qualidade de amostras de Camellia sinensis (L. Kuntze (Theaceae comercializadas no município de Araras – SP.

    Directory of Open Access Journals (Sweden)

    Bruna Cristina da Silva

    2013-04-01

    Full Text Available A espécie Camellia sinensis (L. Kuntze conhecida popularmente como chá verde é considerada a bebida mais consumida no mundo. Apresenta em sua composição flavonoides e taninos com propriedades medicinais. Com o crescimento do consumo dessa bebida o seu uso foi transformado em um problema de Saúde Pública, devido à possibilidade de acesso a produtos sem adequadas condições de qualidade pela falta de fiscalização. O presente estudo teve como objetivo avaliar a qualidade de amostras de Camellia sinensis comercializadas no município de Araras - SP. Foram realizados testes físico-químicos e microbiológicos, conforme descritos pela Farmacopeia Brasileira 5.ed. Em alguns testes as amostras mostraram-se de acordo com as especificações farmacopeicas, já em outros as amostras não estavam de acordo com a legislação vigente. Das sete amostras analisadas somente a amostra quatro foi aprovada na análise de determinação de material estranho, mostrando falhas durante o processamento das demais amostras. Na análise fitoquímica as amostras: 3, 5 e 7 apresentaram ausência dos componentes que caracterizam as propriedades da Camellia sinensis. No controle microbiológico a amostra dois apresentou crescimento para bactérias aeróbias e as amostras 2, 3 e 7 apresentaram presença de patógenos acima do limite permitido pela Farmacopeia Brasileira. Conclui-se que algumas amostras analisadas não estão de acordo com os parâmetros de qualidade estabelecidos para drogas vegetais, apresentando assim risco de contaminação para os usuários.

  20. [Analysis of Camellia rosthorniana populations fecundity].

    Science.gov (United States)

    Cao, Guoxing; Zhong, Zhangcheng; Xie, Deti; Liu, Yun

    2004-03-01

    With the method of space substituting time, the structure of Camellia rosthorniana populations in three forest communities, i.e., Jiant bamboo forest, coniferous and broad-leaved mixed forest, and evergreen broad-leaved forest in Mt. Jinyun was investigated, and based on static life-tables, the fecundity tables and reproductive value tables of C. rosthorniana populations were constructed. Each reproductive parameter and its relation to bionomic strategies of C. rosthorniana populations were also analyzed. The results indicated that in evergreen broad-leaved forest, C. rosthorniana population had the longest life span and the greatest fitness. The stage of maximum reproductive value increased with increasing stability of the community. The sum of each population's reproductive value, residual reproductive value and total reproductive value for the whole life-history of C. rosthorniana also increased with increasing maturity of the community, showing their inherent relationships with reproductive fitness. As regards to bionomic strategy, C. rosthorniana showed mainly the characteristics of a k-strategies, but in less stable community, the reproductive parameters were greatly changed, showing some characteristics of a r-strategies.

  1. Intraclonal genome diversity of Pseudomonas aeruginosa clones CHA and TB

    Science.gov (United States)

    2013-01-01

    Background Adaptation of Pseudomonas aeruginosa to different living conditions is accompanied by microevolution resulting in genomic diversity between strains of the same clonal lineage. In order to detect the impact of colonized habitats on P. aeruginosa microevolution we determined the genomic diversity between the highly virulent cystic fibrosis (CF) isolate CHA and two temporally and geographically unrelated clonal variants. The outcome was compared with the intraclonal genome diversity between three more closely related isolates of another clonal complex. Results The three clone CHA isolates differed in their core genome in several dozen strain specific nucleotide exchanges and small deletions from each other. Loss of function mutations and non-conservative amino acid replacements affected several habitat- and lifestyle-associated traits, for example, the key regulator GacS of the switch between acute and chronic disease phenotypes was disrupted in strain CHA. Intraclonal genome diversity manifested in an individual composition of the respective accessory genome whereby the highest number of accessory DNA elements was observed for isolate PT22 from a polluted aquatic habitat. Little intraclonal diversity was observed between three spatiotemporally related outbreak isolates of clone TB. Although phenotypically different, only a few individual SNPs and deletions were detected in the clone TB isolates. Their accessory genome mainly differed in prophage-like DNA elements taken up by one of the strains. Conclusions The higher geographical and temporal distance of the clone CHA isolates was associated with an increased intraclonal genome diversity compared to the more closely related clone TB isolates derived from a common source demonstrating the impact of habitat adaptation on the microevolution of P. aeruginosa. However, even short-term habitat differentiation can cause major phenotypic diversification driven by single genomic variation events and uptake of phage

  2. Characterization of Armillaria isolates from tea (Camellia sinensis) in Kenya

    NARCIS (Netherlands)

    Otieno, W.; Perez Sierra, A.; Termorshuizen, A.J.

    2003-01-01

    Armillaria is a primary root rot pathogen of tea (Camellia sinensis) in Kenya. The main species presently described in this country are A. mellea and A. heimii. A survey covering fourteen districts of Kenya was carried out and forty-seven isolates of Armillaria collected. Cultural morphology,

  3. Antiviral effects of green tea ( Camellia sinensis ) against pathogenic ...

    African Journals Online (AJOL)

    Background: Tea is the second most addictive worldwide after formulations containing caffeine in carbonated beverage. Green tea is made from leaves of the Camellia sinensis plant. In the repertoire of traditional Chinese medicine, green tea beverages have played a fundamental role associated with their culture.

  4. Analysis on effect of separation and purification of glycoprotein extracted from Camellia seeds and its functional activity as basis for the economic development of Camellia oleifera industry

    Directory of Open Access Journals (Sweden)

    Feng Aiguo

    2016-06-01

    Full Text Available Taking Camellia oleifera seeds as raw materials, this study explored extraction and purification of glycoprotein separated from Camellia seeds as well as its antitumor activity, aiming to provide a theoretical basis for the economic development of Camellia oleifera industry. Key impact factors of Camellia seed glycoprotein were extracted using buffer solution method and water extraction method and a regression model was set up. Methyl thiazolyl tetrazolium was used to evaluate the in vitro antitumor activity of glycoprotein extracted from Camellia seeds and Differential Scanning Calorimetry (DSC was used to measure its denaturation enthalpy value. Results indicated that protein and sugar yields were 8.96% and 17.05% respectively under optimal conditions when water extraction method was used. Crude glycoprotein extracted from Camellia oleifera had a certain inhibitory effect on human hepatoma cell HepG2, gastric cancer cell MGC-803 and breast cancer cell MCF-7 and crude glycoprotein extracted from Camellia oleifera by water-extraction and alcohol-precipitation method had a strong antitumor effect. Crude glycoprotein obtained in the two different ways was capable of scavenging DPPH, •OH and O2g- free radicals and also showed good reducing capacity. DSC measurement results revealed that specific rotation of COGP2a[α]n20${\\rm{COGP}}2{\\rm{a}}\\left[ \\alpha \\right]_n^{20} $ was - 32.5. Antitumor experiment in vitro showed that glycoprotein extracted from Camellia seeds in the two different ways had a certain inhibitory effect on HepG2, MGC-803 and MCF-7, which has important theoretical and realistic significances to promoting utilization value of camellia resources, strengthening Camellia oleifera’s comprehensive development and utilization of high added value as well as enriching types and functions of active glycoprotein.

  5. The solution structure of ChaB, a putative membrane ion antiporter regulator from Escherichia coli

    Directory of Open Access Journals (Sweden)

    Iannuzzi Pietro

    2004-08-01

    Full Text Available Abstract Background ChaB is a putative regulator of ChaA, a Na+/H+ antiporter that also has Ca+/H+ activity in E. coli. ChaB contains a conserved 60-residue region of unknown function found in other bacteria, archaeabacteria and a series of baculoviral proteins. As part of a structural genomics project, the structure of ChaB was elucidated by NMR spectroscopy. Results The structure of ChaB is composed of 3 α-helices and a small sheet that pack tightly to form a fold that is found in the cyclin-box family of proteins. Conclusion ChaB is distinguished from its putative DNA binding sequence homologues by a highly charged flexible loop region that has weak affinity to Mg2+ and Ca2+ divalent metal ions.

  6. Teor de fluoretos em infusões de chá verde (Camellia sinensis Fluoride content in green tea infusions (Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Márcia Reto

    2008-01-01

    Full Text Available The aim of this work was to study the influence of green tea consumption on fluoride ingestion. The extraction conditions of fluorides from green tea infusions were defined and nine brands of green tea available in Portugal were analyzed. The quantification of fluorides in the green tea was preceded by the implementation and validation of the potentiometric method (commercial fluoride selective electrode. The concentration of fluorides in the samples ranged from 0. 8 to 2. 0 mg L-1.

  7. Correlation between CHA2DS2-VASc Score and Glaucoma Treatment and Prognosis.

    Science.gov (United States)

    Pikkel, Yoav Y; Krebs, Daniel; Igal, Vadim; Sharabi-Nov, Adi; Epstein, Irena; Pikkel, Joseph

    2018-01-01

    To find if CHA 2 DS 2 -VASc scale can accurately predict the treatment, prognosis, and outcome for primary open-angle glaucoma (POAG). A survey of 250,000 patient years was taken, using the records of the Ophthalmology Department at Ziv Medical Center. Data was collected regarding the retinal nerve fiber layer (RNFL), visual field (VF), line of treatment (LOT) of glaucoma, and all the data needed to accurately calculate CHA 2 DS 2 -VASc score for each patient. Sixty-seven patients were included in the statistical analysis. The mean age was 72.5 years. The mean CHA 2 DS 2 -VASc score was 3.27 + -1.7. Positive Pearson's correlation coefficients were found for LOT and CHA 2 DS 2 -VASc score, 0.35, and for RNFL grade and CHA2DS2-VASc score, 0.37. The correlation was negative for RNFL width and CHA2DS2-VASc score, -0.35. CHA 2 DS 2 -VASc score was shown to be correlated with glaucoma. This correlation was manifested positively by the LOT needed to stop glaucoma progression, with higher CHA 2 DS 2 -VASc scores correlated with more aggressive treatment. Since glaucoma is a disease with a progressing nature, it is important to treat patients aggressively on one hand, while offering the most benign treatment as possible on the other hand. Modification of the CHA 2 DS 2 -VASc score could achieve an even higher correlation.

  8. Breast cancer chemopreventive and chemotherapeutic effects of Camellia Sinensis (green tea): an updated review.

    Science.gov (United States)

    Rafieian-Kopaei, Mahmoud; Movahedi, Mino

    2017-02-01

    Camellia sinensis belongs to the plant family of Theaceae, native to East Asia, the Indian Subcontinent and Southeast Asia, but naturalized in many parts of the world. The aim of this study was to overview its anti-breast cancer chemopreventive and chemotherapeutic effects. This review article is aimed to overview breast cancer chemopreventive and chemotherapeutic effects of Camellia sinensis (green tea). This review article was carried out by searching studies in PubMed, Medline, Web of Science, and IranMedex databases. The initial search strategy identified around 108 references. In this study, 68 studies were accepted for further screening, and met all our inclusion criteria [in English, full text, chemopreventive and chemotherapeutic effects of Camellia sinensis and dated mainly from the year 1999 to 2016. The search terms were Camellia sinensis, chemopreventive, chemotherapeutic properties, pharmacological effects. The result of this study suggested that the catechin available in Camellia sinensis has properties which can prevent and treat breast cancer. It has also been shown to inhibit proliferation of breast cancer cells and to block carcinogenesis. It was found that increased Camellia sinensis consumption may lower the risk of breast cancer. Camellia sinensis intake was shown to reduce the risk of breast cancer incidence. In addition, potential breast cancer chemopreventive effect of Camellia sinensis both in vivo and in vitro was highly confirmed. However, the evidence of low effect and no effect was observed. More clinical trial studies are needed to prove its anti-breast cancer activity decisively. Camellia sinensis is broadly utilized as a part of customary medication since antiquated time because of its cost adequacy, and fewer reaction properties. The studies demonstrated anti-breast cancer activity of Camellia sinensis and its component by adjusting cell signaling pathways such as angiogenesis, apoptosis, and transcription factor. Furthermore

  9. Burrowing Owl - Palo Verde Valley [ds197

    Data.gov (United States)

    California Natural Resource Agency — These burrowing owl observations were collected during the spring and early summer of 1976 in the Palo Verde Valley, eastern Riverside County, California. This is an...

  10. Laguna Verde - A photo story

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1980-04-15

    Safety is one of the main factors in the construction and operation of a modern nuclear power plant. There are many barriers between the fission products produced in the fuel elements of the core, and the environment: the cladding of the fuel pins which are enclosed in the reactor core, the pressure vessel containing the core and which in turn is enclosed in the reactor containment, all this being located in a low-pressure secondary containment or reactor building. Despite these precautions, nuclear safety is still a widely-discussed issue. The important fact remains, however, that there has not been a single radiation-induced fatality or serious injury at any civilian nuclear power plant during 20 years of nuclear power generation. This includes the accident that occurred in March 1979 at the Three Mile Island nuclear plant in the USA. A substantial component contributing to safety in a nuclear power plant is the containment. The following photos of Laguna Verde, Mexico's first nuclear power station being constructed at Alta Lucero in Vera Cruz, give an impression of how strong this concrete and steel containment actually is. Laguna Verde consists of two 600 MWe units and the plant is scheduled for commercial operation in 1982. Construction began in 1974. Both units are boiling-water reactors. The photos show, in general, the construction of the primary containment for the reactors (the dry wells). The dry well contains the reactor itself and has two layers: the leak-tight steel liner and the heavy concrete building. The purpose of the primary containment is to retain steam and gases that might escape in an emergency and to direct these through relief tubes to a water pond for cooling. Surrounding this primary containment will be a reactor building which serves as a secondary low-pressure containment, able to operate at pressures up to 0.2 atmospheres.

  11. Palo Verde nuclear dynamic analysis (PANDA)

    International Nuclear Information System (INIS)

    Girjashankar, P.V.; Secker, P.A. Jr.; LeClair, S.J.; Mendoza, J.; Webb, J.R.

    1988-01-01

    Arizona Nuclear Power Project (ANPP) has initiated the development of a large scale dynamic analysis computer program for the Palo Verde Nuclear Generating Station (PVNGS). This paper presents the decision processes and preliminary development activities that have been pursued related to the code development. The PANDA (Palo Verde Nuclear Dynamic Analysis) code will be used for a variety of applications as described in this paper

  12. Multispecies Adulteration Detection of Camellia Oil by Chemical Markers.

    Science.gov (United States)

    Dou, Xinjing; Mao, Jin; Zhang, Liangxiao; Xie, Huali; Chen, Lin; Yu, Li; Ma, Fei; Wang, Xiupin; Zhang, Qi; Li, Peiwu

    2018-01-25

    Adulteration of edible oils has attracted attention from more researchers and consumers in recent years. Complex multispecies adulteration is a commonly used strategy to mask the traditional adulteration detection methods. Most of the researchers were only concerned about single targeted adulterants, however, it was difficult to identify complex multispecies adulteration or untargeted adulterants. To detect adulteration of edible oil, identification of characteristic markers of adulterants was proposed to be an effective method, which could provide a solution for multispecies adulteration detection. In this study, a simple method of multispecies adulteration detection for camellia oil (adulterated with soybean oil, peanut oil, rapeseed oil) was developed by quantifying chemical markers including four isoflavones, trans-resveratrol and sinapic acid, which used liquid chromatography tandem mass spectrometry (LC-MS/MS) combined with solid phase extraction (SPE). In commercial camellia oil, only two of them were detected of daidzin with the average content of 0.06 ng/g while other markers were absent. The developed method was highly sensitive as the limits of detection (LODs) ranged from 0.02 ng/mL to 0.16 ng/mL and the mean recoveries ranged from 79.7% to 113.5%, indicating that this method was reliable to detect potential characteristic markers in edible oils. Six target compounds for pure camellia oils, soybean oils, peanut oils and rapeseed oils had been analyzed to get the results. The validation results indicated that this simple and rapid method was successfully employed to determine multispecies adulteration of camellia oil adulterated with soybean, peanut and rapeseed oils.

  13. Enhancement of antioxidative activity and cardiovascular protection in hamsters by camellia oil and soybean-camellia blended oil.

    Science.gov (United States)

    Chou, Ting-Yi; Lu, Yi-Fa; Inbaraj, Baskaran Stephen; Chen, Bing-Huei

    2018-02-07

    The aim of this study was to examine the effects of several vegetable oils and blended oil composed of soybean and camellia oils on blood lipid reduction and antioxidative activity. Forty male hamsters were fed an AIN-93 G diet for 1 wk, followed by dividing into five groups: control group-1 was fed a low-fat diet containing 5% oil for 6 wk, and the other four groups were fed high-fat diets with group-2 containing 14% palm oil, group-3 containing 14% camellia oil, group-4 containing 14% soybean oil, and group-5 containing 14% blended oil (8.4% soybean oil and 5.6% camellia oil) along with 0.2% cholesterol and 0.1% bile acid. High-fat diets raised serum triacylglycerol, total cholesterol, and aspartate aminotransferase in hamsters without affecting alanine aminotransferase. Compared with palm oil-containing diet, the other three high-fat diets reduced serum total cholesterol, low-density lipoprotein cholesterol, and the ratio of low-density lipoprotein to high-density lipoprotein cholesterol with an opposite trend for liver total cholesterol. However, compared with the control group, the serum high-density lipoprotein cholesterol level was raised for all four high-fat diets. The higher the degree of oil unsaturation, the higher the serum thiobarbituric acid reactive substances and the lower the liver triacylglycerol level and activities of fatty acid synthase, glucose 6-phosphate dehydrogenase, and malic enzymes. Both soybean and blended oils lowered the antioxidative activity of liver. Camellia and blended oils were more efficient than soybean oil in elevating serum high-density lipoprotein cholesterol and decreasing the ratio of low-density lipoprotein to high-density lipoprotein cholesterol in hamsters. Copyright © 2018 Elsevier Inc. All rights reserved.

  14. Escuela Superior de Palos Verdes

    Directory of Open Access Journals (Sweden)

    Neutra, Richard J.

    1965-02-01

    Full Text Available Before initiating the building operations for the «Palos Verdes» School, the site was divided into two large horizontal surfaces, at different levels. The lower one served to accommodate the playing fields, a car park, the physical training building, and shop and ancillary buildings. On the higher of these two surfaces, and to the West of the access road, there is a car park and also the building and plot of ground devoted to agricultural technology, as well as the literary studies and general purpose buildings. As a complement to these, there is a series of blocks, arranged in parallel rows, which house the administrative offices, the art school, the craft's school, the general classrooms, and those devoted to higher education. The fascinating aspect of this school is the outstanding penetration of the architect's mind into the essential function of the project. Its most evident merit is the sense of comradeship and harmony that permeates the whole architectural manifold.Antes de construir el complejo escolar «Palos Verdes» se comenzó por crear, en el terreno, dos grandes mesetas a niveles diferentes. Sobre el inferior se organizaron: los campos de juegos, de deportes, un aparcamiento, el edificio para educación física y los destinados a tiendas y servicios. Sobre la meseta superior, al oeste de la vía de acceso, se dispuso un aparcamiento y el edificio y campo para adiestramiento agrícola; al este, otro aparcamiento, el edificio dedicado a materias literarias, y el destinado a usos múltiples. Completan las instalaciones de la escuela una serie de bloques paralelos: la administración, la escuela de arte, las clases de trabajos manuales, las aulas de enseñanzas generales, y las de los cursos superiores. Lo fascinante de este complejo escolar es la perfecta y magistral compenetración del arquitecto con el tema proyectado, y su mayor mérito, la sensación de cordialidad y armonía con el ambiente.

  15. Predictive performance of the CHA2DS2-VASc rule in atrial fibrillation : a systematic review and meta-analysis

    NARCIS (Netherlands)

    Van Doorn, S.; Debray, T. P. A.; Kaasenbrood, F.; Hoes, A. W.; Rutten, F. H.; Moons, K. G. M.; Geersing, G. J.

    2017-01-01

    Essentials The widely recommended CHA2DS2-VASc shows conflicting results in contemporary validation studies. We performed a systematic review and meta-analysis of 19 studies validating CHA2DS2-VASc. There was high heterogeneity in stroke risks for different CHA2DS2-VASc scores. This was not

  16. La chaîne du froid en agroalimentaire

    OpenAIRE

    Rosset , Philippe; Beaufort , Annie; Cornu , Marie; Poumeyrol , Gérard

    2002-01-01

    Le recours au froid constitue une pratique courante pour assurer une conservation prolongée des aliments, de quelques jours à quelques semaines. Limitant notre propos aux denrées réfrigérées et au risque sanitaire d'origine microbiologique, après un rappel de la définition de la chaîne du froid et des modalités générales de mise en oeuvre, nous aborderons dans un premier temps les particularités technologiques de son application. Celle-ci sera étudiée tout d'abord selon le type d'aliments con...

  17. Talento verde y cadenas de suministro verdes: ¿existe una relación significativa?

    Directory of Open Access Journals (Sweden)

    María del Carmen Torres-Salazar

    2016-01-01

    Full Text Available Introducción: En este texto se presentan resultados estadísticos de la relación entre directivos con características de talento verde y la implementación de prácticas de cadena de suministro verde. Debido a que existen investigaciones sobre la importancia de la visión de la alta dirección para la adopción de prácticas verdes; y sin embargo ninguna da cuenta de las características personales del directivo, ni tampoco de la relación significativa entre estas características y la puesta en marcha de prácticas de cadena de suministro verde, esta es la aportación de la presente investigación. El trabajo se desarrolló en empresas manufactureras con más de diez trabajadores de la zona oriente del estado de Morelos México. La caracterización del término talento verde se reportó en el artículo, Talento verde: caracterización y búsqueda, publicado en el número 14 de esta revista. Método: El método utilizado consistió en la construcción de una encuesta dividida en tres categorías que posteriormente se convirtieron en variables: prácticas de cadena de suministro verde, presiones institucionales y talento verde. Las dos primeras se adaptaron de la encuesta de Zhu y Sarkis (2007 y la tercera surgió de la representación social de talento verde, producto de una fase de esta investigación. La encuesta se validó con un grupo de empresarios miembros de la Cámara Nacional de la Industria de la Transformación (CANACINTRA capítulo Morelos. El instrumento validado se aplicó a 26 directivos de empresas manufactureras con más de diez trabajadores de la zona oriente de Morelos, con el fin de probar la relación entre directivos con características de talento verde y la puesta en marcha de prácticas de cadena de suministro verde. Para ello se utilizaron como herramientas estadísticas la correlación de Pearson y la regresión lineal múltiple. Resultados: Las prácticas de cadena de suministro verde de las empresas

  18. 36 CFR 7.39 - Mesa Verde National Park.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Mesa Verde National Park. 7... SPECIAL REGULATIONS, AREAS OF THE NATIONAL PARK SYSTEM § 7.39 Mesa Verde National Park. (a) Visiting of... the admission of commercial automobiles and buses to Mesa Verde National Park, contained in § 5.4 of...

  19. Green tea chemoprotection in rats treated with Diethylnitrosamine Ação quimioprotetora do chá verde em ratos tratados com Dietilnitrosamina

    Directory of Open Access Journals (Sweden)

    Halha Ostrensky Saridakis

    2011-12-01

    Full Text Available Green tea (Camellia sinensis and its main components, the catechins present several biological activities such as: antioxidant and chemoprotective action against hepatotoxic agent as diethylnitrosamine(DEN, a known cytotoxic substance. This work has the objective to evaluate and understand the green tea extract (GTE mechanisms of action as a chemoprotector agent. Therefore, tests in vivo with Wistar rats using GTE 2% (2mg/100mL was taken orally as the only source of water for 35 days. To verify the antioxidant and chemoprotective capacity of GTE, DEN (200mg/kg was used as a lesion agent. The results indicate that green tea if the dosage close to the ones taken by the population is not able to expressively inhibit the lesion caused for the high dose of DEN, but the results indicated a tendency to chemoprotection, suggesting to green tea may act as a prevention substance even in low dosage in presence of a classically known hepatotoxic agent. O chá verde (Camellia sinensis e seus principais componentes, as catequinas, apresentam várias atividades biológicas, dentre elas a ação antioxidante e quimioprotetora contra agentes hepatotóxicos, como a dietilnitrosamina (DEN, um conhecido agente citotóxico. Este trabalho tem como objetivo avaliar e compreender os mecanismos da ação do extrato do chá verde (ECV, como agente antioxidante e quimioprotetor. Foram realizados testes in vivo com ratos Wistar machos utilizando o ECV a 2% (2mg/100mL via oral, como única fonte de água, durante 35 dias. Para verificar a capacidade antioxidante e quimioprotetora do ECV utilizou-se a DEN (200mg/kg como agente lesivo. Os resultados indicam que o chá verde, nas doses próximas as que são ingeridas pela população, não é capaz de inibir significativamente a lesão causada pela alta dose da DEN, mas os resultados indicaram uma tendência à quimioproteção, sugerindo que o chá verde pode agir como substância preventiva mesmo em baixasdoses, frente a um

  20. HERSCHEL OBSERVATIONS OF THE T CHA TRANSITION DISK: CONSTRAINING THE OUTER DISK PROPERTIES

    OpenAIRE

    Cieza, Lucas A.; Olofsson, Johan; Harvey, Paul M.; Pinte, Christophe; Merin, Bruno; Augereau, Jean-Charles; Evans, Neal J., II; Najita, Joan; Henning, Thomas; Menard, Francois

    2011-01-01

    T Cha is a nearby (d = 100 pc) transition disk known to have an optically thin gap separating optically thick inner and outer disk components. Huelamo et al. (2011) recently reported the presence of a low-mass object candidate within the gap of the T Cha disk, giving credence to the suspected planetary origin of this gap. Here we present the Herschel photometry (70, 160, 250, 350, and 500 micron) of T Cha from the "Dust, Ice, and Gas in Time" (DIGIT) Key Program, which bridges the wavelength ...

  1. Hospitales reformando al mundo verde

    Directory of Open Access Journals (Sweden)

    Sandra Milene Rojas-Criollo

    2016-12-01

    Full Text Available Introducción: factores ambientales como el cambio climático, el calentamiento global, el mal uso del suelo y del agua, la mala administración de los recursos naturales, la contaminación del aire en espacios abiertos y cerrados, el crecimiento urbano y la industrialización han ocasionado cambios en los procesos naturales del planeta; para la Organización Mundial de la Salud constituyen una barrera significativa que impide alcanzar los objetivos del milenio y del desarrollo sostenible, haciendo cada vez más grave su aplicación y generando un ambiente hostil para la vida de las personas. Metodología: investigación documental, descriptiva, con enfoque cualitativo. Se realizó búsqueda en las bases de datos Ebsco, Proquest, Scielo, Elsevier, etc., con descriptores en inglés y español. Se clasificó los artículos por similitudes, autores y definiciones; se agruparon 60 artículos en una matriz y, posteriormente, se analizaron y se integraron los conceptos para luego categorizarlos. Conclusiones: es de gran relevancia el conocimiento sobre hospitales verdes, ya que son empresas que promueven la salud pública y la reducción del impacto ambiental, además de la disminución de los índices de morbilidad y mortalidad. El personal de salud tiene un papel importante para desarrollar e implementar estas actividades en beneficio del ambiente y las personas

  2. Radical scavenging activity of crude polysaccharides from Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Yang Fan

    2011-01-01

    Full Text Available A preparation of crude polysaccharides (TPS was isolated from Camellia sinensis by precipitation and ultrafiltration. TPS1, TPS2, and TPS3 had molecular weights of 240, 21.4, and 2.46 kDa, respectively. The radical scavenging activities of TPS were evaluated by DPPH free radical, hydroxyl radical and superoxide radical scavenging. These results revealed that TPS exhibited strong radical scavenging activity in a concentration-dependent manner. TPS3 with lowest molecular weight showed a higher radical scavenging activity.

  3. Spectroscopic Study of Green Tea (Camellia sinensis) Leaves Extraction

    Science.gov (United States)

    Marzuki, A.; Suryanti, V.; Virgynia, A.

    2017-04-01

    This paper reports the analysis of UV-VIS-NIR absorption spectra of different concentrations of green tea (Camellia sinensis) leaf extract in two different solvent systems (chloroform and ethyl acetate). In those solvents, two different peaks characterizing green tea are observed at different wavelengths, namely 296 nm and 329 nm (extracted in chloroform) and 391 nm and 534 nm (extracted in ethyl acetate). We then investigated the absorption spectra change as function of green tea concentration in both solvents. We found that light absorption increases linearly with the increase of green tea concentration. Different wavelengths, however, respond this change differently. However, the way it changes is wavelength dependence.

  4. Finding the Patient's Voice Using Big Data: Analysis of Users' Health-Related Concerns in the ChaCha Question-and-Answer Service (2009-2012).

    Science.gov (United States)

    Priest, Chad; Knopf, Amelia; Groves, Doyle; Carpenter, Janet S; Furrey, Christopher; Krishnan, Anand; Miller, Wendy R; Otte, Julie L; Palakal, Mathew; Wiehe, Sarah; Wilson, Jeffrey

    2016-03-09

    The development of effective health care and public health interventions requires a comprehensive understanding of the perceptions, concerns, and stated needs of health care consumers and the public at large. Big datasets from social media and question-and-answer services provide insight into the public's health concerns and priorities without the financial, temporal, and spatial encumbrances of more traditional community-engagement methods and may prove a useful starting point for public-engagement health research (infodemiology). The objective of our study was to describe user characteristics and health-related queries of the ChaCha question-and-answer platform, and discuss how these data may be used to better understand the perceptions, concerns, and stated needs of health care consumers and the public at large. We conducted a retrospective automated textual analysis of anonymous user-generated queries submitted to ChaCha between January 2009 and November 2012. A total of 2.004 billion queries were read, of which 3.50% (70,083,796/2,004,243,249) were missing 1 or more data fields, leaving 1.934 billion complete lines of data for these analyses. Males and females submitted roughly equal numbers of health queries, but content differed by sex. Questions from females predominantly focused on pregnancy, menstruation, and vaginal health. Questions from males predominantly focused on body image, drug use, and sexuality. Adolescents aged 12-19 years submitted more queries than any other age group. Their queries were largely centered on sexual and reproductive health, and pregnancy in particular. The private nature of the ChaCha service provided a perfect environment for maximum frankness among users, especially among adolescents posing sensitive health questions. Adolescents' sexual health queries reveal knowledge gaps with serious, lifelong consequences. The nature of questions to the service provides opportunities for rapid understanding of health concerns and may

  5. Verde pentru biciclete (Green for Bycicles

    Directory of Open Access Journals (Sweden)

    Romina Faur

    2011-06-01

    Full Text Available The campaign “Verde pentru biciclete” (Engl. “Green for bicycles” is the first official initiative from Timişoara that encourages adopting cycling as an ecological and economical alternative to urban transportation; this addresses the citizens of Timişoara and not only, regardless of age. “Verde pentru biciclete” is a pedalling movement supported by the Bega Foundation, in collaboration with the Gratzu Sportive Club, KissFM, Ziua de Vest, Agenda and agenda.ro. The debut of the campaign took place of October 25th 2008, with the first “Verde pentru biciclete” event – “The bicycles Counting”. All the events that followed were held to draw attention on the importance of cycling, together with obtaining of certain facilities, necessary for the cyclists’ safe movement in traffic. Moreover, a number of communication platforms have been created between the fans of cycling; thus, the website www.pedaleaza.ro has been created, through which those interested can inform themselves or communicate on the forum and discussions group verde_pentru_biciclete@yahoogroups.com o through the social network Facebook (facebook.com/ verdepentrubiciclete. This paper presents the activities held within the campaign since its beginning until today, as well as our future plans.

  6. How Palo Verde saved millions of dollars

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    In autumn 1992, Arizona Public Service adopted new project control procedures for outages at its three-unit Palo Verde PWR site, including: the switch to a PC-based environment; a new scheduling system; and the generation of improved graphics for decision making. Major cost savings were made and three further outages have now benefitted from the new systems. (author)

  7. Reflectance spectroscopy of biochemical components as indicators of tea, Camellia Sinensis, quality

    NARCIS (Netherlands)

    Bian, B.M.; Skidmore, A.K.; Schlerf, M.; Fei, T.; Liu, Y.F.; Wang, T.

    2010-01-01

    The potential of reflectance spectroscopy to estimate the concentration of biochemical compounds related to tea (Camellia sinensis (L.)) quality (total tea polyphenols and free amino acids) is demonstrated. Partial least squares regression (PLSR) was performed to establish the relationship between

  8. Research on pyrolysis behavior of Camellia sinensis branches via the Discrete Distributed Activation Energy Model.

    Science.gov (United States)

    Zhou, Bingliang; Zhou, Jianbin; Zhang, Qisheng

    2017-10-01

    This study aims at investigating the pyrolysis behavior of Camellia sinensis branches by the Discrete Distributed Activation Energy Model (DAEM) and thermogravimetric experiments. Then the Discrete DAEM method is used to describe pyrolysis process of Camellia sinensis branches dominated by 12 characterized reactions. The decomposition mechanism of Camellia sinensis branches and interaction with components are observed. And the reaction at 350.77°C is a significant boundary of the first and second reaction range. The pyrolysis process of Camellia sinensis branches at the heating rate of 10,000°C/min is predicted and provides valuable references for gasification or combustion. The relationship and function between four typical indexes and heating rates from 10 to 10,000°C/min are revealed. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Research and development of Camellia oleifera fruit sheller and sorting machine

    Science.gov (United States)

    Kang, Di; Wang, Yong; Fan, Youhua; Chen, Zejun

    2018-01-01

    Camellia oleifera fruit sheller in this paper was designed by the principle of kneading and extruding. This machine adopted the rolling classification sieve to screen camellia oleifera fruit with different sizes into the husking device, and camellia oleifera fruit was shelled in the mutually co-operative action of transport belt and flexible rubbing washboard. After research, in the condition that the moisture content of camellia oleifera fruit was below 55%, the vibration of the motor frequency was 50 Hz and the horizontal angle of sorting belt was 50 degrees∼55 degrees, the processing capacity was more than 900 kg/h, the threshing ratio was more than 97%, the seed broken ratio was less than 5%, the loss ratio was less than 1%. The machine is of great value in actual production, and should be widely spread and applied.

  10. Favoriser le développement de chaînes de valeur agricoles ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Favoriser le développement de chaînes de valeur agricoles inclusives et durables grâce aux TIC ... Ce projet vise à mettre l'information et les connaissances au service du développement de chaînes de valeur agricoles grâce à l'utilisation stratégique des TIC. ... Tropical Agriculture Research and Higher Education Center.

  11. Analysis of Climate Change Effect on Camellia Oil Content in Fujian Province of China

    Directory of Open Access Journals (Sweden)

    YU Hui-kang

    2015-02-01

    Full Text Available Fujian Province is one of the main camellia oleifera production areas in China. Camellia oleifera is also an important characteristic varieties of woody oil, which can produce the high quality seed oil. By using of 0.5°(E×0.5°(Nlattice data of China ground temperature and precipitation from 1961 to 2010 which came from National Meteorological Information Center in 2013, this paper extracted the corre-sponding decadal climate data of Fujian Province to carry on statistical and variation analysis, applied climate models of the integrated assess-ment for camellia oil content by using of ArcGIS geographic information technology and probability statistics method to regionalize the oil content of camellia oleifera temporal and spatial distribution from 1961s to 2010s in Fujian Province, analyzed the variation relationship be-tween the oil content and climate essential factor of the monthly decadal mean temperature and precipitation in September at the stage of the key growth period of camellia oil fat accumulation and transformation, evaluated the regional characteristics of camellia oil content variation affected by climate factors in Fujian Province from 1961s to 2010s. The results showed that the decadal mean precipitation in September had a positive significant correlation with oil content change and played a major role of camellia oleifera production in Fujian Province; the signif-icant characteristics of that oil content level in high or low followed the decadal alternate change. There were obviously different oil content level between high oil decadal(1960s, 1980s, 2000sand low oil decadal(1970s, 1990s, and its significant variation period was 20 years. The decadal difference was not significant in temperature coefficient of variation (CvT, which affected the oil content was not obvious either. But there had significant change between precipitation coefficient of variation(CvRand oil content coefficient of variation(Cvf, and their

  12. Semi-lethal high temperature and heat tolerance of eight Camellia species

    OpenAIRE

    He, XY; Ye, H; Ma, JL; Zhang, RQ; Chen, GC; Xia, YY

    2012-01-01

    Annual leaf segments of eight Camellia species were used to study the heat tolerance by an electrical conductivity method, in combination with a Logistic equation to ascertain the semi-lethal high temperature by fitting the cell injury rate curve. Te relationship between the processing temperature and the cell injury rate in Camellia showed a typical "S" shaped curve, following the Logistic model. Te correlation coeficient was above 0.95. Te semi-lethal high temperature LT50 of the eight Came...

  13. Unravelling Colletotrichum species associated with Camellia: employing ApMat and GS loci to resolve species in the C. gloeosporioides complex

    NARCIS (Netherlands)

    Liu, F.; Weir, B.S.; Damm, U.; Crous, P.W.; Wang, Y.; Liu, B.; Wang, M.; Zhang, M.; Cai, L.

    2015-01-01

    "We investigated the phylogenetic diversity of 144 Colletotrichum isolates associated with symptomatic and asymptomatic tissues of Camellia sinensis and other Camellia spp. from seven provinces in China (Fujian, Guizhou, Henan, Jiangxi, Sichuan, Yunnan, Zhejiang), and seven isolates obtained from

  14. Unravelling Colletotrichum species associated with Camellia: employing ApMat and GS loci to resolve species in the C. gloeosporioides complex

    NARCIS (Netherlands)

    Liu, F; Weir, B S; Damm, U; Crous, P W; Wang, Y; Liu, B; Wang, M; Zhang, M; Cai, L

    2015-01-01

    We investigated the phylogenetic diversity of 144 Colletotrichum isolates associated with symptomatic and asymptomatic tissues of Camellia sinensis and other Camellia spp. from seven provinces in China (Fujian, Guizhou, Henan, Jiangxi, Sichuan, Yunnan, Zhejiang), and seven isolates obtained from

  15. HERSCHEL OBSERVATIONS OF THE T CHA TRANSITION DISK: CONSTRAINING THE OUTER DISK PROPERTIES

    International Nuclear Information System (INIS)

    Cieza, Lucas A.; Olofsson, Johan; Henning, Thomas; Harvey, Paul M.; Evans II, Neal J.; Pinte, Christophe; Augereau, Jean-Charles; Ménard, Francois; Merín, Bruno; Najita, Joan

    2011-01-01

    T Cha is a nearby (d ∼ 100 pc) transition disk known to have an optically thin gap separating optically thick inner and outer disk components. Huélamo et al. recently reported the presence of a low-mass object candidate within the gap of the T Cha disk, giving credence to the suspected planetary origin of this gap. Here we present the Herschel photometry (70, 160, 250, 350, and 500 μm) of T Cha from the 'Dust, Ice, and Gas in Time' Key Program, which bridges the wavelength range between existing Spitzer and millimeter data and provide important constraints on the outer disk properties of this extraordinary system. We model the entire optical to millimeter wavelength spectral energy distribution (SED) of T Cha (19 data points between 0.36 and 3300 μm without any major gaps in wavelength coverage). T Cha shows a steep spectral slope in the far-IR, which we find clearly favors models with outer disks containing little or no dust beyond ∼40 AU. The full SED can be modeled equally well with either an outer disk that is very compact (only a few AU wide) or a much larger one that has a very steep surface density profile. That is, T Cha's outer disk seems to be either very small or very tenuous. Both scenarios suggest a highly unusual outer disk and have important but different implications for the nature of T Cha. Spatially resolved images are needed to distinguish between the two scenarios.

  16. HERSCHEL OBSERVATIONS OF THE T CHA TRANSITION DISK: CONSTRAINING THE OUTER DISK PROPERTIES

    Energy Technology Data Exchange (ETDEWEB)

    Cieza, Lucas A. [Institute for Astronomy, University of Hawaii at Manoa, Honolulu, HI 96822 (United States); Olofsson, Johan; Henning, Thomas [Max Planck Institut fuer Astronomie, Koenigstuhl 17, 69117 Heidelberg (Germany); Harvey, Paul M.; Evans II, Neal J. [Department of Astronomy, University of Texas at Austin, Austin, TX 78712 (United States); Pinte, Christophe; Augereau, Jean-Charles; Menard, Francois [UJF-Grenoble 1/CNRS-INSU, Institut de Planetologie et d' Astrophysique de Grenoble (IPAG) UMR 5274, Grenoble, F-38041 (France); Merin, Bruno [Herschel Science Centre, European Space Agency (ESAC), P.O. Box 78, 28691 Villanueva de la Canada, Madrid (Spain); Najita, Joan, E-mail: lcieza@ifa.hawaii.edu [National Optical Astronomy Observatory, 950 N. Cherry Avenue, Tucson, AZ 86719 (United States)

    2011-11-10

    T Cha is a nearby (d {approx} 100 pc) transition disk known to have an optically thin gap separating optically thick inner and outer disk components. Huelamo et al. recently reported the presence of a low-mass object candidate within the gap of the T Cha disk, giving credence to the suspected planetary origin of this gap. Here we present the Herschel photometry (70, 160, 250, 350, and 500 {mu}m) of T Cha from the 'Dust, Ice, and Gas in Time' Key Program, which bridges the wavelength range between existing Spitzer and millimeter data and provide important constraints on the outer disk properties of this extraordinary system. We model the entire optical to millimeter wavelength spectral energy distribution (SED) of T Cha (19 data points between 0.36 and 3300 {mu}m without any major gaps in wavelength coverage). T Cha shows a steep spectral slope in the far-IR, which we find clearly favors models with outer disks containing little or no dust beyond {approx}40 AU. The full SED can be modeled equally well with either an outer disk that is very compact (only a few AU wide) or a much larger one that has a very steep surface density profile. That is, T Cha's outer disk seems to be either very small or very tenuous. Both scenarios suggest a highly unusual outer disk and have important but different implications for the nature of T Cha. Spatially resolved images are needed to distinguish between the two scenarios.

  17. Flavonoids and fatty acids of Camellia japonica leaves extract

    Directory of Open Access Journals (Sweden)

    Cinthia M. Azuma

    2011-07-01

    Full Text Available The ethanol extract from the leaves of Camellia japonica L., Theaceae, showed antiradical potential in the DPPH test using TLC plates (SiO2. Aiming the isolation of active compounds, this extract was partitioned between BuOH:H2O (1:1 and the two obtained phases were also evaluated to detection of antiradical activity. The active BuOH phase was fractionated in Sephadex LH-20 and silica (normal or reverse phase to afford three aglycone flavonoids (quercetin, kaempferol and apigenin, which have been described in the C. japonica at first time, two glycosilated flavonoids (rutin and quercetrin, and a mixture of saturated fatty acids. The structures of isolated compounds were defined by NMR and GC/MS analyses.

  18. Flavonoids and fatty acids of Camellia japonica leaves extract

    Directory of Open Access Journals (Sweden)

    Cinthia M. Azuma

    2011-12-01

    Full Text Available The ethanol extract from the leaves of Camellia japonica L., Theaceae, showed antiradical potential in the DPPH test using TLC plates (SiO2. Aiming the isolation of active compounds, this extract was partitioned between BuOH:H2O (1:1 and the two obtained phases were also evaluated to detection of antiradical activity. The active BuOH phase was fractionated in Sephadex LH-20 and silica (normal or reverse phase to afford three aglycone flavonoids (quercetin, kaempferol and apigenin, which have been described in the C. japonica at first time, two glycosilated flavonoids (rutin and quercetrin, and a mixture of saturated fatty acids. The structures of isolated compounds were defined by NMR and GC/MS analyses.

  19. Investigation of major phenolic antioxidants from Camellia sinensis fruits

    Directory of Open Access Journals (Sweden)

    Ajay Rana

    2015-12-01

    Full Text Available The present study unveils major phenolic antioxidant compounds from Camellia sinensis fruits, followed by their investigation, purification and characterization using HPLC, ESI-MS and NMR studies. The spectrophotometric estimation results have clearly demonstrated that C. sinensis (tea fruits contain up to 14% of total polyphenols (as gallic acid equivalent and 7% of flavonoids (as quercetin equivalent on dry weight basis. Differential solvent-mediated extractions have been performed for quantitative assessment of major phytoconstituents by RP-HPLC analysis. And the results have revealed that these fruits contain adequate amount of tea catechins (4% along with caffeine (1% and theanine (0.4% on dry weight basis. Moreover, purification and characterization of major phytoconstituents such as epigallocatechin, epicatechin, epigallocatechin gallate and epicatechin gallate along with caffeine have been accomplished. Thus, it is clearly demonstrated that tea fruits could act as a possible and reliable source for obtaining major phenolic antioxidants.

  20. Laguna Verde: the nuclear debate in Mexico

    International Nuclear Information System (INIS)

    Weinberg, Bill.

    1987-01-01

    Mexico in planning to start up its first nuclear power station at Laguna Verde in the state of Veracruz (1988). The history of the plant is traced; it should have been finished by 1974. Both the fuel and the technology have been imported from the United States for Laguna Verde. The design, a Mark II Boiling Water Reactor, is controversial and there are doubts as to its safety. Opposition to the plant on safety and environmental grounds has grown. In April 1987 a 'Chernobyl anniversary' demonstration had 10,000 protesters and opponents of the plant are becoming more militant. The main opposition is from environmental and 'Green' groups but also includes intellectuals. However, politically, Mexico would find it embarrassing to cancel the plant and also it wants to be seen as a 'First World' rather than a 'Third World' country. (U.K.)

  1. Achieving engineering excellence at Palo Verde

    International Nuclear Information System (INIS)

    Prawlocki, F.C.

    1989-01-01

    Early in 1988, the management of the newly formed Palo Verde Nuclear Generating Station (PVNGS) Engineering and Construction Division was faced with a dilemma: how to build a competent, confident, efficient engineering organization in the face of increasing requirements and tightened fiscal controls. This paper discusses steps taken by Palo Verde to address actions taken to effect a smooth transition from construction to operations and the development of the Engineering Excellence Program. The Engineering Excellence Program will continue to evolve over time as the number of the NED's [Nuclear Engineering Department] personnel grown and processes are changed over the course of the next few years. As tasks from the Engineering Excellence Program action plan are completed, the results achieved are expected to be integrated into the routine business of the NED

  2. Genetic diversity, population structure, and traditional culture of Camellia reticulata.

    Science.gov (United States)

    Xin, Tong; Huang, Weijuan; De Riek, Jan; Zhang, Shuang; Ahmed, Selena; Van Huylenbroeck, Johan; Long, Chunlin

    2017-11-01

    Camellia reticulata is an arbor tree that has been cultivated in southwestern China by various sociolinguistic groups for esthetic purposes as well as to derive an edible seed oil. This study examined the influence of management, socio-economic factors, and religion on the genetic diversity patterns of Camellia reticulata utilizing a combination of ethnobotanical and molecular genetic approaches. Semi-structured interviews and key informant interviews were carried out with local communities in China's Yunnan Province. We collected plant material ( n  = 190 individuals) from five populations at study sites using single-dose AFLP markers in order to access the genetic diversity within and between populations. A total of 387 DNA fragments were produced by four AFLP primer sets. All DNA fragments were found to be polymorphic (100%). A relatively high level of genetic diversity was revealed in C. reticulata samples at both the species ( H sp  = 0.3397, I sp  = 0.5236) and population (percentage of polymorphic loci = 85.63%, H pop  = 0.2937, I pop  = 0.4421) levels. Findings further revealed a relatively high degree of genetic diversity within C. reticulata populations (Analysis of Molecular Variance = 96.31%). The higher genetic diversity within populations than among populations of C. reticulata from different geographies is likely due to the cultural and social influences associated with its long cultivation history for esthetic and culinary purposes by diverse sociolinguistic groups. This study highlights the influence of human management, socio-economic factors, and other cultural variables on the genetic and morphological diversity of C. reticulata at a regional level. Findings emphasize the important role of traditional culture on the conservation and utilization of plant genetic diversity.

  3. Development of a service organization. CHA (Catholic Hospital Association) from post-World War II through Vatican II.

    Science.gov (United States)

    Kauffman, C J

    1990-06-01

    Having weathered the Depression and war years, CHA in the late 1940s looked forward to a new era in Catholic healthcare. The third and fourth articles of Health Progress's six-part history of CHA described how Rev. Alphonse M. Schwitalla, SJ, led the association through one of the most difficult periods in U.S. history. This article follows CHA's development into a modern service organization under the leadership of Rev. John J. Flanagan, SJ. The series' final installment, which will appear in the July-August issue, describes how CHA has modernized its services and structure in the past two decades to help its members adjust to a turbulent environment.

  4. Palo Verde receives new control room simulator

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    A new control room simulator was delivered to Arizona Public Service Company's Palo Verde nuclear generating station in late August. The system, the second simulator on site, will be used for training beginning in January 1994, said David C. Brown, manager of the simulator upgrade project. Having two simulators will ease the current tight training schedule, and allow expansion of instruction to personnel other than licensed operators

  5. First fuel reload in Laguna Verde

    International Nuclear Information System (INIS)

    Bahena B, D.

    1992-01-01

    A report containing the activities carried out during the first reload of nuclear fuel and major maintenance in the Laguna Verde nuclear reactor is presented. The previous and the specific activities are included. These last are related without including the technical considerations, data or the operation details, because these data were documented inside the registrations of the CFE, the ININ and in personal way. (Author)

  6. QUÍMICA VERDE: UN NUEVO RETO

    Directory of Open Access Journals (Sweden)

    Nerlis Paola Pájaro Castro

    2011-01-01

    Full Text Available En la actualidad, existe un enorme deterioro del medio ambiente que ha generado la necesidad de buscar alternativas que conduzcan a la sostenibilidad ambiental. Una de estas herramientas es la ¿química verde¿, concepto que contempla el diseño de productos y procesos que reduzcan la generación de sustancias peligrosas y maximicen la eficiencia en la utilización de recursos materiales y energéticos. El empleo de tecnologías menos contaminantes, permitirá a las empresas químicas mitigar los efectos ambientales asociados a su actividad, reduciendo el consumo de materiales e incrementando la participación de recursos renovables. Para alcanzar estas metas, se han propuesto 12 principios básicos de química verde, aplicables en diferentes campos, tales como la medicina, la agricultura, la industria química y farmacéutica. Esta revisión detalla los principios y usos principales de la química verde, y su aplicación como una filosofía de trabajo para avanzar hacia un verdadero desarrollo sostenible.

  7. Efeitos do chá verde e do exercício físico sobre a composição corporal de pessoas obesas

    Directory of Open Access Journals (Sweden)

    Daniel Zanardini Fernandes

    2017-04-01

    Full Text Available Objetivo: analisar os efeitos do consumo de chá verde associado ao exercício físico sobre a composição corporal de pessoas obesas. Materiais e método: o estudo trata-se de uma revisão sistemática de literatura. As buscas foram feitas nas bases de dados Lilacs, Scielo e PubMed, utilizando os descritores: obesidade, chá verde, Camellia Sinensis, exercício. Os artigos utilizados foram publicados entre os anos de 2003 a 2015. Resultados: uma ferramenta recentemente utilizada para o controle do peso é o chá verde, considerado um alimento funcional; é a segunda bebida mais consumida no mundo. Evidências mostram seu efeito termogênico com aumento do gasto energético e promoção da oxidação de gorduras. O consumo de chá verde se mostrou efetivo na diminuição de massa corporal, especialmente na forma de gordura, porém o consumo do chá aliado à prática de exercício se mostra mais eficaz para a redução de peso. Ressalta-se ainda que os hábitos alimentares saudáveis devem ser incentivados para obter o máximo dos benefícios dessa planta. Considerações finais: é necessária a investigação mais aprofundada para determinar as doses e formas de administração seguras do chá verde, bem como os mecanismos de ação e da biodisponibilidade dos compostos ativos, pois se trata de um alimento de baixo custo e que pode ser utilizado no manejo nutricional de doenças crônicas como a obesidade, colaborando assim, para a qualidade de vida e saúde da população.

  8. Intraplate seismicity across the Cape Verde swell

    Science.gov (United States)

    Vales, Dina; Matias, Luís.; Haberland, Christian; Silveira, Graça.; Weber, Michael; Carrilho, Fernando; Dias, Nuno

    2010-05-01

    The Cape Verde Archipelago ((15-17°N, 23-26°W) is located within the African plate, about 500km west of Senegal, in the African coast. The islands are located astride the Cape Verde mid-plate topographic swell, one of the largest features of its type in the world's ocean basins. The origin of this Cape Verde swell is still in debate. Previous determinations of the elastic thickness (Te) reveal a normal Te and a modest heat flow anomaly which suggest that the swell cannot be fully explained by uplift due to thermal reheating of the lithosphere by an underlying ‘‘hot spot'' and that other, deep-seated, mantle processes must be involved. The CV-PLUME (An investigation on the geometry and deep signature of the Cape Verde mantle plume) project intends to shape the geometry and deep origin of the Cape Verde mantle plume, via a combined study of seismic, magnetic, gravimetric and geochemical observations. Through this study we intend to characterize the structure beneath the archipelago from the surface down to the deep mantle. The core of this 3-year project was a temporary deployment of 39 Very Broad Band seismometers, across all the inhabited islands, to recorder local and teleseismic earthquakes. These instruments were operational from November 2007 to September 2008. In this work we report on the preliminary results obtained from the CV-PLUME network on the characterization of the local and regional seismicity. To detect the small magnitude seismic events the continuous data stream was screened using spectrograms. This proved to be a very robust technique in the face of the high short-period noise recorded by many of the stations, particularly during day time. The 10 month observation time showed that the background seismic activity in the Archipelago and surrounding area is low, with only a very few events recorded by the complete network. However, two clusters of earthquakes were detected close to the Brava Island, one to the NW and a second one, more active

  9. Coordination Environment of Copper Sites in Cu-CHA Zeolite Investigated by Electron Paramagnetic Resonance

    DEFF Research Database (Denmark)

    Godiksen, Anita; Stappen, Frederick N.; Vennestrøm, Peter N. R.

    2014-01-01

    Cu-CHA combines high activity for the selective catalytic reduction (SCR) reaction with better hydrothermal stability and selectivity compared to other copper-substituted zeolites. At the same time Cu-CHA offers an opportunity for unraveling the coordination environment of the copper centers since...... the zeolite framework is very simple with only one crystallographically independent tetrahedral site (T-site). In this study the results of an X-band electron paramagnetic resonance (EPR) investigation of ion-exchanged Cu-CHA zeolite with a Si/Al ratio of 14 ± 1 is presented. Different dehydration treatments...... of the EPR silent monomeric Cu2+ in copper-substituted zeolites is suggested to be copper species with an approximate trigonal coordination sphere appearing during the dehydration. After complete dehydration at 250 °C the majority of the EPR silent Cu2+ is suggested to exist as Cu2+–OH– coordinated to two...

  10. Heating the Primordial Soup: X-raying the Circumstellar Disk of T Cha

    Science.gov (United States)

    Principe, David; Huenemoerder, D.; Kastner, J. H.; Bessell, M. S.; Sacco, G.

    2014-01-01

    The classical T Tauri Star (cTTS) T Chamaeleontis (T Cha) presents a unique opportunity to probe pre-main sequence star-disk interactions and late-stage circumstellar disk evolution. T Cha is the only known example of a nearly edge-on, actively accreting star/disk system within ~110 pc, and furthermore may be orbited by a low-mass companion or massive planet that has cleared an inner hole in its disk. The star is characterized by strong variability in the optical 3 magnitudes in the V band) as well as large and variable extinction (AV in the range of 1-5). Like most cTTS, T Cha is also a luminous X-ray source. We present preliminary results of two observations (totaling 150 ks) of T Cha with Chandra’s HETGS. Our motivations are to (a) determine the intrinsic X-ray spectrum of T Cha, so as to establish whether its X-ray emission can be attributed to accretion shocks, coronal emission, or a combination; (b) investigate whether its X-ray flux exhibits modulation that may be related to the stellar rotational period 3.3 days); and (c) take advantage of the nearly-edge-on disk viewing geometry to model the spectrum of X-rays absorbed by the gaseous disk orbiting T Cha. These results will serve as much-needed input to models of magnetospheric accretion and irradiated, planet-forming disks. This research is supported via award number GO3-14022X to RIT issued by the Chandra X-ray Observatory Center, which is operated by the Smithsonian Astrophysical Observatory for and on behalf of NASA under contract NAS803060. Additional support is provided by National Science Foundation grant AST-1108950 to RIT.

  11. Differential impact of some Aspergillus species on Meloidogyne javanica biocontrol by Pseudomonas fluorescens strain CHA0.

    Science.gov (United States)

    Siddiqui, I A; Shaukat, S S; Khan, A

    2004-01-01

    The aim was to determine the influence of some Aspergillus species on the production of nematicidal agent(s) in vitro and biocontrol of Meloidogyne javanica in tomato by Pseudomonas fluorescens strains CHA0 and CHA0/pME3424. Six species of Aspergillus, isolated from the rhizosphere of certain crops, produced a variety of secondary metabolites in vitro. Culture filtrate (CF) obtained from Ps. fluorescens strain CHA0 and its2,4-diacetylphloroglucinol overproducing mutant CHA0/pME3424 grown in King's B liquid medium caused significant mortality of M. javanica juveniles in vitro. Bacterial growth medium amended with CF of A. niger enhanced nematicidal and beta-galactosidase activities of fluorescent pseudomonads while A. quadrilineatus repressed such activities. Methanol or ethyl acetate extracts of the CF of A. niger markedly optimized bacterial efficacy to cause nematode deaths while hexane extract of the fungus had no influence on the nematicidal activity of the bacterial strains. A. niger applied alone or in conjunction with the bacterial inoculants inhibited root-knot nematode galling in tomato. On the other hand, A. quadrilineatus used alone or together with CHA0 did not inhibit nematode galling but when used in combination with strain CHA0/pME3424 did reduce galling intensity. Aspergillus niger enhances the production of nematicidal compounds by Ps. fluorescensin vitro and improves biocontrol potential of the bacterial inoculants in tomato while A. quadrilineatus reduces bacterial performance to suppress root-knot nematodes. Rhizosphere harbours a variety of micro-organisms including bacteria, fungi and viruses. Aspergillus species are ubiquitous in most agricultural soils and generally produce a variety of secondary metabolites. Such metabolites synthesized by Aspergillus species may influence the production of nematicidal agents and subsequent biocontrol performance of the bacterial inoculants against plant-parasitic nematodes. This fact needs to be taken into

  12. Camp Verde Adult Reading Program. Final Performance Report.

    Science.gov (United States)

    Maynard, David A.

    This document begins with a four-page performance report describing how the Camp Verde Adult Reading Program site was relocated to the Community Center Complex, and the Town Council contracted directly with the Friends of the Camp Verde Library to provide for the requirements of the program. The U.S. Department of Education grant allowed the…

  13. Occurrence of theobromine synthase genes in purine alkaloid-free species of Camellia plants.

    Science.gov (United States)

    Ishida, Mariko; Kitao, Naoko; Mizuno, Kouichi; Tanikawa, Natsu; Kato, Misako

    2009-02-01

    Caffeine (1,3,7-trimethylxanthine) and theobromine (3,7-dimethylxanthine) are purine alkaloids that are present in high concentrations in plants of some species of Camellia. However, most members of the genus Camellia contain no purine alkaloids. Tracer experiments using [8-(14)C]adenine and [8-(14)C]theobromine showed that the purine alkaloid pathway is not fully functional in leaves of purine alkaloid-free species. In five species of purine alkaloid-free Camellia plants, sufficient evidence was obtained to show the occurrence of genes that are homologous to caffeine synthase. Recombinant enzymes derived from purine alkaloid-free species showed only theobromine synthase activity. Unlike the caffeine synthase gene, these genes were expressed more strongly in mature tissue than in young tissue.

  14. Enzymatic lipophilization of epicatechin with free fatty acids and its effect on antioxidative capacity in crude camellia seed oil.

    Science.gov (United States)

    Chen, Sa-Sa; Luo, Shui-Zhong; Zheng, Zhi; Zhao, Yan-Yan; Pang, Min; Jiang, Shao-Tong

    2017-02-01

    Crude camellia seed oil is rich in free fatty acids, which must be removed to produce an oil of acceptable quality. In the present study, we reduced the free fatty acid content of crude camellia seed oil by lipophilization of epicatechin with these free fatty acids in the presence of Candida antarctica lipase B (Novozym 435), and this may enhance the oxidative stability of the oil at the same time. The acid value of crude camellia seed oil reduced from 3.7 to 2.5 mgKOH g -1 after lipophilization. Gas chomatography-mass spectrometry analysis revealed that epicatechin oleate and epicatechin palmitate were synthesized in the lipophilized oil. The peroxide, p-anisidine, and total oxidation values during heating of the lipophilized oil were much lower than that of the crude oil and commercially available camellia seed oil, suggesting that lipophilized epicatechin derivatives could help enhance the oxidative stability of edible oil. The enzymatic process to lipophilize epicatechin with the free fatty acids in crude camellia seed oil described in the present study could decrease the acid value to meet the quality standards for commercial camellia seed oil and, at the same time, obtain a new edible camellia seed oil product with good oxidative stability. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  15. Landscape value of the tea (Camellia sinensis areas

    Directory of Open Access Journals (Sweden)

    Nilgün Güneroğlu

    2016-04-01

    Full Text Available Agricultural fields are very effective and widespread in Turkey’s rural landscape formation. Turkey is located on transitional climatic zone on mid-latitudes which leads to diversification of agricultural plants. Accordingly, many agricultural landscape types representing diferent regions and culture were naturally formed. Agricultural lands are not only fields for harvesting crops but also areas to form natural habitats, reduce greenhouse effect and create cultural landscapes with countable value. Moreover, it is well-known that landscape value has also economic compesation as result of offered ecosystem services. Therefore this study was carried out in Rize city located on Northeastern part of Turkey and characterized by Tea (Camellia sinensis cultivation. This study was carried out in three steps. The first step is a literature search, the second one is the preparing of identity card for each survey point and the last step is based on data obtained from questionnaries and related field work to produce quantitative landscpae value map of the region by considering visual perception and tourism value of the study area. Finally, character number 2 has the highest landscape value whereas character number 4 has the lowest landscape value among previosuly determined 5 landscape characters of the study area. It is concluded that non-fragmented areas are generally more preffered as they offer integrated and perceivable landscapes to the users.

  16. Heart failure: a weak link in CHA2 DS2 -VASc.

    Science.gov (United States)

    Friberg, Leif; Lund, Lars H

    2018-02-15

    In atrial fibrillation, stroke risk is assessed by the CHA 2 DS 2 -VASc score. Heart failure is included in CHA 2 DS 2 -VASc, but the rationale is uncertain. Our objective was to test if heart failure is a risk factor for stroke, independent of other risk factors in CHA 2 DS 2 -VASc. We studied 300 839 patients with atrial fibrillation in the Swedish Patient Register 2005-11. Three definitions of heart failure were used in order to assess the robustness of the results. In the main analysis, heart failure was defined by a hospital discharge diagnosis of heart failure as first or second diagnosis and a filled prescription of a diuretic within 3 months before index + 30 days. The second definition counted first or second discharge diagnoses failure diagnosis in open or hospital care before index + 30 days. Associations with outcomes were assessed with multivariable Cox analyses. Patients with heart failure were older (80.5 vs. 74.0 years, P failure and 3.1% without. Adjustment for the cofactors in CHA 2 DS 2 -VASc eradicated the difference in stroke risk between patients with and without heart failure (hazard ratio 1.01 with 95% confidence interval 0.96-1.05). The area under the receiver operating characteristic curve for CHA 2 DS 2 -VASc was not improved by points for heart failure. A clinical diagnosis of heart failure was not an independent risk factor for stroke in patients with atrial fibrillation, which may have implications for anticoagulation management. © 2018 The Authors. ESC Heart Failure published by John Wiley & Sons Ltd on behalf of the European Society of Cardiology.

  17. VizieR Online Data Catalog: ChaMP X-ray point source catalog (Kim+, 2007)

    Science.gov (United States)

    Kim, M.; Kim, D.-W.; Wilkes, B. J.; Green, P. J.; Kim, E.; Anderson, C. S.; Barkhouse, W. A.; Evans, N. R.; Ivezic, Z.; Karovska, M.; Kashyap, V. L.; Lee, M. G.; Maksym, P.; Mossman, A. E.; Silverman, J. D.; Tananbaum, H. D.

    2009-01-01

    We present the Chandra Multiwavelength Project (ChaMP) X-ray point source catalog with ~6800 X-ray sources detected in 149 Chandra observations covering ~10deg2. The full ChaMP catalog sample is 7 times larger than the initial published ChaMP catalog. The exposure time of the fields in our sample ranges from 0.9 to 124ks, corresponding to a deepest X-ray flux limit of f0.5-8.0=9x10-16ergs/cm2/s. The ChaMP X-ray data have been uniformly reduced and analyzed with ChaMP-specific pipelines and then carefully validated by visual inspection. The ChaMP catalog includes X-ray photometric data in eight different energy bands as well as X-ray spectral hardness ratios and colors. To best utilize the ChaMP catalog, we also present the source reliability, detection probability, and positional uncertainty. (10 data files).

  18. First fuel reload in Laguna Verde; Primera recarga de combustible en Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Bahena B, D

    1992-01-15

    A report containing the activities carried out during the first reload of nuclear fuel and major maintenance in the Laguna Verde nuclear reactor is presented. The previous and the specific activities are included. These last are related without including the technical considerations, data or the operation details, because these data were documented inside the registrations of the CFE, the ININ and in personal way. (Author)

  19. Exogenous abscisic acid significantly affects proteome in tea plant (Camellia sinensis) exposed to drought stress

    Science.gov (United States)

    Tea [Camellia sinensis (L.) O. Kuntze] is an important economic crop, and drought is the most important abiotic stress affecting yield and quality. Abscisic acid (ABA) is an important phytohormone responsible for activating drought resistance. Increased understanding of ABA effects on tea plant unde...

  20. Diverse Colletotrichum species cause anthracnose of tea plants (Camellia sinensis (L.) O. Kuntze) in China.

    Science.gov (United States)

    Wang, Yu-Chun; Hao, Xin-Yuan; Wang, Lu; Bin Xiao; Wang, Xin-Chao; Yang, Ya-Jun

    2016-10-26

    Anthracnose caused by Colletotrichum is one of the most severe diseases that can afflict Camellia sinensis. However, research on the diversity and geographical distribution of Colletotrichum in China remain limited. In this study, 106 Colletotrichum isolates were collected from diseased leaves of Ca. sinensis cultivated in the 15 main tea production provinces in China. Multi-locus phylogenetic analysis coupled with morphological identification showed that the collected isolates belonged to 11 species, including 6 known species (C. camelliae, C. cliviae, C. fioriniae, C. fructicola, C. karstii, and C. siamense), 3 new record species (C. aenigma, C. endophytica, and C. truncatum), 1 novel species (C. wuxiense), and 1 indistinguishable strain, herein described as Colletotrichum sp. Of these species, C. camelliae and C. fructicola were the dominant species causing anthracnose in Ca. sinensis. In addition, our study provided further evidence that phylogenetic analysis using a combination of ApMat and GS sequences can be used to effectively resolve the taxonomic relationships within the C. gloeosporioides species complex. Finally, pathogenicity tests suggested that C. camelliae, C. aenigma, and C. endophytica are more invasive than other species after the inoculation of the leaves of Ca. sinensis.

  1. Zero-correlation linear cryptanalysis with FFT and improved attacks on ISO standards Camellia and CLEFIA

    DEFF Research Database (Denmark)

    Bogdanov, Andrey; Geng, Huizheng; Wang, Meiqin

    2014-01-01

    as published in FSE'12 and ASIACRYPT'12, respectively. In this paper, we use the FFT (Fast Fourier Transform) technique to speed up the zero-correlation cryptanalysis. First, this allows us to improve upon the state-of-the-art cryptanalysis for the ISO/IEC standard and CRYPTREC-portfolio cipher Camellia...

  2. Seasonal symptom expression, laboratory detection success, and sporulation potential of Phytophthora ramorum on rhododendron and camellia

    Science.gov (United States)

    Steve A. Tjosvold; David L. Chambers; Cheryl L. Blomquist

    2008-01-01

    Camellias and rhododendrons are important nursery and landscape plants and are known to be highly susceptible hosts of the quarantined plant pathogen, Phytophthora ramorum Werres, de Cock & Man In?t Veld. Nursery inspection can not always occur during optimal conditions for the disease and its detection. The goals of this research were to (1)...

  3. PENGGUNAAN EKSTRAK TEH HIJAU (Camellia sinensis) SEBAGAI PENGHAMBAT PEMBENTUKAN HISTAMIN PADA IKAN SEBELUM DIOLAH

    OpenAIRE

    Endang Sri Heruwati; Farida Ariyani; Radestya Triwibowo; Novalia Rachmawati; Irma Hermana

    2009-01-01

    Penelitian penggunaan ekstrak teh hijau (Camellia sinensis) sebagai penghambat pembentukan histamin pada ikan telah dilakukan. Ikan, terutama dari jenis skombroid, sangat rentan mengalami kerusakan karena terjadinya perubahan asam amino histidin yang terkandung dalam ikan menjadi senyawa histamin yang bersifat alergen, yang dikatalisasi oleh enzim histamin dekarboksilase (HDC). Teh hijau diketahui mengandung polifenol berupa senyawa epigalokatekingalat (EGCG) yang merupakan penghambat enzim H...

  4. Thesis Abstract Fermented milk elaborated with Camellia sinensis.

    Science.gov (United States)

    Ribeiro, O A S; Silva, M I A; Boari, C A

    2016-05-13

    This study aimed to develop and to characterize fermented dairy beverage formulated with Camellia sinensis. The infusion was elaborated with the addiction of dehydrated leaves of C. sinensis in whey (1g/100g) which added in sweetened milk (10% sucrose w/w) coagulated by Streptococcus salivarius subspecies thermophilus and Lactobacillus delbrueckii subspecies bulgaricus in proportions of 10, 20, 30 and 40% (v/w). The control treatment consisted of yogurt added with sucrose (10% w/w). Analysis were performed to quantify dry mass, moisture, ash, protein, fat, sodium, acidity, total quantification of lactic acid bacteria, total antioxidant activity and viscosity at the initial time of production and at 15 and 30 days of storage. Chromatographic determination of volatile compounds and sensory tests of acceptance and consumption intention were conducted at the initial time of production. Dry matter content, moisture, ash and total count of lactic acid bacteria from fermented milk drink formulations were not significantly affected by the amount of infusion of C. sinensis. However, the content of protein, fat and sodium were significantly lower with the increase of the proportion of infusion incorporated into the product. Significant reduction in apparent viscosity occurs with the increase in the amount of infusion added. The total antioxidant activity of the formulations was significantly higher as higher were the amount of added infusion. The addition of infusion contributed to the diversification of volatile aroma and taste makers in the product. The formulation of fermented dairy drink with addition of 30% infusion C. sinensis was better evaluated in sensory tests, with greater acceptance and greater consumer intent of consumption.

  5. GRIP BARBADOS/CAPE VERDE RADIOSONDE V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GRIP Barbados/Cape Verde radiosonde data set consists of generally two soundings per day (06Z and 12Z) launched from Barbados, and one sounding per day (12Z)...

  6. The technology transfer and the Laguna Verde power plants

    International Nuclear Information System (INIS)

    Garza, R.F. de La

    1991-01-01

    The process of technology transfer to the construction of Laguna Verde Nuclear Power Plants, Mexico, is described. The options and the efforts for absorbing the technology of Nuclear Power Plant design and construction by the mexican engineers are emphasized. (author)

  7. New species of mayflies (Ephemeroptera) from Cape Verde

    Czech Academy of Sciences Publication Activity Database

    Soldán, Tomáš; Bojková, J.

    2015-01-01

    Roč. 3926, č. 4 (2015), s. 561-575 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : Cape Verde * Macaronesia * West Africa Subject RIV: EH - Ecology, Behaviour Impact factor: 0.994, year: 2015

  8. Palo Verde Unit 3 BMI nozzle modification

    International Nuclear Information System (INIS)

    Waskey, D.

    2015-01-01

    The 61 BMI (Bottom Mount Instrumentation) nozzles of the unit 3 of the Palo Verde plant have been examined through ASME Code Case N722. The nozzle 3 was the only one with leakage noted. The ultrasound testing results are characteristic of PWSCC (Primary Water Stress Corrosion Cracking). The initiation likely occurred at a weld defect which was exposed to the primary water environment resulting in PWSCC. All other nozzles (60) showed no unacceptable indications. Concerning nozzle 3 one crack in J-groove weld connected large defect to primary water. An environmental model has been used to simulate and optimize the repair. The AREVA crew was on site 18 days after contract award and the job was completed in 12 days, 30 hours ahead of baseline schedule. This series of slides describes the examination of the BMI nozzles, the repair steps, and alternative design concepts

  9. Impuestos verdes: una meta de equidad

    Directory of Open Access Journals (Sweden)

    Lilliana Arrieta Quesada

    2011-09-01

    Full Text Available Al considerar necesario incorporar a los grupos económicos en el gran proyecto de alcanzar metas de desarrollo sostenible, que surge como un nuevo paradigma al tomarse en consciencia por parte de los organismos internacionales, entre ellos las Naciones Unidas, de la necesidad de hacer un planteamiento de desarrollo económico diferente al convencional que considera aspectos ambientales y de equidad social, se admite por primera vez que la explotación de los recursos naturales y su transformación en materia prima y fuente energética, tiene límites, los cuales deben ser considerados en cualquier planteamiento serio de desarrollo económico.Es así como surge la tesis de los impuestos verdes como una opción que permita a los gobiernos incidir tanto en el mercado como en el sector industrial y en los hábitos de los consumidores.

  10. Verdes Mares: The Ideology of the Siren

    Directory of Open Access Journals (Sweden)

    Bruno Marinoni Marinoni

    2009-02-01

    Full Text Available The television channel number 10 of Fortaleza (current TV Verdes Mares, during the 1960 decade, passed through the ideological filter of the Military Dictatorship, when the channel was taken from its owner and given to the businessman Edson Queiroz. The filter had consequences in the next decade with the channel affiliation to the biggest network broadcasting of the country, the Rede Globo, which was also protected by the Military Regime. Based on those two facts, it is intended to discuss some aspects of the exploration models of communication that occurs in the country since the specified period, emphasizing the ideology transmitted by the TV channel which has the biggest audience ratings in Ceará.

  11. Capturing the design bases on Palo Verde

    International Nuclear Information System (INIS)

    Rogers, A.C.; Prawlocki, F.C.

    1989-01-01

    Over the past several years, the nuclear power industry has been directing considerable attention to plant configuration control. Utilities have been put in difficult situations due to changes made in plants without full original design basis knowledge. Once a plant is constructed, there is often insufficient information from the reactor designer or the architect/engineer to properly support operations, especially changes to the plant. In many cases utilities do not know the design bases for their units. As a result of these concerns, many utilities have been searching for ways to define the appropriate design bases for their plant. This paper discusses steps taken by Palo Verde to produce a design bases document and how it is being used to support the operation of the three nuclear units

  12. Leptospira interrogans in Rodents from Cape Verde.

    Science.gov (United States)

    Plata-Luis, Josué; Foronda, Pilar; Martín-Alonso, Aaron; Feliu, Carlos; Alves, Joana; Gil, Horacio; Valladares, Basilio

    2016-11-01

    Leptospirosis is an important worldwide zoonotic disease that can infect both animals and humans. In most cases, leptospirosis is a nonspecific self-limiting illness, but some patients can develop a severe form with a high mortality. This study was carried out in Santiago Island, Cape Verde, in 2012-2013. A total of 62 wild rodents (Rattus rattus and Mus domesticus) were analyzed. The lipL32 gene, present only in pathogenic Leptospira spp., was amplified by PCR, and 16 samples were positive (25.8%). In both rodent species, Leptospira interrogans was identified. The results show the presence of pathogenic Leptospira in the three localities analyzed in Santiago. The presence of L. interrogans demonstrates a serious health risk for the population, since this species has been associated with the most severe form of leptospirosis, the Weil's disease in humans, a severe infection with jaundice, renal failure, and hemorrhage.

  13. Mercadeo verde de una empresa dorada

    Directory of Open Access Journals (Sweden)

    Carlos Mario Uribe-Saldarriaga

    2014-01-01

    Full Text Available El caso presenta la campaña de mercadeo realizada por Ecopetrol entre 2009 y 2012 para la introducción en Colombia del diésel ultra bajo de azufre denominado diésel limpio. Se examina la campaña desde 2 puntos de vista: el primero, el posicionamiento de Ecopetrol como una de las empresas más admiradas de Colombia, tanto por sus resultados financieros como por sus actividades en la responsabilidad social empresarial; el segundo, desde las exigencias que se hacen al mercadeo ambiental en los países desarrollados, especialmente con respecto al lavado verde, teniendo en cuenta a la vez que Ecopetrol opera en un país en vía de desarrollo donde existe un menor avance en las exigencias ambientales hechas por los grupos de interés.

  14. DCVD Measurements at the Laguna Verde NPP

    Energy Technology Data Exchange (ETDEWEB)

    Chen, J.D.; Gerwing, A.F. [Channel Systems Inc., Pinawa MA (Canada); Kosierb, R. [Canadian Nuclear Safety Commission, Ottawa, ON (Canada); Vones, J.; Broodryck, A. [International Atomic Energy Agency, Vienna (Austria)

    2006-12-30

    A new digital Cerenkov viewing device (DCVD) with high ultraviolet light sensitivity has been developed. Field measurements on BWR spent fuel at Laguna Verde Nuclear Power Plant Unit 2 resulted in new Cerenkov information on GE9 and GE12 spent fuel assemblies. Off-alignment measurements show: quantitative differences in the degree of light collimation from between the fuel rods; lack of light collimation from water rods; and decreased light collimation from partial length rod positions. Hidden rods could also be detected in off-angle views. The results indicate that it may be possible to detect missing partial-length fuel rods in GE12 fuel assemblies. The new DCVD was able to verify low burnup, long-cooled, natural uranium GE6 fuel assemblies.

  15. Mercadeo verde de una empresa dorada

    Directory of Open Access Journals (Sweden)

    Carlos Mario Uribe-Saldarriaga

    2014-01-01

    Full Text Available El caso presenta la campa ̃ na de mercadeo realizada por Ecopetrol entre 2009 y 2012 para la introducción en Colombia del diésel ultra bajo de azufre denominado diésel limpio. Se examina la campa ̃ na desde 2 puntos de vista: el primero, el posicionamiento de Ecopetrol como una de las empresas más admiradas de Colombia, tanto por sus resultados financieros como por sus actividades en la responsabilidad social empresarial; el segundo, desde las exigencias que se hacen al mercadeo ambiental en los países desarro- llados, especialmente con respecto al lavado verde, teniendo en cuenta a la vez que Ecopetrol opera en un país en vía de desarrollo donde existe un menor avance en las exigencias ambientales hechas por los grupos de interés.

  16. DCVD Measurements at the Laguna Verde NPP

    International Nuclear Information System (INIS)

    Chen, J.D.; Gerwing, A.F.; Kosierb, R.; Vones, J.; Broodryck, A.

    2006-01-01

    A new digital Cerenkov viewing device (DCVD) with high ultraviolet light sensitivity has been developed. Field measurements on BWR spent fuel at Laguna Verde Nuclear Power Plant Unit 2 resulted in new Cerenkov information on GE9 and GE12 spent fuel assemblies. Off-alignment measurements show: quantitative differences in the degree of light collimation from between the fuel rods; lack of light collimation from water rods; and decreased light collimation from partial length rod positions. Hidden rods could also be detected in off-angle views. The results indicate that it may be possible to detect missing partial-length fuel rods in GE12 fuel assemblies. The new DCVD was able to verify low burnup, long-cooled, natural uranium GE6 fuel assemblies

  17. [Fast Detection of Camellia Sinensis Growth Process and Tea Quality Informations with Spectral Technology: A Review].

    Science.gov (United States)

    Peng, Ji-yu; Song, Xing-lin; Liu, Fei; Bao, Yi-dan; He, Yong

    2016-03-01

    The research achievements and trends of spectral technology in fast detection of Camellia sinensis growth process information and tea quality information were being reviewed. Spectral technology is a kind of fast, nondestructive, efficient detection technology, which mainly contains infrared spectroscopy, fluorescence spectroscopy, Raman spectroscopy and mass spectroscopy. The rapid detection of Camellia sinensis growth process information and tea quality is helpful to realize the informatization and automation of tea production and ensure the tea quality and safety. This paper provides a review on its applications containing the detection of tea (Camellia sinensis) growing status(nitrogen, chlorophyll, diseases and insect pest), the discrimination of tea varieties, the grade discrimination of tea, the detection of tea internal quality (catechins, total polyphenols, caffeine, amino acid, pesticide residual and so on), the quality evaluation of tea beverage and tea by-product, the machinery of tea quality determination and discrimination. This paper briefly introduces the trends of the technology of the determination of tea growth process information, sensor and industrial application. In conclusion, spectral technology showed high potential to detect Camellia sinensis growth process information, to predict tea internal quality and to classify tea varieties and grades. Suitable chemometrics and preprocessing methods is helpful to improve the performance of the model and get rid of redundancy, which provides the possibility to develop the portable machinery. Future work is to develop the portable machinery and on-line detection system is recommended to improve the further application. The application and research achievement of spectral technology concerning about tea were outlined in this paper for the first time, which contained Camellia sinensis growth, tea production, the quality and safety of tea and by-produce and so on, as well as some problems to be solved

  18. Genome size variation among and within Camellia species by using flow cytometric analysis.

    Directory of Open Access Journals (Sweden)

    Hui Huang

    Full Text Available BACKGROUND: The genus Camellia, belonging to the family Theaceae, is economically important group in flowering plants. Frequent interspecific hybridization together with polyploidization has made them become taxonomically "difficult taxa". The DNA content is often used to measure genome size variation and has largely advanced our understanding of plant evolution and genome variation. The goals of this study were to investigate patterns of interspecific and intraspecific variation of DNA contents and further explore genome size evolution in a phylogenetic context of the genus. METHODOLOGY/PRINCIPAL FINDINGS: The DNA amount in the genus was determined by using propidium iodide flow cytometry analysis for a total of 139 individual plants representing almost all sections of the two subgenera, Camellia and Thea. An improved WPB buffer was proven to be suitable for the Camellia species, which was able to counteract the negative effects of secondary metabolite and generated high-quality results with low coefficient of variation values (CV <5%. Our results showed trivial effects on different tissues of flowers, leaves and buds as well as cytosolic compounds on the estimation of DNA amount. The DNA content of C. sinensis var. assamica was estimated to be 1C = 3.01 pg by flow cytometric analysis, which is equal to a genome size of about 2940 Mb. CONCLUSION: Intraspecific and interspecific variations were observed in the genus Camellia, and as expected, the latter was larger than the former. Our study suggests a directional trend of increasing genome size in the genus Camellia probably owing to the frequent polyploidization events.

  19. White tea (Camellia sinensis extract reduces oxidative stress and triacylglycerols in obese mice Extrato de chá branco reduz extresse oxidativo e triacilglicerois em camundongos obesos

    Directory of Open Access Journals (Sweden)

    Lílian Gonçalves Teixeira

    2012-12-01

    Full Text Available White tea is an unfermented tea made from young shoots of Camellia sinensis protected from sunlight to avoid polyphenol degradation. Although its levels of catechins are higher than those of green tea (derived from the same plant, there are no studies addressing the relationship between this tea and obesity associated with oxidative stress.The objective of this study was to evaluate the effect of white tea on obesity and its complications using a diet induced obesity model. Forty male C57BL/6 mice were fed a high-fat diet to induce obesity (Obese group or the same diet supplemented with 0.5% white tea extract (Obese + WTE for 8 weeks. Adipose tissue, serum lipid profile, and oxidative stress were studied. White tea supplementation was not able to reduce food intake, body weight, or visceral adiposity. Similarly, there were no changes in cholesterol rich lipoprotein profile between the groups. A reduction in blood triacylglycerols associated with increased cecal lipids was observed in the group fed the diet supplemented with white tea. White tea supplementation also reduced oxidative stress in liver and adipose tissue. In conclusion, white tea extract supplementation (0.5% does not influence body weight or adiposity in obese mice. Its benefits are restricted to the reduction in oxidative stress associated with obesity and improvement of hypertriacylglycerolemia.O chá branco é um chá não fermentando feito a partir de brotos jovens da Camellia sinensis protegidos da luz solar para evitar a degradação de polifenóis. Embora os níveis de catequinas sejam mais elevados que os do chá verde (mesma planta, nenhum estudo foi realizado sobre estresse oxidativo relacionado obesidade. Nosso objetivo foi avaliar o efeito do chá verde na obesidade e suas complicações, usando um modelo de obesidade induzida por dieta. Quarenta camundongos C57BL/6 machos foram alimentados com dieta hiperlipídica para indução da obesidade ou mesma dieta suplementada

  20. Isolation of eugenyl β-primeveroside from Camellia sasanqua and its anticancer activity in PC3 prostate cancer cells

    Directory of Open Access Journals (Sweden)

    Chun-Chieh Wang

    2016-01-01

    Full Text Available Most studies of tea trees have focused on their ornamental properties, there are fewer published studies on their medical values. The purpose of this study was to compare the chemical constituents and the biological potential of the water extract of leaves in eight species of Camellia including Camellia sinensis. Among eight Camellia species, Camellia sasanqua showed potent anticancer activities in prostate cancer PC3 cells. In addition to catechins, the major component, eugenyl β-primeveroside was detected in C. sasanqua. Eugenyl β-primeveroside blocked the progression of cell cycle at G1 phase by inducing p53 expression and further upregulating p21 expression. Moreover, eugenyl β-primeveroside induced apoptosis in PC3 prostate cancer cells. Our results suggest that C. sasanqua may have anticancer potential.

  1. AMIDO RESISTENTE EM FARINHAS DE BANANA VERDE

    Directory of Open Access Journals (Sweden)

    Dayana Portes RAMOS

    2010-03-01

    Full Text Available

    Este trabalho teve por objetivo avaliar o teor de amido resistente (AR em farinhas de banana verde produzidas a partir de treze genótipos de bananeira. Para a produção da farinha foram separadas a 1ª, 3ª e 5ª pencas de cada genótipo, na qual cada penca correspondeu a uma repetição. Os frutos de cada penca no estádio 1 (casca completamente verde de maturação foram descascados manualmente, cortados em fatias circulares de 0,5 cm e desidratados em estufa com circulação de ar a 40ºC por 48 horas, sendo em seguida moídos. A análise de AR consistiu em um processo enzimático, calculando-se o conteúdo final pela concentração de glicose liberada. Os resultados foram submetidos à análise estatística e mostraram diferenças significativas para o teor de AR nas farinhas obtidas dos genótipos de bananeira, sendo que a farinha com maior teor de AR foi a produzida a partir do cultivar ‘Nam’ (40,25% e a menor pelo híbrido ‘Fhia 01’ (10,01%. Pode-se concluir que o conteúdo de AR varia em relação ao genótipo utilizado para a confecção da farinha e que a banana pode ser uma boa opção de estudo de alimento funcional.

  2. The influence of gamma radiation on the aflatoxigenic fungi, phenolics content and antioxidant activity of the green tea; Irradiacao do cha verde para controle de fungos Aspergillus sp.

    Energy Technology Data Exchange (ETDEWEB)

    Lemos, S.G.; Silva, E.B.; Costa, L.F., E-mail: sloana.lemos@gmail.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Energia Nuclear. Centro de Tecnologia e Geociencias; Nascimento, M.S. [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Centro de Ciencias Biologicas. Departamento de Antibioticos; Oliveira, I.S. [Universidade Federal de Pernambuco (CAV/UFPE), Vitoria de Santo Antao, PE (Brazil). Centro Academico de Vitoria

    2013-08-15

    The use of raw plants, including the green tea (Camelia sinensis), has been increasing in Brazil. Along with this increasing tea consumption, there are risks due to its unsuitable handling and storage, which points to the need of controlling possible contaminations. This could be achieved with the use of ionizing radiation. In this context, the present study aimed to evaluate the effect of gamma irradiation over the total phenolics amount, antioxidants and fungic activities of the green tea aqueous extract aiming its processing. Aliquots of the bulk samples have been analyzed before and after gamma irradiation (dosages of 0; 5; 7,5 and 10 kGy). The total phenolics content of the aqueous extracts was determined by using the Folin-Ciocalteu reagent having the catechin as the standard. Those same extracts were used to evaluate its ability of scavenging the free radical DPPH. The microbiological analysis were performed through irradiated samples and control. The results have allowed to check that different dosages of radiation (5; 7,5 e 10 kGy) did not induce significant differences on the content of total phenols and on the antioxidant capacity of the analyzed samples when compared to control. Also, it was also observed that the radiation may have had a catalytic effect on the oxidation of the DPPH and was effective on the microbiological control, even though it was not possible to kill the aflatoxigenic fungus. (author)

  3. Verde Macael: A Serpentinite Wrongly Referred to as a Marble

    OpenAIRE

    Navarro, Rafael; Pereira, Dolores; Gimeno, Ana; Barrio, Santiago

    2013-01-01

    Serpentinites are used in both exterior and interior locations, but not all serpentinites are equal: they vary in physical-mechanical behavior and are not all suitable for similar uses. The serpentinites most commonly used worldwide come from India, Pakistan or Egypt. Spain has traditionally quarried two ultramafic massifs, one in Galicia (Verde Pirineos) and one in Andalucía (Verde Macael). Some of these quarries were small family-run businesses. In both cases, these rocks are commercially a...

  4. Německý Mácha, Óda na radost a krize evropské vize

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Martin Z.

    2013-01-01

    Roč. 31, 97-98 (2013), s. 244-251 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion

  5. Chaînes logistiques et consommation d'énergie : cas du yaourt et du jean

    OpenAIRE

    Rizet , C.; Keita , Basile

    2005-01-01

    Contrat INRETS/ADEME n°: 0203034; Rapport de recherche; Pour analyser l'efficacité énergétique et les émissions de GES des chaînes logistiques, on compare différentes chaînes aboutissant aux mêmes consommateurs. Deux produits sont étudiés : le yaourt, caractéristique de la chaîne du froid et des flux tendus et le blue jean, intégré au marché mondial, tant pour sa matière première principale (le coton) que pour les différentes étapes de sa fabrication. Les chaînes étudiées pour le jean différe...

  6. Chaîne de blocs | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 déc. 2017 ... Des édutiants dans une salle de classe, Tambon Mae La, Myanmar. Zi Jian Lim. La technologie des chaînes de blocs pourrait appuyer et améliorer la gouvernance démocratique et les programmes de développement, mais le degré élevé de sophistication et les exigences complexes du point de vue de ...

  7. Ouro Verde MG 2: nova cultivar de mungo-verde para Minas Gerais Ouro Verde MG 2: new mungbean cultivar for Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Rogério F. Vieira

    2002-03-01

    Full Text Available Dentre várias linhagens introduzidas do "Asian Vegetable Research and Development Center" (AVRDC, sobressaiu a linhagem VC 3984-B-2-B-4-1-B, que recebeu o nome de Ouro Verde MG 2. Suas sementes são verde-brilhantes e o peso de 1000 unidades varia de 43 a 51 g. O início da floração ocorre em torno de 33 dias após a emergência e a primeira vagem madura surge entre 23 e 33 dias. Por se tratar de espécie de maturação desuniforme, podem ser necessárias duas a quatro colheitas. As plantas podem atingir 95 cm de altura. As vagens são marrom-escuras e concentram-se na parte superior da planta. É suscetível a duas doenças que geralmente aparecem no final do ciclo de vida do mungo-verde: míldio-pulverulento (Erysiphe polygoni e mancha-foliar-de-cercospora (Cercospora canescens. A 'Ouro Verde MG 2' é resistente ao acamamento, e o seu rendimento, em três ensaios instalados em dezembro, janeiro e fevereiro, variou de 1,5 a 2,0 t/ha. Esses rendimentos foram, em média, 12% superior ao da cultivar Ouro Verde.Among many accessions introduced from Asian Vegetable Research and Development Center (AVRDC, the VC 3984-B-2-B-4-1-B stood out and was named 'Ouro Verde MG 2'. The seeds are bright green and 1000-seed weight ranges from 43 to 51 g. Flowering starts approximately 33 days after emergence and the first pod ripens between 23 and 33 days later. As mungbean is a non-uniform maturation species, two to four harvests could be necessary. The plant can reach 95 cm high. The pods are dark brown and concentrated in the upper canopy. This cv. is susceptible to two diseases which generally appear late in the crop: powdery mildew (Erysiphe polygoni and cercospora leaf spot (Cercospora canescens. 'Ouro Verde MG 2' is resistant to lodging. The yield measured in three experiments carried out in December, January, and February, ranged from 1.5 to 2.0 t/ha. In average, these yields were 12% superior than the achieved by the cultivar 'Ouro Verde'.

  8. Interaction between the Bacterium Pseudomonas fluorescens strain CHA0, its genetic derivatives and vermiculite: Effects on chemical, mineralogical and mechanical properties of vermiculite

    Science.gov (United States)

    Mueller, Barbara

    2016-04-01

    Using bacteria of the strain Pseudomonas fluorescens wild type CHA0 and its genetic derivative strains CHA77, CHA89, CHA400, CHA631 and CHA661 (which differ in one gene only) the changes in chemical, mineralogical and rheological properties of the clay mineral vermiculite affected by microbial activity were studied in order to test whether the individually different production of metabolites by the genetically engineered strains may alter the clay mineral vermiculite in distinct ways. With the novel strategy of working with living wild type bacteria, their genetic derivatives and clay, the following properties of the mineral altered by the various strains of Pseudomonas fluorescens were determined: grain size, X-Ray diffraction pattern, intercrystalline swelling with glycerol, layer charge, CEC, BET surface and uptake of trace elements. Laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) was used to determine the changes in major, minor and trace elements of the clay vermiculite affected by microbial activity. Among all analyzed trace elements, Fe, Mn and Cu are the most interesting. Fe and Mn are taken up from the clay mineral by all bacterial strains whereas Cu is only removed from vermiculite by strains CHA0, CHA77, CHA400 and CHA661. The latter mentioned strains all produce the antibiotics 2,4-diacetylphloroglucinol and monoacetylphloroglucinol which can complex Cu efficiently. Therefore the alteration of only one gene of the bacteria is causing significant effects on the clay mineral.

  9. Efeitos da utilização do chá verde na saúde humana - doi: 10.5102/ucs.v7i1.882

    Directory of Open Access Journals (Sweden)

    Nayane Lins Saigg

    2009-12-01

    Full Text Available O presente trabalho teve como objetivo investigar os efeitos da utilização do chá verde para saúde humana, levantou os benefícios e malefícios, determinou a relação entre o consumo de chá verde e a prevenção de algumas doenças e o emagrecimento. A metodologia adotada foi uma revisão de literatura, dos últimos dez anos, em livros e artigos de diversos autores que abordam o tema chá verde. Cerca de três mil produtos levam o nome de chá, mas na verdade, podem ser considerados como chás somente aqueles que tenham em sua composição a planta Camellia sinensis, que dá origem ao chá verde. Hoje o chá verde, uma das bebidas estimulantes mais consumidas no mundo, é considerado um alimento funcional, que consumido na alimentação cotidiana pode trazer benefícios fisiológicos à saúde, graças aos seus componentes ativos, como os antioxidantes, flavonóides, catequinas, que atuam na prevenção de doenças e em mecanismos específicos do emagrecimento e manutenção do peso corporal. No entanto sua utilização tem sido bastante questionada, motivando a realização de vários estudos para determinar o verdadeiro efeito do chá no organismo e a dose ideal a ser consumida, para que não acarrete prejuízos à saúde, pois ainda não há comprovação científica sobre os benefícios e malefícios que este alimento possa causar em seus usuários. Os hábitos alimentares vão contribuir para o aparecimento ou não de doenças crônicas, com isso a dieta exerce um papel fundamental na prevenção de doenças e para manutenção do peso, aliado a isso à prática de exercícios físicos, obtendo assim um estilo de vida saudável.

  10. NPDES Permit for Mesa Verde National Park Wastewater Treatment Facility in Colorado

    Science.gov (United States)

    Under NPDES permit number CO-0034398, the United States Department of the Interior, National Park Service, Mesa Verde National Park is authorized to discharge from the Mesa Verde National Park wastewater treatment plant, in Montezuma County, Colo.

  11. Laguna Verde after the extended power increase

    International Nuclear Information System (INIS)

    Herrera C, M. N.; Castaneda G, M. A.; Cardenas J, J. B.; Garcia de la C, F. M.

    2012-10-01

    The project of extended power increase that was implemented in both units of the nuclear power plant of Laguna Verde beginning with the stage feasibility evaluation in nuclear side of the facilities, that is to say the affectation of the power increase in the equipment s, systems and components of the nuclear power plant; besides the feasibility evaluation a study cost-benefit for the rehabilitated and modernization of the equipment s, systems and components of Plant Balance was realized. Once considered technical and economically feasible the project began the engineering evaluations required to carry out the licensing of the new operation conditions, as well as beginning to the elaboration of the technical specifications purchase of the equipment s, systems and components of the Plant Balance. While on one hand was carried out the administration of the licensing of the extended power increase for other was carried out the necessary engineering to make the physical changes in the conventional side of the nuclear power plant. Once concluded the constructive stage beginning the final stage of the project, the starting-up tests, operation and performance of the Units under the new operation conditions. This work describes this last stage that contains the technical base, the realized tests and the obtained results. (Author)

  12. El anillo verde de Vitoria-Gasteiz

    Directory of Open Access Journals (Sweden)

    Marañón, Blanca

    2001-10-01

    de la periferia de la ciudad, donde coexistían zonas de alto valor ecológico sometidas a agresiones de todo tipo, con otros espacios degradados y marginales, fruto de la expansión urbana e industrial. La restauración ecológico-paisajística de estos espacios y su acondicionamiento para el uso público han permitido configurar un "anillo verde multifunción" en torno a la ciudad que está proporcionando importantes beneficios ambientales, sociales y económicos. El anillo verde ha jugado un papel importante en la integración naturaleza-ciudad, equilibrando la oferta de zonas verdes entre todos los barrios y favoreciendo la conexión entre los espacios verdes urbanos y los espacios naturales del entorno agrícola. Ha propiciado, asimismo, el desarrollo de nuevas actividades relacionadas con el ocio y el esparcimiento y con la formación, educación y sensibilización ambiental; actividades que, por un lado, están suponiendo un revulsivo para el sector empresarial ambiental y la integración socio-laboral de determinados colectivos sociales y, por otro, contribuyen a la conservación de estos espacios, al convertirse los usuarios en sus mayores defensores y guardianes. La utilización de algunos de estos espacios como superficies de laminación de agua en épocas de avenidas para solventar problemas de inundación en las zonas industriales es otro ejemplo del valor añadido obtenido al plantear soluciones integrales. Los excelentes resultados obtenidos tras nueve años de trabajo demuestran la viabilidad técnica y económica y la rentabilidad social de este proyecto, que representa una prueba evidente de la decidida voluntad municipal de avanzar hacia un modelo de ciudad sostenible en armonía con el medio natural que la rodea.

  13. Start-up and operation of Laguna Verde-2

    International Nuclear Information System (INIS)

    Torres Ramirez, J.F.

    1996-01-01

    The 665 MWe Laguna Verde-2 nuclear generating unit was accepted into commercial operation on April 10, 1995. The boiling water reactor plant by General Electric (GE) was first synchronized with the grid on November 11, 1994. Laguna Verde-2 is identical with Laguna Verde-1 on the same site. That unit had gone critical for the first time in November 1988 and had first been synchronized with the power grid on April 13, 1989. Commercial operation of Laguna Verde-1 had been started on July 29, 1990. Mexico's only nuclear power plant had been built 70 km north of Veracruz on the east coast and had been scheduled to start operation in 1976. As the Mexican nuclear power program was reduced, the scheduled commissioning dates suffered more and more delays. In the full of 1987, the investigation by the Operational Safety Review Team (Osart) of the International Atomic Energy Agency (IAEA) had indicated that the safety requirements of installations and equpiment were met, and that the whole plant was well prepared for fueling. In mid-1988, the Mexican Government had issued the permit to fuel the Laguna Verde-1 reactor. The contract to build the two units had been awarded in 1972/73. No other nuclear power plants are currently under construction or in the planning phase in Mexico. (orig.) [de

  14. 75 FR 52045 - Arizona Public Service Company, Palo Verde Nuclear Generating Station, Unit 3; Environmental...

    Science.gov (United States)

    2010-08-24

    ... Company, Palo Verde Nuclear Generating Station, Unit 3; Environmental Assessment and Finding of No.... NPF-74, issued to Arizona Public Service Company (APS, the licensee), for operation of Palo Verde... Statement for the Palo Verde Nuclear Generating Station, NUREG-0841, dated February 1982. Agencies and...

  15. 75 FR 47808 - Verde Hydro, LLC; Notice of Preliminary Permit Application Accepted for Filing and Soliciting...

    Science.gov (United States)

    2010-08-09

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13819-000] Verde Hydro, LLC... Intervene, and Competing Applications August 2, 2010. On July 21, 2010, Verde Hydro, LLC filed an... the feasibility of the Verde Hydroelectric Project, located in Maricopa County, in the State of...

  16. 77 FR 9974 - Notice of Entering Into a Compact With the Republic of Cape Verde

    Science.gov (United States)

    2012-02-21

    ... Republic of Cape Verde AGENCY: Millennium Challenge Corporation. ACTION: Notice. SUMMARY: In accordance..., and the Republic of Cape Verde. Representatives of the United States Government and the Republic of Cape Verde executed the Compact documents on February 10, 2012. Dated: February 14, 2012. Melvin F...

  17. Profiling and quantification of phenolic compounds in Camellia seed oils: Natural tea polyphenols in vegetable oil.

    Science.gov (United States)

    Wang, Xiaoqin; Zeng, Qiumei; Del Mar Contreras, María; Wang, Lijuan

    2017-12-01

    In Asia, tea seed oils (seed oils from Camellia oleifera, C. chekiangoleosa, and C. sinensis) are used in edible, medicinal, and cosmetic applications. However, these oils differ in their fatty acid contents, and there is little known about their phenolic compounds. Here we analyzed the phenolic compounds of seed oils from three species gathered from 15 regions of China. Twenty-four phenolic compounds were characterized by HPLC-Q-TOF-MS, including benzoic acids (6), cinnamic acids (6), a hydroxyphenylacetic acid, flavanols (4), flavonols (3), flavones (2), and dihydroflavonoids (2). Some of these phenolic compounds had not previously been reported from C. sinensis (20), C. oleifera (15), and C. chekiangoleosa (24) seed oils. Quantification was done by HPLC-QqQ-MS using 24 chemical standards. The total concentrations in the studied samples ranged from 20.56 to 88.56μg/g. Phenolic acids were the most abundant class, accounting for 76.2-90.4%, with benzoic acid, found at up to 18.87μg/g. The concentration of catechins, typical of tea polyphenols, ranged between 2.1% and 9.7%, while the other flavonoids varied from 4.2% to 17.8%. Although the cultivation region affected the phenolic composition of the Camellia seed oils, in our hierarchical clustering analysis, the samples clustered according to species. The phenolic composition of the seed oils from C. oleifera and C. chekiangoelosa were similar. We found that the phenolic categories in Camellia seed oils were similar to tea polyphenols, thereby identifying a source of liposoluble tea polyphenols and potentially accounting for some of the reported activities of these oils. In addition, this work provides basic data that allows distinction of various Camellia seed oils, as well as improvements to be made in their quality standards. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. De novo Assembly of the Camellia nitidissima Transcriptome Reveals Key Genes of Flower Pigment Biosynthesis

    Directory of Open Access Journals (Sweden)

    Xingwen Zhou

    2017-09-01

    Full Text Available The golden camellia, Camellia nitidissima Chi., is a well-known ornamental plant that is known as “the queen of camellias” because of its golden yellow flowers. The principal pigments in the flowers are carotenoids and flavonol glycosides. Understanding the biosynthesis of the golden color and its regulation is important in camellia breeding. To obtain a comprehensive understanding of flower development in C. nitidissima, a number of cDNA libraries were independently constructed during flower development. Using the Illumina Hiseq2500 platform, approximately 71.8 million raw reads (about 10.8 gigabase pairs were obtained and assembled into 583,194 transcripts and 466, 594 unigenes. A differentially expressed genes (DEGs and co-expression network was constructed to identify unigenes correlated with flower color. The analysis of DEGs and co-expressed network involved in the carotenoid pathway indicated that the biosynthesis of carotenoids is regulated mainly at the transcript level and that phytoene synthase (PSY, β -carotene 3-hydroxylase (CrtZ, and capsanthin synthase (CCS1 exert synergistic effects in carotenoid biosynthesis. The analysis of DEGs and co-expressed network involved in the flavonoid pathway indicated that chalcone synthase (CHS, naringenin 3-dioxygenase (F3H, leucoanthocyanidin dioxygenase(ANS, and flavonol synthase (FLS play critical roles in regulating the formation of flavonols and anthocyanidin. Based on the gene expression analysis of the carotenoid and flavonoid pathways, and determinations of the pigments, we speculate that the high expression of PSY and CrtZ ensures the production of adequate levels of carotenoids, while the expression of CHS, FLS ensures the production of flavonols. The golden yellow color is then the result of the accumulation of carotenoids and flavonol glucosides in the petals. This study of the mechanism of color formation in golden camellia points the way to breeding strategies that exploit gene

  19. Antiatherogenic Effect of Camellia japonica Fruit Extract in High Fat Diet-Fed Rats

    OpenAIRE

    Lee, Hyun-Ho; Paudel, Keshav Raj; Jeong, Jieun; Wi, An-Jin; Park, Whoa-Shig; Kim, Dong-Wook; Oak, Min-Ho

    2016-01-01

    Hypercholesterolemia is a well-known etiological factor for cardiovascular disease and a common symptom of most types of metabolic disorders. Camellia japonica is a traditional garden plant, and its flower and seed have been used as a base oil of traditional cosmetics in East Asia. The present study was carried out to evaluate the effect of C. japonica fruit extracts (CJF) in a high fat diet- (HFD-) induced hypercholesterolemic rat model. CJF was administered orally at three different doses: ...

  20. Production of secondary metabolites trimethyl xanthina by Camellia sinensis L suspension culture

    Science.gov (United States)

    Sutini, Sodiq, Mochamad; Muslihatin, Wirdhatul; Indra, Mochamad Rasjad

    2017-06-01

    Bioactive trimethyl xanthina can be obtained from the plant Camellia sinensis L. To obtain bioactive plant of which there are several hurdles for instance to wait up to five years to be harvested, also it needs land at a certain height from the sea level. Therefore, the production of secondary metabolites trimethyl xanthina need to be developed with suspense culture techniques. The purpose of this study obtained the production of bioactive trimethyl xanthina way culturally suspense in large scale with a relatively short time, potentially as anti-oxidants. Research methods include: (1) initiation of callus from pieces of leaves, shoots the youngest of the plant Camellia sinensis L in the media MS with the optimization of the addition of growth regulators, (2) the subculture of callus on media and plant growth regulator that is equal to the stage of initiation, (3) initiation of suspension culture using explants of callus Camellia sinensis L, (4) Analysis of secondary metabolites trimethyl xanthina growth in suspension culture, (5) the isolation and identification of trimethyl xanthina qualitatively and quantitatively using thin layer chromatography/high performance chromatography column. The results of the study suspension cultures containing bioactive trimethyl xanthina candidates that can be used as an antioxidant.

  1. Antioxidant, Anti-Tyrosinase and Anti-Inflammatory Activities of Oil Production Residues from Camellia tenuifloria

    Directory of Open Access Journals (Sweden)

    Shu-Yuan Chiou

    2015-12-01

    Full Text Available Camellia tenuifloria is an indigenous Camellia species used for the production of camellia oil in Taiwan. This study investigated for the first time the potential antioxidant, anti-tyrosinase and anti-inflammatory activities of oil production byproducts, specifically those of the fruit shell, seed shell, and seed pomace from C. tenuifloria. It was found that the crude ethanol extract of the seed shell had the strongest DPPH scavenging and mushroom tyrosinase inhibitory activities, followed by the fruit shell, while seed pomace was the weakest. The IC50 values of crude extracts and fractions on monophenolase were smaller than diphenolase. The phenolic-rich methanol fraction of seed shell (SM reduced nitric oxide (NO production, and inducible nitric oxide synthase (iNOS expression in lipopolysaccharide (LPS-stimulated RAW 264.7 cells. It also repressed the expression of IL-1β, and secretion of prostaglandin E2 (PGE2 and IL-6 in response to LPS. SM strongly stimulated heme oxygenase 1 (HO-1 expression and addition of zinc protoporphyrin (ZnPP, a HO-1 competitive inhibitor, reversed the inhibition of NO production, indicating the involvement of HO-1 in its anti-inflammatory activity. The effects observed in this study provide evidence for the reuse of residues from C. tenuifloria in the food additive, medicine and cosmetic industries.

  2. The protective ability of Camellia meal extract on the silk protein

    Science.gov (United States)

    Weng, JZ; Cai, C.; Zhang, DY; Dai, BK

    2018-02-01

    With the enhancement of living standards, people pay more and more attention to the health. The edible oil become more and more popular, but also produced a large amount of Camellia meal which can not fully put into utilization. In this study, the extracting liquid of Camellia meal was used on the process of silk degumming. Firstly, tussah silk was treated by degumming in the Na2CO3 solution, and the preliminary condition of tussah silk degumming was obtained by orthogonal experiment: the concentration Na2CO3 was 0.1%, the degumming time was 1 hour, and the ratio of silk/water was 40:1. Then the extract of Camellia meal (GCJSY) was added before the bleaching process of tussah silk to investigate the protective ability of GCJSY on the silk protein basry on the residual ratio of the silk. While the concentration of GYJSY was 0.08%, the residual ratio of silk after degumming in the Na2CO3 solution and bleaching in the 2% H2O2 solution was 87.2%.

  3. Anti-Inflammatory and Analgesic Activities of a Novel Biflavonoid from Shells of Camellia oleifera

    Directory of Open Access Journals (Sweden)

    Yong Ye

    2012-09-01

    Full Text Available Shells are by-products of oil production from Camellia oleifera which have not been harnessed effectively. The purpose of this research is to isolate flavonoid from shells of Camellia oleifera and evaluate its anti-inflammatory and analgesic effects. The flavonoid was identified as bimolecular kaempferol structure by UV, MS, 1H NMR and 13C NMR spectra, which is a new biflavonoid and first found in Camellia oleifera. It showed dose-dependent anti-inflammatory activity by carrageenin-induced paw oedema in rats and croton oil induced ear inflammation in mice, and analgesic activity by hot plate test and acetic acid induced writhing. The mechanism of anti-inflammation of biflavonoid is related to both bradykinin and prostaglandins synthesis inhibition. The biflavonoid showed both central and peripheral analgesic effects different from aspirin, inhibition of the synthesis or action of prostaglandins may contribute to analgesic effect of biflavonoid. The biflavonoid significantly decreased malonaldehyde (MDA and increased superoxidase dismutase (SOD and Glutathione peroxidase (GSH-Px activity in serum (p < 0.01, revealed strong free radical scavenging activity in vivo. It indicates the biflavonoid can control inflammation and pain by eliminating free radical so as to inhibit the mediators and decrease the prostaglandins. The biflavonoid can be used as a prospective medicine for inflammation and pain.

  4. The nematicidal effect of camellia seed cake on root-knot nematode Meloidogyne javanica of banana.

    Directory of Open Access Journals (Sweden)

    Xiujuan Yang

    Full Text Available Suppression of root-knot nematodes is crucially important for maintaining the worldwide development of the banana industry. Growing concerns about human and environmental safety have led to the withdrawal of commonly used nematicides and soil fumigants, thus motivating the development of alternative nematode management strategies. In this study, Meloidogyne javanica was isolated, and the nematicidal effect of Camellia seed cake on this pest was investigated. The results showed that in dish experiments, Camellia seed cake extracts under low concentration (2 g/L showed a strong nematicidal effect. After treatment for 72 h, the eggs of M. javanica were gradually dissolved, and the intestine of the juveniles gradually became indistinct. Nematicidal compounds, including saponins identified by HPLC-ESI-MS and 8 types of volatile compounds identified by GC-MS, exhibited effective nematicidal activities, especially 4-methylphenol. The pot experiments demonstrated that the application of Camellia seed cake suppressed M. javanica, and promoted the banana plant growth. This study explored an effective nematicidal agent for application in soil and revealed its potential mechanism of nematode suppression.

  5. Sphingoid bases and the serine catabolic enzyme CHA1 define a novel feedforward/feedback mechanism in the response to serine availability.

    Science.gov (United States)

    Montefusco, David J; Newcomb, Benjamin; Gandy, Jason L; Brice, Sarah E; Matmati, Nabil; Cowart, L Ashley; Hannun, Yusuf A

    2012-03-16

    Targets of bioactive sphingolipids in Saccharomyces cerevisiae were previously identified using microarray experiments focused on sphingolipid-dependent responses to heat stress. One of these heat-induced genes is the serine deamidase/dehydratase Cha1 known to be regulated by increased serine availability. This study investigated the hypothesis that sphingolipids may mediate the induction of Cha1 in response to serine availability. The results showed that inhibition of de novo synthesis of sphingolipids, pharmacologically or genetically, prevented the induction of Cha1 in response to increased serine availability. Additional studies implicated the sphingoid bases phytosphingosine and dihydrosphingosine as the likely mediators of Cha1 up-regulation. The yeast protein kinases Pkh1 and Pkh2, known sphingoid base effectors, were found to mediate CHA1 up-regulation via the transcription factor Cha4. Because the results disclosed a role for sphingolipids in negative feedback regulation of serine metabolism, we investigated the effects of disrupting this mechanism on sphingolipid levels and on cell growth. Intriguingly, exposure of the cha1Δ strain to high serine resulted in hyperaccumulation of endogenous serine and in turn a significant accumulation of sphingoid bases and ceramides. Under these conditions, the cha1Δ strain displayed a significant growth defect that was sphingolipid-dependent. Together, this work reveals a feedforward/feedback loop whereby the sphingoid bases serve as sensors of serine availability and mediate up-regulation of Cha1 in response to serine availability, which in turn regulates sphingolipid levels by limiting serine accumulation.

  6. Antinociceptive activity of fruits extracts and "arrope" of Geoffroea decorticans (chañar).

    Science.gov (United States)

    Reynoso, M A; Vera, N; Aristimuño, M E; Daud, A; Sánchez Riera, A

    2013-01-09

    Geoffroea decorticans (chañar) fruits and their derivate product (arrope) have been traditionally used as food and a folk medicine for the treatment of a wide variety of diseases including bronchopulmonary disorders and to relieve dolorous process. In order to evaluate the pharmacology action of this plant, studies were performed of antinociceptive and antioxidant activities. The aqueous and ethanolic extracts and arrope of chañar were evaluated in various established pain models, including chemical nociception induced by subplantar formalin and intraperitoneal acetic acid and thermal nociception method, such as tail immersion test in rats. To examine the possible connection of the opioid receptor to the antinociceptive activity of extracts and arrope it was performed a combination test with naloxone, a non-selective opioid receptor antagonist. The aqueous extract and arrope (1000 mg/kg) caused an inhibition of the pain in formalin test in the first phase, similar to morphine and decrease in the second phase. In a combination test using naloxone, diminished analgesic activity of aqueous extract and arrope were observed, indicating that antinociceptive activity is connected with the opioid receptor. The aqueous extract and arrope, caused an inhibition of the writhing response induced by acetic acid. Central involvement in analgesic profile was confirmed by the tail immersion test, in which the aqueous extract and arrope showed a significant analgesic activity by increasing latency time. The aqueous extract showed higher antioxidant activity than the arrope, it may be due to the cooking process. This study has shown that the aqueous extract and arrope of Geoffroea decorticans (chañar) fruits, does possess significant antinociceptive effects. It is further concluded that aqueous extract with maximum inhibition of free radical is the most potent extract amount tested extracts. At the oral doses tested the aqueous extract and arrope were non-toxic. The present

  7. The Chaîne des Puys: how complicated can monogentic get?

    Science.gov (United States)

    Van Wyk de Vries, B.; Grosse, P.; Marquez, A.; Petronis, M. S.; Kervyn, M.; Delcamp, A.; Mossoux, S.; Troll, V. R.

    2012-12-01

    The Chaîne des Puys (Massif Centrale of France) is part of a prospective volcano-tectonic UNESCO World Heritage site including the Limagne Rift fault (http://www.chainedespuys-failledelimagne.com/). The strategy is to present the monogentic field that is as representative of other such fields, but which itself is uniquely special. Effectively, the Chaîne des Puys would become a sort of ambassador for monogentic volcanism, raising the profile of all other sites. Here, I want to go through some recent work on the chain, looking at morphology, morphometry, structure, lithology and petrology and show some of the intriguing complexities of this classic highly variable monogentic alignment. Also, I want to build on the historical development of ideas that can be traced back to characters such as Montlosier, Humphrey Davey, Faraday, Lyell, and Von Humbolt... and many more. I focus, first, on the central the Puy de Dôme. This classic trachyte dome has been known for some time to be the product of two eruptions, and recently we have found that it is related to a number of cryptodome intrusions that have created flanking bulges, fed at least two major explosive eruptions, and extensively modified the topography of the field. Strangely, Von Humbolt's concept of 'craters of elevation' rises up in a reanalysis of these structures. Secondly, I visit Lemptégy (www.auvergne-volcan.com/), that in 1857, Scrope called 'an insignificant cone grazed by sheep', but now quarried out and showing the internal structure expected for the Puy de Dôme bulges, as well as illustrating that a seemingly simple scoria cone plumbing can be infernally complicated. Thirdly, I consider the Beaunit, a bucolic village in a maar, where the process of crustal ingestion suggests an intimate relationship between eruptive dynamics and assimilation. With these three examples I show some of the complications and interactions of monogentic basaltic to trachytic volcanism typified by the Chaîne des Puys.

  8. Evaluation of the Anxiolytic and Antidepressant Activities of the Aqueous Extract from Camellia euphlebia Merr. ex Sealy in Mice

    Directory of Open Access Journals (Sweden)

    Dongye He

    2015-01-01

    Full Text Available Camellia euphlebia Merr. ex Sealy is a traditional Chinese medicine that has been widely used for improvement of human emotions in the Guangxi Province of southern China. However, there are no studies about the anxiolytic and antidepressant activities of Camellia euphlebia. This study evaluated the anxiolytic and antidepressant activities of the aqueous extract from Camellia euphlebia (CEE in mice. We found that administration of 400 mg/kg CEE or 20 mg/kg fluoxetine for 7 days significantly reduced the immobility time in both TST and FST. Oral administration of 100 mg/kg extract or 4 mg/kg diazepam for 7 days significantly increased the percentage of time spent and the number of entries into the open arms of the EPMT. In addition, the time spent by mice in the illuminated side of the LDBT was increased. Furthermore, pretreatment with 400 mg/kg CEE for 7 days significantly elevated the level of 5-HT and DA in the whole brain of mice. These results provide support for the potential anxiolytic and antidepressant activity of Camellia euphlebia and contribute towards validation of the traditional use of Camellia euphlebia in the treatment of emotional disorders.

  9. Camellia oleifera shell as an alternative feedstock for furfural production using a high surface acidity solid acid catalyst.

    Science.gov (United States)

    Zhang, Luxin; He, Yunfei; Zhu, Yujie; Liu, Yuting; Wang, Xiaochang

    2018-02-01

    This paper focuses on the high-value transformation of camellia oleifera shell, which is an agricultural waste enriched in hemicellulose. An efficient catalytic route employing sulfonated swelling mesoporous polydivinylbenzene (PDVB-SO 3 H) as catalyst in monophasic or biphasic solvents was developed for the conversion of raw camellia oleifera shell into furfural. The reaction parameters were evaluated and optimized for improving the furfural yield. It was found that the solvent greatly influenced the hydrolysis of camellia oleifera shells, and the highest furfural yield of 61.3% was obtained in "γ-butyrolactone + water" system when the feedstock-to-catalyst ratio was 2 for 30 min at 443 K. Camellia oleifera shell exhibited a high potential as feedstock to produce furfural in high yields. The outcome of this study provides an attractive utilization option to camellia oleifera shell, which is currently burned or discarded for producing a bio-based chemical. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Clima, cultura y disponibilidad de espacios verdes urbanos

    OpenAIRE

    Sierra, Eduardo Mario; Pérez, Silvia Patricia; Nizzero, Gustavo Raúl

    2002-01-01

    p.165-171 El rápido crecimiento urbano mundial hace que la calidad de vida dependa cada vez más de la disponibilidad de espacios verdes. Este trabajo trata de relacionar la disponibilidad de espacios verdes urbanos públicos con los factores climáticos y culturales. Las ciudades del Hemisferio Norte en países de cultura europea, donde se llevan a cabo programas de sustentabilidad muestran mayores disponibilidades lo cual refleja el impacto de los factores culturales. Desde el punto de vista...

  11. Strategic Analysis for the MER Cape Verde Approach

    Science.gov (United States)

    Gaines, Daniel; Belluta, Paolo; Herman, Jennifer; Hwang, Pauline; Mukai, Ryan; Porter, Dan; Jones, Byron; Wood, Eric; Grotzinger, John; Edgar, Lauren; hide

    2009-01-01

    The Mars Exploration Rover Opportunity has recently completed a two year campaign studying Victoria Crater. The campaign culminated in a close approach of Cape Verde in order to acquire high resolution imagery of the exposed stratigraphy in the cliff face. The close approach to Cape Verde provided significant challenges for every subsystem of the rover as the rover needed to traverse difficult, uncharacterised terrain and approach a cliff face with the potential of blocking out solar energy and communications with Earth. In this paper we describe the strategic analyses performed by the science and engineering teams so that we could successfully achieve the science objectives while keeping the rover safe.

  12. Comments About The New Rhetoric Theory Of Chaïm Perelman

    Directory of Open Access Journals (Sweden)

    Veronica Calado

    2016-11-01

    Full Text Available This essay pretends to demonstrate how the issue of the interpretation of legal norms was treated in the New Rhetoric of Chaïm Perelman. The theory emerged in the 1950´s criticizing juridical positivism and bringing back the possibility of reinsertion of valuational matters in the application of the law. With the scope of not compromising legal predictability, notions like equity and reasonability where hitched to the concept. Furthermore, the essay aimed, with the collation of literary works about the theme, to analyze the possibility of applying the New Rhetoric theory in the Brazilian Legal Order, The method utilized was the critic- deductive.

  13. Identification of Cha o 3 homolog Cry j 4 from Cryptomeria japonica (Japanese cedar) pollen: Limitation of the present Japanese cedar-specific ASIT.

    Science.gov (United States)

    Osada, Toshihiro; Tanaka, Yuki; Yamada, Akira; Sasaki, Eiji; Utsugi, Teruhiro

    2018-03-07

    About one-third of the Japanese population suffers from Japanese cedar pollinosis, which is frequently accompanied by Japanese cypress pollinosis. Recently, a novel major Japanese cypress pollen allergen, Cha o 3, was discovered. However, whether a Cha o 3 homolog is present in Japanese cedar pollen remains to be determined. Western blot analysis was performed using Cha o 3-specific antiserum. In addition, cloning of the gene encoding Cry j 4 was conducted using total cDNA from the male flower of Japanese cedar trees. Allergen potency and cross-reactivity were investigated using a T-cell proliferation assay, basophil activation test, and ImmunoCAP inhibition assay. A low amount of Cha o 3 homolog protein was detected in Japanese cedar pollen extract. The deduced amino acid sequence of Cry j 4 showed 84% identity to that of Cha o 3. Cross-reactivity between Cry j 4 and Cha o 3 was observed at the T cell and IgE levels. Cry j 4 was discovered as a counterpart allergen of Cha o 3 in Japanese cedar pollen, with a relationship similar to that between Cry j 1-Cha o 1 and Cry j 2-Cha o 2. Our findings also suggest that allergen-specific immunotherapy (ASIT) using Japanese cedar pollen extract does not induce adequate immune tolerance to Cha o 3 due to the low amount of Cry j 4 in Japanese cedar pollen. Therefore, ASIT using Cha o 3 or cypress pollen extract coupled with Japanese cedar pollen extract is required in order to optimally control allergy symptoms during Japanese cypress pollen season. Copyright © 2018 Japanese Society of Allergology. Production and hosting by Elsevier B.V. All rights reserved.

  14. Supplementation with different teas from Camellia sinensis prevents memory deficits and hippocampus oxidative stress in ischemia-reperfusion.

    Science.gov (United States)

    Martins, Alexandre; Schimidt, Helen L; Garcia, Alexandre; Colletta Altermann, Caroline Dalla; Santos, Francielli W; Carpes, Felipe P; da Silva, Weber Cláudio; Mello-Carpes, Pâmela B

    2017-09-01

    Memory and cognition impairments resultant of ischemic stroke could be minimized or avoided by antioxidant supplementation. In this regard, the neuroprotective potential of Green tea from Camellia sinensis has been investigated. However, there is a lack of information regarding the neuroprotective potential of others teas processed from the Camellia sinensis. Here we investigate the neuroprotective role of green, red, white and black tea on memory deficits and brain oxidative stress in a model of ischemic stroke in rats. Our findings show that green and red teas prevent deficits in object and social recognition memories, but only green tea protects against deficits in spatial memory and avoids hippocampal oxidative status and intense necrosis and others alterations in the brain tissue. In summary, green tea shows better neuroprotection in ischemic stroke than the others teas from Camellia sinensis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. A likely planet-induced gap in the disc around T Cha

    Science.gov (United States)

    Hendler, Nathanial P.; Pinilla, Paola; Pascucci, Ilaria; Pohl, Adriana; Mulders, Gijs; Henning, Thomas; Dong, Ruobing; Clarke, Cathie; Owen, James; Hollenbach, David

    2018-03-01

    We present high-resolution (0.11 × 0.06 arcsec2) 3 mm ALMA observations of the highly inclined transition disc around the star T Cha. Our continuum image reveals multiple dust structures: an inner disc, a spatially resolved dust gap, and an outer ring. When fitting sky-brightness models to the real component of the 3 mm visibilities, we infer that the inner emission is compact (≤1 au in radius), the gap width is between 18 and 28 au, and the emission from the outer ring peaks at ˜36 au. We compare our ALMA image with previously published 1.6 μm VLT/SPHERE imagery. This comparison reveals that the location of the outer ring is wavelength dependent. More specifically, the peak emission of the 3 mm ring is at a larger radial distance than that of the 1.6 μm ring, suggesting that millimeter-sized grains in the outer disc are located farther away from the central star than micron-sized grains. We discuss different scenarios to explain our findings, including dead zones, star-driven photoevaporation, and planet-disc interactions. We find that the most likely origin of the dust gap is from an embedded planet, and estimate - for a single planet scenario - that T Cha's gap is carved by a 1.2MJup planet.

  16. A gacS deletion in Pseudomonas aeruginosa cystic fibrosis isolate CHA shapes its virulence.

    Directory of Open Access Journals (Sweden)

    Khady Mayebine Sall

    Full Text Available Pseudomonas aeruginosa, a human opportunistic pathogen, is capable of provoking acute and chronic infections that are associated with defined sets of virulence factors. During chronic infections, the bacterium accumulates mutations that silence some and activate other genes. Here we show that the cystic fibrosis isolate CHA exhibits a unique virulence phenotype featuring a mucoid morphology, an active Type III Secretion System (T3SS, hallmark of acute infections, and no Type VI Secretion System (H1-T6SS. This virulence profile is due to a 426 bp deletion in the 3' end of the gacS gene encoding an essential regulatory protein. The absence of GacS disturbs the Gac/Rsm pathway leading to depletion of the small regulatory RNAs RsmY/RsmZ and, in consequence, to expression of T3SS, while switching off the expression of H1-T6SS and Pel polysaccharides. The CHA isolate also exhibits full ability to swim and twitch, due to active flagellum and Type IVa pili. Thus, unlike the classical scheme of balance between virulence factors, clinical strains may adapt to a local niche by expressing both alginate exopolysaccharide, a hallmark of membrane stress that protects from antibiotic action, host defences and phagocytosis, and efficient T3S machinery that is considered as an aggressive virulence factor.

  17. Extracellular Protease of Pseudomonas fluorescens CHA0, a Biocontrol Factor with Activity against the Root-Knot Nematode Meloidogyne incognita

    OpenAIRE

    Siddiqui, Imran Ali; Haas, Dieter; Heeb, Stephan

    2005-01-01

    In Pseudomonas fluorescens CHA0, mutation of the GacA-controlled aprA gene (encoding the major extracellular protease) or the gacA regulatory gene resulted in reduced biocontrol activity against the root-knot nematode Meloidogyne incognita during tomato and soybean infection. Culture supernatants of strain CHA0 inhibited egg hatching and induced mortality of M. incognita juveniles more strongly than did supernatants of aprA and gacA mutants, suggesting that AprA protease contributes to biocon...

  18. Extracellular Protease of Pseudomonas fluorescens CHA0, a Biocontrol Factor with Activity against the Root-Knot Nematode Meloidogyne incognita

    Science.gov (United States)

    Siddiqui, Imran Ali; Haas, Dieter; Heeb, Stephan

    2005-01-01

    In Pseudomonas fluorescens CHA0, mutation of the GacA-controlled aprA gene (encoding the major extracellular protease) or the gacA regulatory gene resulted in reduced biocontrol activity against the root-knot nematode Meloidogyne incognita during tomato and soybean infection. Culture supernatants of strain CHA0 inhibited egg hatching and induced mortality of M. incognita juveniles more strongly than did supernatants of aprA and gacA mutants, suggesting that AprA protease contributes to biocontrol. PMID:16151170

  19. Period changes of cataclysmic variables below the period gap: V2051 Oph, OY Car and Z Cha

    Science.gov (United States)

    Pilarčík, L.; Wolf, M.; Zasche, P.; Vraštil, J.

    2018-04-01

    We present our results of a long-term monitoring of cataclysmic variable stars (CVs). About 40 new eclipses were measured for the three southern SU UMa-type eclipsing CVs: V2051 Oph, OY Car and Z Cha. Based on the current O - C diagrams we confirmed earlier findings that V2051 Oph and OY Car present cyclic changes of their orbital periods lasting 25 and 29 years, respectively. In case of Z Cha we propose the light-time effect caused probably by a presence of the third component orbiting the eclipsing CV with the period of 43.5 years. The minimal mass of this companion results about 15 MJup.

  20. Transient analysis for Laguna Verde nuclear power plant

    International Nuclear Information System (INIS)

    Ramos Pablos, J.C. et.al.

    1991-01-01

    Relationship between transients analysis and safety of Laguna Verde nuclear power plant is described a general panorama of safety thermal limits of a nuclear station, as well as transients classification and events simulation codes are exposed. Activities of a group of transients analysis of electrical research institute are also mentioned (Author)

  1. Verde Valley Community Needs Assessment Project, Spring 1979.

    Science.gov (United States)

    Gose, Frank J.

    A study of the educational needs to be met by the Verde Campus of Yavapai College (YC) involved surveying seven populations. Responses were returned by 88 non-retired community residents, 96 retired members of the community, 191 members of the business sector, 240 current students, 208 former students, 19 faculty members, and 261 high school…

  2. Prefabricated solution to modular construction in Cape Verde

    Science.gov (United States)

    Vieira, Nuno; Amado, Miguel; Pinho, Fernando

    2017-02-01

    Nowadays, the lack of adequate housing in Cape Verde is a growing problem. The migration of the population living in the countryside to the major cities generates an increase of the diameter of the cities. With the lack of economic power, the migrating families tend to occupy the land with houses which don't present proper conditions to living. Praia is the capital of Cape Verde and so on the biggest city of the country. This fact leads Praia to being the city with major economic power and job offer in all country. Consequently, Praia has developed the biggest slum of the Cape Verde and it is urgent to approach this problem in order to create solutions that reveal capacity to start solving it. Cape Verde's unique dry subtropical climate turns indispensable a careful resolution of the housing, in order to ensure the comfort of the occupants. The modular construction is a solution with potential to approach this problem with a fast and economic response. In order to answer the situation, this article introduces a modular solution in order to reach the needing of thermal comfort to the specific case of Praia.

  3. Paso del Aguilo : Jarre de type Rio Verde Poli

    OpenAIRE

    Michelet , Dominique

    1981-01-01

    Zone IV, site n°2. Las Colaciones, Paso del Aguila, municipio Armadillo, San Luis Potosi.Jarre à deux petites anses latérales sous le col, du type Rio Verde Poli. Engobe brun-beige poli. Hauteur totale 13 centimètres. Collection particulière Paso del Aguila.

  4. Nectar properties and the role of sunbirds as pollinators of the golden-flowered tea (Camellia petelotii).

    Science.gov (United States)

    Sun, Shi-Guo; Huang, Zhi-Huan; Chen, Zhi-Bao; Huang, Shuang-Quan

    2017-03-01

    Properties of floral nectar have been used to predict if a plant species is pollinated by birds. To see whether winter-flowering plants evolve nectar properties corresponding to bird pollinators, nectar properties of several Camellia species (including the golden-flowered tea), as well as the role of floral visitors as effective pollinators, were examined. Potential pollinators of Camellia petelotii were identified at different times of day and under various weather conditions. A bird exclusion experiment was used to compare the pollination effectiveness of birds and insects. Nectar sugar components (fructose, glucose, and sucrose) from C. petelotii growing wild and another seven Camellia species and 22 additional cultivars (all in cultivation) were examined by high-performance liquid chromatography (HPLC). The sunbird Aethopyga siparaja and honeybees were the most frequent floral visitors to C. petelotii . Honeybee visits were significantly reduced in cloudy/rainy weather. The fruit and seed set of flowers with birds excluded were reduced by 64%, indicating that bird pollination is significant. For the wild populations of C. petelotii , a bagged flower could secrete 157 μL nectar; this nectar has a low sugar concentration (19%) and is sucrose-dominant (87%). The eight Camellia species and 22 cultivars had an average sugar concentration of around 30% and a sucrose concentration of 80%, demonstrating sucrose-dominant nectar in Camellia species. The nectar sugar composition of Camellia species was characterized by sucrose dominance. In addition, the large reduction in seed set when birds are excluded in the golden-flowered tea also supports the suggestion that these winter-flowering plants may have evolved with birds as significant pollinators. © 2017 Botanical Society of America.

  5. The value of the CHA2DS2-VASc score for refining stroke risk stratification in patients with atrial fibrillation with a CHADS2 score 0-1

    DEFF Research Database (Denmark)

    Olesen, Jonas Bjerring; Torp-Pedersen, Christian; Hansen, Morten Lock

    2012-01-01

    associated with increasing CHA2DS2-VASc score was estimated in Cox regression models adjusted for year of inclusion and antiplatelet therapy. The value of adding the extra CHA2DS2-VASc risk factors to the CHADS2 score was evaluated by c-statistics, Net Reclassification Improvement (NRI) and Integrated......DS2-VASc score significantly improved the predictive value of the CHADS2 score alone and a CHA2DS2-VASc score=0 could clearly identify 'truly low risk' subjects. Use of the CHA2DS2-VASc score would significantly improve classification of AF patients at low and intermediate risk of stroke, compared......North American and European guidelines on atrial fibrillation (AF) are conflicting regarding the classification of patients at low/intermediate risk of stroke. We aimed to investigate if the CHA2DS2-VASc score improved risk stratification of AF patients with a CHADS2 score of 0-1. Using individual...

  6. Investigation of free amino acid, total phenolics, antioxidant activity and purine alkaloids to assess the health properties of non-Camellia tea

    Directory of Open Access Journals (Sweden)

    Wu Bi

    2016-03-01

    Full Text Available To find novel functional beverages from folk teas, 33 species of frequently used non-Camellia tea (plants other than Camellia were collected and compared with Camellia tea (green tea, pu-erh tea and black tea for the first time. Data are reported here on the quantities of 20 free amino acids (FAAs and three purine alkaloids (measured by UHPLC, total polyphenols (measured by Folin-Ciocalteu assay, and antioxidant activity (DPPH. The total amounts of FAAs in non-Camellia tea (0.62–18.99 mg/g are generally less than that of Camellia tea (16.55–24.99 mg/g. However, for certain FAAs, the quantities were much higher in some non-Camellia teas, such as γ-aminobutyric acid in teas from Ampelopsis grossedentata, Isodon serra and Hibiscus sabdariffa. Interestingly, theanine was detected in tea from Potentilla fruticosa (1.16±0.81 mg/g. Furthermore, the content of polyphenols in teas from A. grossedentata, Acer tataricum subsp. ginnala are significantly higher than those from Camellia tea; teas from I. serra, Pistacia chinensis and A. tataricum subsp. ginnala have remarkable antioxidant activities similar to the activities from green tea (44.23 μg/mL. Purine alkaloids (caffeine, theobromine and theophylline were not detected in non-Camellia teas. The investigation suggest some non-Camellia teas may be great functional natural products with potential for prevention of chronic diseases and aging, by providing with abundant polyphenols, antioxidants and specific FAAs.

  7. Investigation of free amino acid, total phenolics, antioxidant activity and purine alkaloids to assess the health properties of non-Camellia tea.

    Science.gov (United States)

    Bi, Wu; He, Chunnian; Ma, Yunyun; Shen, Jie; Zhang, Linghua Harris; Peng, Yong; Xiao, Peigen

    2016-03-01

    To find novel functional beverages from folk teas, 33 species of frequently used non-Camellia tea (plants other than Camellia) were collected and compared with Camellia tea (green tea, pu-erh tea and black tea) for the first time. Data are reported here on the quantities of 20 free amino acids (FAAs) and three purine alkaloids (measured by UHPLC), total polyphenols (measured by Folin-Ciocalteu assay), and antioxidant activity (DPPH). The total amounts of FAAs in non-Camellia tea (0.62-18.99 mg/g) are generally less than that of Camellia tea (16.55-24.99 mg/g). However, for certain FAAs, the quantities were much higher in some non-Camellia teas, such as γ-aminobutyric acid in teas from Ampelopsis grossedentata, Isodon serra and Hibiscus sabdariffa. Interestingly, theanine was detected in tea from Potentilla fruticosa (1.16±0.81 mg/g). Furthermore, the content of polyphenols in teas from A. grossedentata, Acer tataricum subsp. ginnala are significantly higher than those from Camellia tea; teas from I. serra, Pistacia chinensis and A. tataricum subsp. ginnala have remarkable antioxidant activities similar to the activities from green tea (44.23 μg/mL). Purine alkaloids (caffeine, theobromine and theophylline) were not detected in non-Camellia teas. The investigation suggest some non-Camellia teas may be great functional natural products with potential for prevention of chronic diseases and aging, by providing with abundant polyphenols, antioxidants and specific FAAs.

  8. Cape Verde: Marketing Good Governance Kap Verde: Die Vermarktung von Good Governance

    Directory of Open Access Journals (Sweden)

    Bruce Baker

    2009-01-01

    Full Text Available Faced with a lack of natural resources Cape Verde has made good governance one of its most marketable products. Running parallel to the institutionalisation of democratic politics there has been an overhaul and growing sophistication in public administration, though certain weaknesses persist. This report argues that it is reform and improvement in this area in particular that has enabled this small island state to punch above its weight and achieve remarkable social, economic and political results. But will the successful formula of the past decade prove sufficient for the future? Poverty and unemployment have by no means been conquered. Much of the economic growth has been based in the tourist sector and the government is well aware of the dangers of over-reliance on a single industry. Cape Verde’s midway location between South America and Europe and its increasing international transport connections will continue to offer advantages to drug traffickers. The next few years of the world financial crisis will show whether marketing good governance is enough and whether this is the model for small resource developing states. Der Inselstaat Kap Verde hat seine Anstrengungen zu guter Regierungsführung (Good Governance erfolgreich demonstriert. Parallel zur Institutionalisierung demokratischer Regierungsstrukturen wurde die Verwaltung reformiert und modernisiert, wenn auch immer noch Problembereiche erkennbar sind. Der Autor sieht insbesondere in den politischen und administrativen Reformen den Hintergrund für die erfolgreiche soziale, wirtschaftliche und politische Entwicklung dieser kleinen Inselrepublik. Aber wird dieses Rezept, das im vergangenen Jahrzehnt seine Wirksamkeit beweisen konnte, auch in Zukunft ausreichend sein? Armut und Unterbeschäftigung sind keineswegs besiegt. Ein Großteil des Wirtschaftswachstums basiert auf dem Tourismussektor; die Regierung ist sich der Gefahr wohl bewusst, die in zu großer Abhängigkeit von einem

  9. Progress in analytical methods for the detection of geographical origin and authenticity of tea (Camellia sinensis)

    International Nuclear Information System (INIS)

    Yuan Yuwei; Hu Guixian; Shao Shengzhi; Zhang Yongzhi; Zhang Yu; Zhu Jiahong; Yang Guiling; Zhang Zhiheng

    2013-01-01

    Tea (Camellia sinensis) is one of the important agricultural products with obvious regional characteristics. Analytical methods are very important for the protection of geographical origin and authenticity of tea. The developments of analytical methods including stable isotope determination, multi-elements determination, near infrared reflectance spectroscopy, chemical fingerprint and others were reviewed. Major problems on tea origin and authenticity detection were discussed in this study, and some suggestions were also proposed which would be useful for the protection of geographical origin of tea in China. (authors)

  10. Caffeine in tea Camellia sinensis--content, absorption, benefits and risks of consumption.

    Science.gov (United States)

    Gramza-Michałowska, A

    2014-01-01

    Therapeutic properties of tea Camellia sinensis are of particular interest since it has been consumed for ages and was always regarded as safe beverage. Tea is most popular beverage in the world because of its attractive aroma, exceptional taste, health promoting and pharmaceutical potential. Current results showed that antioxidative, antibacterial and other health effects are attributed to its caffeine content and caffeine - polyphenols interactions. An overview is given on caffeine content in different tea leaves beverage. Special attention is drawn to caffeine physiological effect on human organism. Controversies concerning the possible caffeine influence on human physical and psychological health are briefly summarized and presented.

  11. Extract of Camellia sinensis as Green Inhibitor for the Corrosion of Mild Steel in Aqueous Solution

    International Nuclear Information System (INIS)

    Fouda, Abd Elaziz S.; Mekkia, Dina; Badr, Abeer H.

    2013-01-01

    Corrosion inhibition of mild steel used in water station in 35 ppm aluminum sulfate and 10 ppm chloride solution by Camellia sinensis leaves extract was studied using weight loss, potentiodynamic polarization and electrochemical impedance spectroscopy techniques at 30 .deg. C. Results show that the inhibition efficiency increases with increasing concentration of the extract and decreases with increasing temperature. Inhibitive effect was afforded by adsorption of the extract's components which was found to accord with Langmuir adsorption isotherm. Inhibition mechanism is deduced from the temperature dependence of the inhibition efficiency and was further corroborated by the values of activation parameters obtained from the experimental data

  12. L-alanine as a precursor of ethylamine in camellia sinensis

    International Nuclear Information System (INIS)

    Takeo, Tadakazu

    1975-01-01

    After absorption of ammonium nitrogen, nitrogen-deficient Camellia sinensis synthesized theanine following synthesis of glutamic acid and alanine. The rate of incorporation of 14 C from L-alanine U- 14 C into theanine was faster than from acetaldehyde 1-2 14 C. Incorporation of 14 C from L-alanine U- 14 C into the ethylamide of theanine was prevented by adding an excess of ethylamine to the culture solution. Green seedlings converted alanine to ethylamine more rapidly than did etiolated seedlings. (auth.)

  13. Extract of Camellia sinensis as Green Inhibitor for the Corrosion of Mild Steel in Aqueous Solution

    Energy Technology Data Exchange (ETDEWEB)

    Fouda, Abd Elaziz S. [El-Mansoura Univ., El-Mansoura (Egypt); Mekkia, Dina; Badr, Abeer H. [Water and wastewater company, Dakahlia (Egypt)

    2013-04-15

    Corrosion inhibition of mild steel used in water station in 35 ppm aluminum sulfate and 10 ppm chloride solution by Camellia sinensis leaves extract was studied using weight loss, potentiodynamic polarization and electrochemical impedance spectroscopy techniques at 30 .deg. C. Results show that the inhibition efficiency increases with increasing concentration of the extract and decreases with increasing temperature. Inhibitive effect was afforded by adsorption of the extract's components which was found to accord with Langmuir adsorption isotherm. Inhibition mechanism is deduced from the temperature dependence of the inhibition efficiency and was further corroborated by the values of activation parameters obtained from the experimental data.

  14. AHP 24: A Multi-ethnic Village in Northeast Tibet - History, Ritual, and Daily Life in Chu cha

    Directory of Open Access Journals (Sweden)

    Stobs stag lha སྟོབས་སྟག་ལྷ།

    2013-09-01

    Full Text Available Multi-ethnic Chu cha Village in Mchod rten thang Township, Dpa' ris Tibetan Autonomous County, Gansu Province, China is described in terms of location; population; clothing; language; religion; history; and personal, family, and community rituals. Photographs provide additional information.

  15. High-speed photometry of the dwarf nova Z Cha in quiescence

    International Nuclear Information System (INIS)

    Wood, Janet; Horne, Keith; Berriman, Graham; O'Donoghue, Darragh; Warner, Brian

    1986-01-01

    High-speed white light photometry of the cataclysmic variable star Z Cha is used to study the structure of the system and to derive the properties of its components. The white dwarf and bright spot eclipse timings require a mass ratio, q=Msub(R)/Msub(WD) of 0.146 0 .9>i>81 0 .6. The infalling stream passes through the light centre of the bright spot. If the central luminous object is the white dwarf its mass is 0.54+-0.01 Msolar mass which corresponds to a secondary star mass of 0.081+-0.003 Msolar mass. Agreement between colour and brightness temperatures for the white dwarf and bright spot provide a rough confirmation of the 97 pc distance. (author)

  16. Optimization of CHA-PCFC Hybrid Material for the Removal of Radioactive Cs from Waste Seawater

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Keun-Young; Kim, Jimin; Park, Minsung; Kim, Kwang-Wook; Lee, Eil-Hee; Chung, Dong-Yong; Moon, Jei-Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    The liquid waste treatment processes in the normal operation of nuclear power plant are commercialized, those in the abnormal accidents have not been fully developed until now. In the present study, as a preliminary research for the development of precipitation-based treatment process specialized for the removal of Cs from waste seawater generated in the emergency case, the performance test of a hybrid material combining chabazite and potassium cobalt ferrocyanide was conducted. Also the synthesis method for the hybrid adsorbent was optimized for the best Cs removal efficiency on the actual contamination level of waste seawater. Because the temperature effect on the synthesis of PCFC was confirmed by preliminary experiments, the optimization of CHA-PCFC synthesis was also conducted. The hybrid material synthesized at 40 .deg. C showed the highest distribution coefficient of Cs in the same manner of the performance of PCFC synthesized at the lower temperature than that of conventional methods.

  17. Effect of environmental conditions and lesion age on sporulation of Phytophthora ramorum on California bay laurel, rhododendron, and camellia

    Science.gov (United States)

    Steve Tjosvold; David Chambers; Sylvia Mori

    2013-01-01

    The objective of our research was to determine the environmental conditions and lesion age favorable for Phytophthora ramorum sporulation under field conditions. For 2 years, new camellia, rhododendron, and California bay laurel (Umbellaria californica (Hook. & Arn.) Nutt.) nursery stock were seasonally inoculated (every 3 months) on foliage....

  18. Predicting foliar biochemistry of tea (Camellia sinensis) using reflectance spectra measured at powder, leaf and canopy levels

    NARCIS (Netherlands)

    Bian, B.M.; Skidmore, A.K.; Schlerf, M.; Wang, T.; Liu, X.; Zeng, R.; Fei, T.

    2013-01-01

    Some biochemical compounds are closely related with the quality of tea (Camellia sinensis (L.)). In this study, the concentration of these compounds including total tea polyphenols, free amino acids and soluble sugars were estimated using reflectance spectroscopy at three different levels: powder,

  19. Studies on the Biochemical Formation Pathway of the Amino Acid l-Theanine in Tea (Camellia sinensis) and Other Plants.

    Science.gov (United States)

    Cheng, Sihua; Fu, Xiumin; Wang, Xiaoqin; Liao, Yinyin; Zeng, Lanting; Dong, Fang; Yang, Ziyin

    2017-08-23

    Tea (Camellia sinensis) is the most widely consumed beverage aside from water. The flavor of tea is conferred by certain metabolites, especially l-theanine, in C. sinensis. To determine why more l-theanine accumulates in C. sinensis than in other plants, we compare l-theanine contents between C. sinensis and other plant species (Camellia nitidissima, Camellia japonica, Zea mays, Arabidopsis thaliana, and Solanum lycopersicum) and use a stable isotope labeling approach to elucidate its biosynthetic route. We quantify relevant intermediates and metabolites by mass spectrometry. l-Glutamic acid, a precursor of l-theanine, is present in most plants, while ethylamine, another precursor of l-theanine, specifically accumulates in Camellia species, especially C. sinensis. Most plants contain the enzyme/gene catalyzing the conversion of ethylamine and l-glutamic acid to l-theanine. After supplementation with [ 2 H 5 ]ethylamine, all the plants produce [ 2 H 5 ]l-theanine, which suggests that ethylamine availability is the reason for the difference in l-theanine accumulation between C. sinensis and other plants.

  20. Optimization of the degumming process for camellia oil by the use of phospholipase C in pilot-scale system.

    Science.gov (United States)

    Jiang, Xiaofei; Chang, Ming; Jin, Qingzhe; Wang, Xingguo

    2015-06-01

    In present study, phospholipase C (PLC) was applied in camellia oil degumming and the response surface method (RSM) was used to determine the optimum degumming conditions (reaction time, reaction temperature and enzyme dosage) for this enzyme. The optimum conditions for the minimum residual phosphorus content (15.14 mg/kg) and maximum yield of camellia oil (98.2 %) were obtained at reaction temperature 53 ºC, reaction time 2.2 h, PLC dosage 400 mg/kg and pH 5.4. The application of phospholipase A (PLA) - assisted degumming process could further reduce the residual phosphorus content of camellia oil (6.84 mg/kg) to make the oil suitable for physical refining while maintaining the maximal oil yield (98.2 %). These results indicate that PLC degumming process in combination with PLA treatment can be a commercially viable alternative for traditional degumming process. Study on the quality changes of degummed oils showed that the oxidative stability of camellia oil was slightly deceased after the enzymatic treatment, thus more attention should be paid to the oxidative stability in the further application.

  1. Talento verde: caracterización y búsqueda

    Directory of Open Access Journals (Sweden)

    María del Carmen Torres-Salazar

    2015-01-01

    Full Text Available Introducción: Los impactos del calentamiento global y el cambio climático son una preocupación en prácticamente todos los sectores de la sociedad, debido a las consecuencias que ya se perciben y que afectarán cada día más tanto a los sistemas naturales como a los creados por el hombre, generalmente de forma negativa. Para revertir estos efectos negativos y no continuar deteriorando el medio ambiente, es necesario un tipo especial de personas que sean capaces de tomar las decisiones adecuadas en los ámbitos en los que se desenvuelven. En esta investigación, estos seres humanos se denominan: “personas con talento verde”. El término talento verde no ha sido caracterizado y su uso es aun restringido. Esta investigación hace una caracterización del talento verde y propone una encuesta para detectar a las personas que cuentan con estas características. En este artículo, se reporta solo la validación de la encuesta. Es importante hacer notar que este trabajo forma parte de una investigación más amplia que busca conocer la relación entre directivos con talento verde y prácticas de cadena de suministro sustentable. Método: La caracterización del talento verde se realizó a través de la metodología de representaciones sociales, de la cual surgieron una serie de preguntas que buscan las características de talento verde en directivos de empresas y que forman parte de una encuesta de mayor cobertura que fue piloteada para su validación. La confiabilidad se midió a través del Alfa de Crombach y la validez por un Análisis Factorial. Resultados: Se encontraron nueve aspectos que caracterizan a las personas con talento verde, con las cuales se construyeron también nueve preguntas. Estas preguntas se hicieron a 25 directivos de empresas que participan en la Cámara de la Industria de la Transformación (CANACINTRA con el objetivo de validar el instrumento. El alfa de Crombrach obtenido fue del 0.948 y el análisis factorial indica

  2. Safety evaluation of the Laguna Verde nuclear power plant

    International Nuclear Information System (INIS)

    Delgado G, J.L.

    1991-01-01

    The present work describe the licensing process for the first nuclear power plant built in Mexico, it presents the difficulties found during the several years of construction and tests until the phrase a level of safety equivalent to that of the country of origin of the nuclear steam supply system could be applicable to Laguna Verde, at least from the point of view of the mexican regulatory body, and also that this statement could be signed for the inspectors of international organizations. (author)

  3. Cabo Verde telemedicine program: initial results of nationwide implementation.

    Science.gov (United States)

    Latifi, Rifat; Dasho, Erion; Merrell, Ronald C; Lopes, Miguel; Azevedo, Vanda; Bekteshi, Flamur; Osmani, Kalterina L; Qesteri, Orland; Kucani, Julian; Lecaj, Ismet

    2014-11-01

    Telemedicine and e-health have been suggested as one solution for closing the health disparity gap between the developed world and the developing world. Yet evidence is lacking from current successful programs in the developing world and, in particular, from sub-Saharan Africa. The primary objective of our study was to present the preliminary results of our efforts in building the Integrated Telemedicine and e-Health Program for Cabo Verde (ITeHP-CV), with an emphasis on initial utilization and results. This is a prospective study of data collected while we worked to establish a fully functional, integrated national telemedicine network and virtual education network in Cabo Verde. We used the International Virtual e-Hospital Foundation strategic approach known as "initiate-build-operate-transfer" over a 26-month period (November 2011-December 2013). We describe herein the five main pillars of this process that have been implemented: (1) capacity building; (2) network development and deployment of equipment; (3) implementation of clinical telemedicine; (4) implementation of activities related to continuing medical education, delivered from within the country and from abroad; and (5) establishment and use of the electronic virtual library. Based on comprehensive technical and medical assessment of the country's needs, 10 fully functional telemedicine centers in all nine inhabited islands of the Republic of Cabo Verde have been established. RESULTS are presented under the five main pillars of capacity building, network deployment, implementation of clinical telemedicine, implementation of continuing medical education activities, and establishment of the electronic virtual library. The ITeHP-CV has been successfully launched, and the initial results are encouraging. The continuity of the program and sustainability are primary goals once the program is transferred fully to the Ministry of Health of Cabo Verde. A long-term follow-up study is required in order to ensure

  4. Community-based tourism in Cape Verde - a case study

    OpenAIRE

    Tomas Lopez-Guzman; Osvaldo Borges; Ana Maria Castillo-Canalejo

    2011-01-01

    Community-based tourism is taking its place in the world as an alternative to traditional tourist destinations, especially in developing countries. This form of tourism allows for greater contact with the local community and for the tourist to experience new sensations while enabling the economic and social development of the geographic area. In this paper, the results of fieldwork carried out in the island of Fogo (Cape Verde) are presented, assessing the opinion and perception tourists visi...

  5. Les enjeux écologiques de Palo Verde (Costa Rica

    Directory of Open Access Journals (Sweden)

    Bertrand LÉVY

    1992-09-01

    Full Text Available Près de Palo Verde a été créé un parc naturel. Un projet d’irrigation risque de perturber l’écologie de la région. Une carte de son écosystème a été établie par télédétection, pour évaluer l’impact d’un tel projet.

  6. Prototype fuel fabrication for nuclear reactors of Laguna Verde

    International Nuclear Information System (INIS)

    Nocetti, C.; Torres, J.; Medrano, A.

    1996-01-01

    Four prototype fuel bundles for the Laguna Verde Nuclear Power Plant have been fabricated. the type of nuclear fuel produced is described and the process used is commented. As an example of the fabrication criteria adopted, the production model to determine the density of the U O 2 pellets for the different batches of ceramic powder is described. the results are evaluated using the statistical indexes C p and C pk . (author)

  7. Deep sequencing of the Camellia chekiangoleosa transcriptome revealed candidate genes for anthocyanin biosynthesis.

    Science.gov (United States)

    Wang, Zhong-Wei; Jiang, Cong; Wen, Qiang; Wang, Na; Tao, Yuan-Yuan; Xu, Li-An

    2014-03-15

    Camellia chekiangoleosa is an important species of genus Camellia. It provides high-quality edible oil and has great ornamental value. The flowers are big and red which bloom between February and March. Flower pigmentation is closely related to the accumulation of anthocyanin. Although anthocyanin biosynthesis has been studied extensively in herbaceous plants, little molecular information on the anthocyanin biosynthesis pathway of C. chekiangoleosa is yet known. In the present study, a cDNA library was constructed to obtain detailed and general data from the flowers of C. chekiangoleosa. To explore the transcriptome of C. chekiangoleosa and investigate genes involved in anthocyanin biosynthesis, a 454 GS FLX Titanium platform was used to generate an EST dataset. About 46,279 sequences were obtained, and 24,593 (53.1%) were annotated. Using Blast search against the AGRIS, 1740 unigenes were found homologous to 599 Arabidopsis transcription factor genes. Based on the transcriptome dataset, nine anthocyanin biosynthesis pathway genes (PAL, CHS1, CHS2, CHS3, CHI, F3H, DFR, ANS, and UFGT) were identified and cloned. The spatio-temporal expression patterns of these genes were also analyzed using quantitative real-time polymerase chain reaction. The study results not only enrich the gene resource but also provide valuable information for further studies concerning anthocyanin biosynthesis. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Effects of the medicinal plants Curcuma zedoaria and Camellia sinensis on halitosis control

    Directory of Open Access Journals (Sweden)

    Vitor Hugo Farina

    2012-12-01

    Full Text Available Volatile sulphur compounds (VSC are the gases mainly responsible for halitosis (bad breath. The aim of this research was to evaluate the effects of medicinal plants on halitosis control. Two commonly used plants were tested: Curcuma zedoaria and Camellia sinensis (green tea. These plants were prepared as an aqueous solution and used as mouthwashes, compared with a standard mouthwash of 0.12% chlorhexidine gluconate and a placebo (water. The experiment was conducted with 30 volunteers from the School of Dentistry of São Jose dos Campos, Univ. Estadual Paulista - UNESP, SP, Brazil. Each volunteer tested the four mouthwashes. The Cysteine Challenge Method, modified for this study, was used for initial breath standardization. Four breath assessments were conducted after volunteers rinsed orally with acetylcysteine: one before the test mouthwash was used; the second, one minute after its use; a third 90 minutes later; and the last 180 minutes later. The results showed that chlorhexidine gluconate lowered VSC production immediately, and that this effect lasted up to 3 hours, while the tested plants had immediate inhibitory effects but no residual inhibitory effects on VSC. We concluded that Curcuma zedoaria and Camellia sinensis, prepared as infusions and used as mouthwashes, did not have a residual neutralizing effect on VSC.

  9. Verde Macael: A Serpentinite Wrongly Referred to as a Marble

    Directory of Open Access Journals (Sweden)

    Santiago del Barrio

    2013-02-01

    Full Text Available Serpentinites are used in both exterior and interior locations, but not all serpentinites are equal: they vary in physical-mechanical behavior and are not all suitable for similar uses. The serpentinites most commonly used worldwide come from India, Pakistan or Egypt. Spain has traditionally quarried two ultramafic massifs, one in Galicia (Verde Pirineos and one in Andalucía (Verde Macael. Some of these quarries were small family-run businesses. In both cases, these rocks are commercially available as “green marble.” These serpentinites commonly have a high degree of carbonation, but the process does not always take place with the same intensity. Carbonate can act as a cementing agent of the other phases, increasing the mechanical strength parameters. As a result, an improvement in the strength conditions is achieved, but a misinterpretation of the suitability of the rock may occur because a perception among users that “green marble” is similar to geologically defined marble. This may lead to inappropriate applications as an ornamental stone. At a time of economic crisis in Europe, the natural stone sector is encouraged to invest in research to identify the best quality products that can compete profitably with those currently being imported from other countries. This paper provides a comparison of properties of the Verde Macael serpentinite with a true marble in the hope of contributing to improving the natural stone industrial sector.

  10. Renewable energy projects to electrify rural communities in Cape Verde

    International Nuclear Information System (INIS)

    Ranaboldo, Matteo; Lega, Bruno Domenech; Ferrenbach, David Vilar; Ferrer-Martí, Laia; Moreno, Rafael Pastor; García-Villoria, Alberto

    2014-01-01

    Highlights: • The design of 2 off-grid electrification projects in Cape Verde is developed. • Configurations with hybrid renewable energy systems and micro-grids are considered. • A detailed micro-scale wind resource assessment is carried out. • An optimization model is used in order to support the design. • The proposed system is economically beneficial in comparison with diesel generation. - Abstract: Even though Cape Verde has high wind and solar energy resources, the conventional strategy for increasing access to electricity in isolated rural areas is by centralized microgrids with diesel generators. In this study, the design of 2 off-grid electrification projects based on hybrid wind–photovoltaic systems in Cape Verde is developed and analyzed. The design considers some significant novelty features in comparison with previous studies. First a detailed wind resource assessment is carried out combining meso-scale wind climate data and a specialized micro-scale wind flow model. Then a mathematical model is used for the design of off-grid projects considering a combination of individual systems and microgrids. In this study, locations far from the demand points are also considered as possible generation points. Various design configurations are analyzed and compared. The proposed configurations exploit the highest wind potential areas and are economically beneficial in comparison with diesel generator systems

  11. Living With Parasites in Palo Verde National Park

    Directory of Open Access Journals (Sweden)

    Eben Kirksey

    2012-11-01

    Full Text Available Bruno Latour has tried to bring a parliamentary democracy to the domain of nature. Wading through the swamps of Palo Verde, a national park in the Guanacaste Province of Costa Rica, and wandering onto neighbouring agricultural lands, I failed to find a central place where people were speaking for nature. Departing from a failed attempt to speak for another species (the fringe-toed foam frog, this paper considers how diverging values and obligations shape relationships in multi-species worlds. As spokespersons articulated competing visions of nature on the borderlands of Palo Verde, multiple social and ecological worlds went to war. The haunting specter of capital joined the fray—animating the movements of cattle, grasses with animal rhizomes, rice seeds, and flighty ducks across national borders and through fragmented landscapes. Amidst this warfare, the fringe-toed foam frog was just one tenacious parasite, a noisy agent eating at the table of another, which began to flourish in worlds designed with the well-being of others in mind. Cattails, charismatic birds, and a multitude of insects began interrupting human dreams and schemes. Final solutions to the problem of living with parasites failed in Palo Verde. Humans and parasites, who became para-selves of one another, maintained an abiding presence in the landscape.

  12. Population size, breeding biology and on-land threats of Cape Verde petrel (Pterodroma feae) in Fogo Island, Cape Verde.

    Science.gov (United States)

    Militão, Teresa; Dinis, Herculano Andrade; Zango, Laura; Calabuig, Pascual; Stefan, Laura M; González-Solís, Jacob

    2017-01-01

    Cape Verde petrel (Pterodroma feae) is currently considered near threatened, but little is known about its population size, breeding biology and on land threats, jeopardizing its management and conservation. To improve this situation, we captured, marked and recaptured (CMR) birds using mist-nets over 10 years; measured and sexed them; monitored up to 14 burrows, deployed GPS devices on breeders and analyzed activity data of geolocators retrieved from breeders in Fogo (Cape Verde). We set cat traps over the colony and investigated their domestic/feral origin by marking domestic cats from a nearby village with transponders, by deploying GPS devices on domestic cats and by performing stable isotope analyses of fur of the trapped and domestic cats. The population of Fogo was estimated to be 293 birds, including immatures (95% CI: 233-254, CMR modelling). Based on geolocator activity data and nest monitoring we determined the breeding phenology of this species and we found biometric differences between sexes. While monitoring breeding performance, we verified a still ongoing cat predation and human harvesting. Overall, data gathered from trapped cats without transponder, cats GPS trips and the distinct isotopic values between domestic and trapped cats suggest cats visiting the colony are of feral origin. GPS tracks from breeders showed birds left and returned to the colony using the sector NE of the islands, where high level of public lights should be avoided specially during the fledging period. Main threats for the Cape Verde petrel in the remaining breeding islands are currently unknown but likely to be similar to Fogo, calling for an urgent assessment of population trends and the control of main threats in all Cape Verde Islands and uplisting its conservation status.

  13. Population size, breeding biology and on-land threats of Cape Verde petrel (Pterodroma feae in Fogo Island, Cape Verde.

    Directory of Open Access Journals (Sweden)

    Teresa Militão

    Full Text Available Cape Verde petrel (Pterodroma feae is currently considered near threatened, but little is known about its population size, breeding biology and on land threats, jeopardizing its management and conservation. To improve this situation, we captured, marked and recaptured (CMR birds using mist-nets over 10 years; measured and sexed them; monitored up to 14 burrows, deployed GPS devices on breeders and analyzed activity data of geolocators retrieved from breeders in Fogo (Cape Verde. We set cat traps over the colony and investigated their domestic/feral origin by marking domestic cats from a nearby village with transponders, by deploying GPS devices on domestic cats and by performing stable isotope analyses of fur of the trapped and domestic cats. The population of Fogo was estimated to be 293 birds, including immatures (95% CI: 233-254, CMR modelling. Based on geolocator activity data and nest monitoring we determined the breeding phenology of this species and we found biometric differences between sexes. While monitoring breeding performance, we verified a still ongoing cat predation and human harvesting. Overall, data gathered from trapped cats without transponder, cats GPS trips and the distinct isotopic values between domestic and trapped cats suggest cats visiting the colony are of feral origin. GPS tracks from breeders showed birds left and returned to the colony using the sector NE of the islands, where high level of public lights should be avoided specially during the fledging period. Main threats for the Cape Verde petrel in the remaining breeding islands are currently unknown but likely to be similar to Fogo, calling for an urgent assessment of population trends and the control of main threats in all Cape Verde Islands and uplisting its conservation status.

  14. CHA2DS2-VASc score and risk of thromboembolism and bleeding in patients with atrial fibrillation and recent cancer

    DEFF Research Database (Denmark)

    D'Souza, Maria; Carlson, Nicholas; Fosbøl, Emil

    2018-01-01

    Background Cancer may influence the risk of thromboembolism and bleeding associated with the CHA2DS2-VASc score. We examined the risk of thromboembolism and bleeding associated with the CHA2DS2-VASc score in atrial fibrillation patients with and without recent cancer. Methods and results Using...... nationwide registers all patients diagnosed with atrial fibrillation from 2000 to 2015 and not on oral anticoagulation or heparin therapy were included and followed for 2 years. Recent cancer was defined by a cancer diagnosis 5 years or fewer earlier. Risks of thromboembolism and bleeding were estimated...... in cumulative incidence curves and Cox regression models. We included 122,053 patients with incident atrial fibrillation, 12,014 (10%) had recent cancer. The 2-year cumulative incidence of thromboembolism and bleeding in patients with versus without recent cancer was 1.7% (95% confidence interval (CI) 0...

  15. 77 FR 14058 - Santa Teresa Southern Railroad, LLC-Operation Exemption-Rail Line of Verde Logistics Railroad...

    Science.gov (United States)

    2012-03-08

    ... Southern Railroad, LLC--Operation Exemption--Rail Line of Verde Logistics Railroad, LLC at Santa Teresa... notice of exemption under 49 CFR 1150.31 to operate approximately 12,000 feet of rail line owned by Verde Logistics Railroad, LLC (Verde). The rail line extends between a point of connection with Union Pacific...

  16. 76 FR 24064 - Arizona Public Service Company, Palo Verde Nuclear Generating Station, Units 1, 2, and 3, Notice...

    Science.gov (United States)

    2011-04-29

    ... Service Company, Palo Verde Nuclear Generating Station, Units 1, 2, and 3, Notice of Issuance of Renewed... Company (licensee), the operator of the Palo Verde Nuclear Generating Station, Units 1, 2, and 3 (PVNGS... Plants: Supplement 43, Regarding Palo Verde Nuclear Generating Station,'' issued January 2011, discusses...

  17. Deposition and Accumulation of Emerging Contaminants in the Sediments of the Palos Verde Shelf, California

    Science.gov (United States)

    Deposition and Accumulation of Emerging Contaminants in the Sediments of the Palos Verde Shelf, California Mark G. Cantwell, David R. Katz, Julia Sullivan, Robert P. Eganhouse, Monique M. Perron, Robert M. Burgess The Palos Verdes shelf is located off the Southern California coa...

  18. The Cape Verde Islands are home to a small and genetically distinct humpback whale breeding population

    NARCIS (Netherlands)

    Bérubé, Martine; Ryan, Conor; Berrow, Simon D.; Suarez, Pedro Lopez; Monteiro, Vanda; Wenzel, Frederick; Robbins, Jooke; Mattila, David; Vikingsson, G.A.; Øien, Nils; Palsboll, Per

    2013-01-01

    The Cape Verde Islands appear to be winter breeding ground of the smallest humpback whale population yet known. However, it is unclear whether the humpback whales at the Cape Verde Islands interbreed with those in the West Indies. Here we present the results of the genetic analysis of 50 humpback

  19. 76 FR 1197 - Arizona Public Service Company, Palo Verde Nuclear Generating Station; Notice of Availability of...

    Science.gov (United States)

    2011-01-07

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 50-528, 50-529, 50-530; NRC-2009-0012] Arizona Public Service Company, Palo Verde Nuclear Generating Station; Notice of Availability of the Final Supplement 43... of operation for the Palo Verde Nuclear Generating Station (PVNGS). Possible alternatives to the...

  20. Cape Verde. A Country Guide Series Report from the AACRAO-AID Project.

    Science.gov (United States)

    Sevigny, Joseph A.

    This report provides information on the education system of Cape Verde, and is designed to assist college admissions officers and registrars in the United States with the admission and placement of students from that country. The report contains general information on the geography, history, and people of Cape Verde, as well as more specific…

  1. Mesa Verde--A Year-Round High School. A Descriptive Report of 1980-81.

    Science.gov (United States)

    Housden, Terry; Holmes, Lynda

    Mesa Verde High School was constructed in 1974 and is the last high school built in the San Juan (California) Unified District. It serves students in grades 9 through 12 and has an open enrollment policy. Mesa Verde operates on a year-round schedule with students divided into three tracks. Basically, each track is in session for 9 weeks and then…

  2. 75 FR 48323 - Agency Information Collection Activities; Proposed Collection; Comment Request; Palos Verdes...

    Science.gov (United States)

    2010-08-10

    ..., quantity, and/or cooking method of fish species, (3) gather quantitative data that can be used to... anglers who fish in the Palos Verdes Shelf vicinity. Title: Palos Verdes Shelf Seafood Consumption Survey... deep for direct human contact; however, fish in the PV Shelf area bioaccumulate the contaminants...

  3. Predictive Value of CHA2DS2-VASC Score for Contrast-Induced Nephropathy After Percutaneous Coronary Intervention for Acute Coronary Syndrome.

    Science.gov (United States)

    Kurtul, Alparslan; Yarlioglues, Mikail; Duran, Mustafa

    2017-03-15

    The CHA2DS2-VASC score, used for embolic risk stratification in atrial fibrillation (AF), has been reported recently to predict adverse clinical outcomes in patients with acute coronary syndrome (ACS), regardless of having AF. We investigated the correlation between the CHA2DS2-VASC score and contrast-induced nephropathy (CIN) in patients with ACS who underwent urgent percutaneous coronary intervention (PCI). A total of 1,408 patients were enrolled in the study. The CHA2DS2-VASC score was calculated for each patient. Based on the receiver operating characteristic analysis, the study population was divided into 2 groups: CHA2DS2-VASC score ≤3 group (n = 944) and CHA2DS2-VASC score ≥4 group (n = 464). Patients were then reallocated to 2 groups according to the presence or absence of CIN. CIN was defined as a rise in serum creatinine >0.5 mg/dl or >25% increase in baseline within 72 hours after PCI. Overall, 159 cases (11.3%) of CIN were diagnosed. Receiver operating characteristic curve analysis revealed good diagnostic value of CHA2DS2-VASC score in predicting CIN (area under the curve 0.769, 95% confidence interval 0.733 to 0.805; p high score had a higher frequency of CIN (23.9% vs 5.1%; p <0.001), and multivariate analysis identified the CHA2DS2-VASC score of ≥4 as an independent predictor of CIN. In conclusion, CHA2DS2-VASC score can be used as a new, simple, and reliable tool to predict CIN in patients with ACS who underwent urgent PCI. Copyright © 2016 Elsevier Inc. All rights reserved.

  4. Assessment of CHADS2 and CHA 2DS 2-VASc scores in obstructive sleep apnea patients with atrial fibrillation.

    Science.gov (United States)

    Szymanski, Filip M; Filipiak, Krzysztof J; Platek, Anna E; Hrynkiewicz-Szymanska, Anna; Karpinski, Grzegorz; Opolski, Grzegorz

    2015-05-01

    Assessment of stroke risk and implementation of appropriate antithrombotic therapy is an important issue in atrial fibrillation patients. Current risk scores do not take into consideration the comorbidities associated with elevated thromboembolic like obstructive sleep apnea (OSA). The aim of the study was to establish whether atrial fibrillation patients with coexisting OSA have higher stroke risk according to CHADS2 and CHA2DS2-VASc scores. Two hundred fifty-four consecutive patients hospitalized with a primary diagnosis of atrial fibrillation participated in the study. All patients underwent whole night polygraphy and were scored in both CHADS2 and CHA2DS2-VASc according to their medical records or de novo diagnosis. The study population was predominantly male (65.4%; mean age, 57.5 ± 10.0 years) with a high prevalence of hypertension (73.6%), dyslipidemia (63.4%), and obesity (42.9%). OSA was present in 47.6% of patients, who more often had history of stroke (p = 0.0007). Stroke risk profile assessed by both CHADS2 and CHA2DS2-VASc scores was higher in patients with OSA (1.2 ± 0.9 vs. 0.8 ± 0.6; p vs. 1.5 ± 1.1; p = 0.001) than without it. Differences in the stroke risk remained significant across different age strata, and the trend for point values in CHADS2 and CHA2DS2-VASc scores rose along with OSA severity according to the apnea-hypopnea index (AHI; p for trend stroke prediction models.

  5. CORRELATION OF MORPHOLOGICAL CHA RACTERISTICS STUDENTS WITH SUCCESS IN PERFORMAnCE OF FOLK DANCES

    Directory of Open Access Journals (Sweden)

    Amra Nožinović Mujanović

    2007-05-01

    Full Text Available On the sam ple of 121stu dent from se cond and third gra de of Fa culty of physi cal edu ca tion and sport, is be ing me a su red by using 20 va ri a bles of morp ho lo gi cal cha racte ri stics and 4 va ri a bles for esti ma tion of the suc cess in per for ming the folk dan ces, with the aim to de ter mi ne the ir con nec tion to the re sults of the esti ma ted va lue from the practi cal part of Folk dan ce lec tu ring. Ba sed on pre sen ted re sults, by ca no nic cor re la tion analysis in ma ni fe sted spa ce, ma jor part of pre dic tion gro up is in vol ved in va ri a bi lity of suc cess of cri te ria va ri a ble what con fi rms one im por tant ca no nic par of fac tors (Ca noni cal R .40.

  6. Antioxidant and antifungal activities of Camellia sinensis (L. Kuntze leaves obtained by different forms of production

    Directory of Open Access Journals (Sweden)

    L. E. A. Camargo

    Full Text Available Abstract The antioxidant and anticandidal activities of leaves obtained from Camellia sinensis by non-fermentation (green and white teas, semi-fermentation (red tea and fermentation method (black tea were investigated. It was evaluated the total phenolic content by Folin-Ciocalteau assay; antioxidant capacities were evaluated in vitro using DPPH and ABTS radicals, hypochlorous acid and superoxide anion scavenger assays, induced hemolysis, lipid peroxidation by conjugated diene formation and myeloperoxidase activity. Anticandidal activity was performed on three strains of Candida spp. The results showed that non-fermented teas have a higher concentration of phenolic compounds, and then presented the best inhibitory activity of AAPH-induced hemolysis, the best inhibition of conjugated diene formation and more pronounced antioxidant activity in all tests. The highest anticandidal activity was obtained from fermented tea, followed by non-fermented tea. These results indicate that the antioxidant activity demonstrated has no direct relation with the anticandidal activity.

  7. Quantitative Analysis of Major Phytochemicals in Orthodox tea (Camellia sinensis), Oxidized under Compressed Air Environment.

    Science.gov (United States)

    Panda, Brajesh Kumar; Datta, Ashis Kumar

    2016-04-01

    This study describes major changes in phytochemical composition of orthodox tea (Camellia sinensis var. Assamica) oxidized under compressed air (CA). The experiments for oxidation were conducted under air pressure (101, 202, and 303 kPa) for 150 min. Relative change in the concentrations of caffeine, catechins, theaflavins (TF), and thearubigins (TR) were analyzed. Effect of CA pressure was found to be nonsignificant in regulating caffeine concentration during oxidation. But degradation in different catechins as well as formation of different TF was significantly affected by CA pressure. At high CA pressure, TF showed highest peak value. TR was found to have slower rate of formation during initial phase of oxidation than TF. Even though the rate of TR formation was significantly influenced by CA, a portion of catechins remained unoxidized at end of oxidation. Except caffeine, the percent change in rate of formation or degradation were more prominent at 202 kPa. © 2016 Institute of Food Technologists®

  8. Inhibition of α-glucosidase by polysaccharides from the fruit hull of Camellia oleifera Abel.

    Science.gov (United States)

    Zhang, Sheng; Li, Xiang-Zhou

    2015-01-22

    We isolated and purified polysaccharides from the Camellia oleifera Abel. fruit hull and studied its hypoglycemic potential. Our results revealed six polysaccharides (CFPA-1-5 & CFPB) from the aqueous extract from the defatted C. oleifera fruit hull. Purified polysaccharides (purity >90%) were investigated for the inhibition of α-glucosidase activity in vitro. Two polysaccharides, CFPB and CFPA-3 were present in high concentration in the fruit hull and showed a dose-dependent inhibition of α-glucosidase activity, with IC50 concentrations of 11.80 and 10.95 μg/mL, respectively. This result suggests that polysaccharides (CFP) extracted from the fruit hull of C. oleifera may have potential as functional foods with featuring a hypoglycemic effect. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Effect of hydrogen peroxide and camellia sinensis extract on reduction of oxygen level in graphene oxide

    Science.gov (United States)

    Celina Selvakumari, J.; Dhanalakshmi, J.; Pathinettam Padiyan, D.

    2016-10-01

    The intention of this work is to reduce the oxygen level in graphene oxide. The reduction process was initiated while preparing graphene oxide using modified Hummer’s method. In this new method, increase in hydrogen peroxide concentration during the preparation process results in the oxygen content reduction. Adding green tea (camellia sinensis) extract with increased hydrogen peroxide results in further reduction of oxygen content and changed the graphene oxide to reduced graphene oxide. The structural and optical properties of the new found reduced graphene oxide was analysed using XRD, FTIR, TEM, Raman and UV-vis spectra. The overall observation reflects that the sp3 carbon network of graphene oxide changed into sp2 carbon lattice of graphene which is very handful in supercapacitor and biosensor fields.

  10. Influence of Camellia sinensis extract on Zinc Oxide nanoparticle green synthesis

    Science.gov (United States)

    Nava, O. J.; Luque, P. A.; Gómez-Gutiérrez, C. M.; Vilchis-Nestor, A. R.; Castro-Beltrán, A.; Mota-González, M. L.; Olivas, A.

    2017-04-01

    This work addresses low cost, non-toxic green synthesis of Zinc Oxide nanoparticles prepared using different amounts of Camellia sinensis extract. The Synthesized material was studied and characterized through Fourier transform infrared spectroscopy (FTIR), x-ray diffraction (XRD), transmission electron microscopy (TEM). The Zinc Oxide nanoparticles presented the desired Znsbnd O bond at 618 cm-1, demonstrated growth in a purely hexagonal Wurtzite crystal structure, and, depending on the amount of extract used, they presented different size and shape homogeneity. The photocatalytic activity of the obtained Zinc Oxide nanoparticles was studied. The photocatalytic degradation studies were done at a 1:1 M ratio of methylene blue to Zinc Oxide nanoparticles under UV light. The obtained results presented a better degradation rate than commercially available Zinc Oxide nanoparticles.

  11. Inhibition of the Cu65/Zn35 brass corrosion by natural extract of Camellia sinensis

    International Nuclear Information System (INIS)

    Ramde, Tambi; Rossi, Stefano; Zanella, Caterina

    2014-01-01

    In this work, the corrosion inhibition of brass was studied using natural plant extract, Camellia sinensis, in 0.1 M Na2SO4 solutions with pH 7 and pH 4. Electrochemical techniques (potentiodynamic polarization, electrochemical impedance spectroscopy) and scanning electron microscopy (SEM) were applied to study the brass corrosion behavior in presence and absence of the extract. The results indicated that the extract is a very effective corrosion inhibitor for brass corrosion process in both the acidic and neutral media by virtue of adsorption. The inhibition effect increases by time as demonstrated by the EIS monitoring for 120 h. In the blank solution the corrosion process leads to the formation of a dark oxide patina at pH 7 and induces localized corrosion morphology at pH 4. The extract presence can avoid both the dark patina and the pits formation.

  12. Characteristics and bioactivities of different molecular weight polysaccharides from camellia seed cake.

    Science.gov (United States)

    Xu, Zhou; Li, Xu; Feng, Shiling; Liu, Jing; Zhou, Lijun; Yuan, Ming; Ding, Chunbang

    2016-10-01

    Four polysaccharides, namely COP-1, COP-2, COP-3 and COP-4, were ultrafiltrated from crud Camellia oleifera seed cake polysaccharides (COP-c), purified, and characterized, including the determination of antioxidant and antiproliferative activities. Their molecular weights were 7.9, 36, 83 and 225kDa, respectively. All COPs showed the similar FT-IR spectrums, but significant differentials in monosaccharide components. COP-2 exhibited the highest radical scavenging abilities. COP-1 has the strongest metal chelating capabilities. Although with higher molecular weight, COP-4 showed the poorest antioxidant abilities. These results suggested appreciate molecular weight COP possessed a better antioxidant activities. Additionally, all COPs had non-significant antiproliferative abilities in HaLa and HepG2 cells. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Inhibition of the Cu65/Zn35 brass corrosion by natural extract of Camellia sinensis

    Energy Technology Data Exchange (ETDEWEB)

    Ramde, Tambi, E-mail: t_ramde@univ-ouaga.bf [Equipe Chimie Physique et Electrochimie, Laboratoire de Chimie Moléculaire et des Matériaux, Université de Ouagadougou, 03 BP 7021 Ouagadougou 03 (Burkina Faso); Department of Industrial Engineering, University of Trento, via Sommarive 9, 38123 Trento (Italy); Rossi, Stefano; Zanella, Caterina [Department of Industrial Engineering, University of Trento, via Sommarive 9, 38123 Trento (Italy)

    2014-07-01

    In this work, the corrosion inhibition of brass was studied using natural plant extract, Camellia sinensis, in 0.1 M Na2SO4 solutions with pH 7 and pH 4. Electrochemical techniques (potentiodynamic polarization, electrochemical impedance spectroscopy) and scanning electron microscopy (SEM) were applied to study the brass corrosion behavior in presence and absence of the extract. The results indicated that the extract is a very effective corrosion inhibitor for brass corrosion process in both the acidic and neutral media by virtue of adsorption. The inhibition effect increases by time as demonstrated by the EIS monitoring for 120 h. In the blank solution the corrosion process leads to the formation of a dark oxide patina at pH 7 and induces localized corrosion morphology at pH 4. The extract presence can avoid both the dark patina and the pits formation.

  14. Response to IPE and IPEEE results at Palo Verde NGS

    International Nuclear Information System (INIS)

    Lindquist, R.C.

    1992-01-01

    Insights gained from the internal events probabilistic risk assessment (PRA) and from the pilot plant demonstration of the fire-induced vulnerability evaluation (FIVE) have been used to initiate corrective actions in the form of administrative controls, compensatory measures, and plant modifications to reduce the risks associated with significant core-damage sequences. Palo Verde was a pilot demonstration plant for the FIVE methodology developed by the Electrical Power Research Institute and sponsored by the Nuclear Utility Management and Resources Council. Several findings emerged from the application of FIVE and have been acted upon to reduce the impact of fire in several compartments of the plant

  15. Optimization of a DNA Nicking Assay to Evaluate Oenocarpus bataua and Camellia sinensis Antioxidant Capacity

    Directory of Open Access Journals (Sweden)

    Louis-Jérôme Leba

    2014-10-01

    Full Text Available This study was aimed at assessing the DNA damage protective activity of different types of extracts (aqueous, methanolic and acetonic using an in vitro DNA nicking assay. Several parameters were optimized using the pUC18 plasmid, especially FeSO4, EDTA, solvent concentrations and incubation time. Special attention has been paid to removing the protective and damaging effect of the solvent and FeSO4 respectively, as well as to identifying the relevant positive and negative controls. For each solvent, the optimal conditions were determined: (i for aqueous extracts, 0.33 mM of FeSO4 and 0.62 mM of EDTA were incubated for 20 min at 37 °C; (ii for acetone extracts, 1.16% solvent were incubated for 15 min at 37 °C with 1.3 mM of FeSO4 and 2.5 mM of EDTA and (iii for methanol extracts, 0.16% solvent, were incubated for 1.5 h at 37 °C with 0.33 mM of FeSO4 and 0.62 mM of EDTA. Using the optimized conditions, the DNA damage protective activity of aqueous, methanolic and acetonic extracts of an Amazonian palm berry (Oenocarpus bataua and green tea (Camellia sinensis was assessed. Aqueous and acetonic Oenocarpus bataua extracts were protective against DNA damage, whereas aqueous, methanolic and acetonic extracts of Camellia sinensis extracts induced DNA damage.

  16. Study on transportation and accumulation mechanisms of cesium in Camellia sinensis by SR-XRF imaging

    International Nuclear Information System (INIS)

    Oda, Nahoko; Nakai, Izumi; Terada, Yasuko

    2014-01-01

    After the tragedy in Fukushima, soil and food pollution by radionuclides has become a serious problem. Cs can be uptaken by many plants due to its chemical similarities with K. So, removal of radioactive Cs from the soils can be carried out using the phytoremediation technology. However, the development of phytoremediation techniques require the knowledge on the interactions between the plants and soils. Although the competitive relation between K and Cs to enter the plant is known, few works were dedicated to the visual localization of Cs in the plant and its relation to potassium. In this study, we have used synchrotron radiation X-ray fluorescence (SR-XRF) imaging in order to reveal accumulation of Cs with a cellular spatial resolution. The Cs Lβ intensity measured in the XRF imaging were transformed into the Cs concentration based on the calibration curves prepared using in house standard samples of known Cs concentrations. It is remarkable that after exposure to 10 ppm Cs solution for 4 weeks Camellia sinensis accumulated Cs up to 300 ppm (expressed in dry weight) in the body. XRF imaging of the root show that Cs was located mainly at the epidermis. On the other hand, K was located mainly at endodermis and the cell wall. A correlation coefficient(R) between XRF intensity of K and that of Cs in the root was about R=0.5. This suggest that Cs is hardly absorbed from roots of Camellia sinensis compared with K, due to its large ionic radius. In the case of stem, distribution of Cs was similar to that of K. They were located at the exodermis, epidermis and the cell wall. Their correlation coefficient was about R=0.8. These results suggest that Cs was transported through the same pathway as that of K in the stem. (author)

  17. Laboratory, Epidemiological, and Human Intervention Studies Show That Tea (Camellia sinensis) May Be Useful in the Prevention of Obesity12

    OpenAIRE

    Grove, Kimberly A.; Lambert, Joshua D.

    2010-01-01

    Tea (Camellia sinensis, Theaceae) and tea polyphenols have been studied for the prevention of chronic diseases, including obesity. Obesity currently affects >20% of adults in the United States and is a risk factor for chronic diseases such as type II diabetes, cardiovascular disease, and cancer. Given this increasing public health concern, the use of dietary agents for the prevention of obesity would be of tremendous benefit. Whereas many laboratory studies have demonstrated the potential eff...

  18. Groundwater arsenic in the Verde Valley in central Arizona, USA

    International Nuclear Information System (INIS)

    Foust, R.D.; Mohapatra, P.; Compton-O'Brien, A.-M.; Reifel, J.

    2004-01-01

    Forty-one water samples were collected and analyzed from throughout the Verde Valley watershed to identify the source of As in well water used for domestic and agricultural purposes. Each water sample was analyzed for anions, cations and trace chemical constituents by atomic absorption spectroscopy, anion chromatography and traditional wet chemical procedures. Arsenic concentrations ranged from 10 to 210 μg/l, with the highest values observed for water pooled on tailings from an abandoned Cu mine. Geostatistical analysis of the data revealed the primary source of As to be groundwater in contact with the Supai and Verde formations, as opposed to runoff from the abandoned mine tailings. Montezuma Well, a collapsed travertine spring, contained the highest levels of naturally occurring As (> 100 μg/l). Arsenic in Montezuma Well water was shown to be 100% arsenate. X-ray absorbance near edge spectra (XANES) of Potomogeton illinoiensis, an endemic plant species of Montezuma Well, demonstrate that As is absorbed as arsenate, reduced to arsenite in the plant and retained as an organic glutathione complex. XANES spectra of Montezuma Well sediments show 4 forms of As present: arsenate (∼54%), As(III)-glutathione complex (∼32%) and an As-organic complex (∼14%) containing dimethylarsinic acid and arsenobetaine. This is the first report of As(III)-glutathione in sediments

  19. Gamma thermometer longevity test: Laguna Verde 2 instruments recent performance

    International Nuclear Information System (INIS)

    Cuevas V, G.; Avila N, A.; Calleros M, G.

    2013-10-01

    This paper is informative of the General Electric Hitachi and Global Nuclear Fuel - Americas are collaboration with Comision Federal de Electricidad in a longevity test of thermocouples as power monitoring devices. The test conclusions will serve for final engineering design in detailing the Automated Fixed In-core Probes for calibration of the Local Power Range Monitors (LPRMs) of the Economic Simplified Boiling Water Reactor. This paper introduces the collaboration description and some recent performance evaluation of the thermocouples that are sensitive to gamma radiation and are known generically as Gamma Thermometers (G T). The G Ts in Laguna Verde 2 are radially located inside six instrumentation tubes in the core and consist of seven thermocouples, four are aligned with the LPRM heights and three are axially located between LPRM heights. The Laguna Verde 2 G T test has become the longest test of thermocouples as power monitoring devices in a BWR industry history and confirms their reliability in terms of time-dependent small noise under steady state reactor conditions and good agreement against Traversing In-core Probes power measurements. (Author)

  20. Gamma thermometer longevity test: Laguna Verde 2 instruments recent performance

    Energy Technology Data Exchange (ETDEWEB)

    Cuevas V, G. [Global Nuclear Fuel, Americas, 3901 Castle Hayne Road, Wilmington, North Carolina (United States); Avila N, A.; Calleros M, G., E-mail: Gabriel.Cuevas-Vivas@gnf.com [Comision Federal de Electricidad, Central Nucleoelectrica Laguna Verda, Carretera Veracruz-Nautla Km 42.5, Alto Lucero, Veracruz (Mexico)

    2013-10-15

    This paper is informative of the General Electric Hitachi and Global Nuclear Fuel - Americas are collaboration with Comision Federal de Electricidad in a longevity test of thermocouples as power monitoring devices. The test conclusions will serve for final engineering design in detailing the Automated Fixed In-core Probes for calibration of the Local Power Range Monitors (LPRMs) of the Economic Simplified Boiling Water Reactor. This paper introduces the collaboration description and some recent performance evaluation of the thermocouples that are sensitive to gamma radiation and are known generically as Gamma Thermometers (G T). The G Ts in Laguna Verde 2 are radially located inside six instrumentation tubes in the core and consist of seven thermocouples, four are aligned with the LPRM heights and three are axially located between LPRM heights. The Laguna Verde 2 G T test has become the longest test of thermocouples as power monitoring devices in a BWR industry history and confirms their reliability in terms of time-dependent small noise under steady state reactor conditions and good agreement against Traversing In-core Probes power measurements. (Author)

  1. Update-processing steam generator cleaning solvent at Palo Verde

    International Nuclear Information System (INIS)

    Peters, G.

    1996-01-01

    Framatome Technologies Inc.(FTI) recently completed the steam generator chemical cleanings at the Palo Verde Nuclear Generating Station Units 1, 2 and 3. Over 500,000 gallons of low-level radioactive solvents were generated during these cleanings and were processed on-site. Chemical cleaning solutions containing high concentrations of organic chelating wastes are difficult to reduce in volume using standard technologies. The process that was ultimately used at Palo Verde involved three distinct processing steps: The evaporation step was conducted using FTI's submerged combustion evaporator (SCE) that has also been successfully used at Arkansas Nuclear One - Unit 1, Three Mile Island - Unit 1, and Oconee on similar waste. The polishing step of the distillate used ultrafiltration (UF) and reverse osmosis (RO) technology that was also used extensively by Ontario Hydro to assist in their processing of chemical cleaning solvent. This technology, equipment, and operations personnel were provided by Zenon Environmental, Inc. The concentrate from the evaporator was absorbed with a special open-quotes peat mossclose quotes based media that allowed it to be shipped and buried at the Environcare of Utah facility. This is the first time that this absorption media or burial site has been used for chemical cleaning solvent

  2. Geotourism, Medical Geology and local development: Cape Verde case study

    Science.gov (United States)

    Rocha, F.; Ferreira da Silva, E.

    2014-11-01

    Geotourism and Geoparks in particular are real opportunities to rural developments promoting the rate decline of unemployment and emigration through engaging the local communities in geopark activities and tourism marketing in the form of adventure tourism, ecotourism, rural tourism and health geotourism. Geotourism is closely linked with Medical Geology. The intake of minerals and chemical elements for food, water, soil (through geophagy) or dust can be accomplished by ingestion, inhalation or dermal absorption. Pelotherapy or “Mudtherapy” is the use of mud/clay for therapeutic applications, internal or external. Cape Verde archipelago is located in Atlantic ocean, 400 km westwards of Senegal coast. Geotourism is being developed, mainly focused on the development of a geopark in Fogo island huge caldera, but also trying to take advantage of their potentialities for Geomedecine. A cooperative program established between Cape Verde University (UCV) and Aveiro University (UA, Portugal) is under way, aiming, on a first stage, to identify Geotouristic potentialities and, on a second stage, to develop products. Geotourism is being developed, mainly focused on the development of a geopark in Fogo isl. huge caldera, but also trying to take advantage of their potentialities for Geomedecine.

  3. Groundwater arsenic in the Verde Valley in central Arizona, USA

    Energy Technology Data Exchange (ETDEWEB)

    Foust, R.D.; Mohapatra, P.; Compton-O' Brien, A.-M.; Reifel, J

    2004-02-01

    Forty-one water samples were collected and analyzed from throughout the Verde Valley watershed to identify the source of As in well water used for domestic and agricultural purposes. Each water sample was analyzed for anions, cations and trace chemical constituents by atomic absorption spectroscopy, anion chromatography and traditional wet chemical procedures. Arsenic concentrations ranged from 10 to 210 {mu}g/l, with the highest values observed for water pooled on tailings from an abandoned Cu mine. Geostatistical analysis of the data revealed the primary source of As to be groundwater in contact with the Supai and Verde formations, as opposed to runoff from the abandoned mine tailings. Montezuma Well, a collapsed travertine spring, contained the highest levels of naturally occurring As (> 100 {mu}g/l). Arsenic in Montezuma Well water was shown to be 100% arsenate. X-ray absorbance near edge spectra (XANES) of Potomogeton illinoiensis, an endemic plant species of Montezuma Well, demonstrate that As is absorbed as arsenate, reduced to arsenite in the plant and retained as an organic glutathione complex. XANES spectra of Montezuma Well sediments show 4 forms of As present: arsenate ({approx}54%), As(III)-glutathione complex ({approx}32%) and an As-organic complex ({approx}14%) containing dimethylarsinic acid and arsenobetaine. This is the first report of As(III)-glutathione in sediments.

  4. ¿Qué tan verde es tu mercado?

    Directory of Open Access Journals (Sweden)

    Wilmar R. Olaya-González

    2011-01-01

    Full Text Available El mercado de lo verde y lo ecológico es una tendencia indiscutible en nuestro mundo globalizado, que busca de alguna manera resarcir el daño infringido sobre el medio ambiente. Más allá de simple altruismo, la ecología se ha convertido en una moda, de la cual unos y otros toman ventaja a su mejor acomodo, haciendo del mercado de productos y servicios su tribuna; eco-diseño, planes de responsabilidad social y ambiental, campañas por el reciclaje y consumo de productos "más amigables" con el medio ambiente hacen parte del panorama que se intenta describir en esta reseña. Por medio de un estudio de caso, se hará énfasis en cómo la comunicación asume un papel crucial en la verdadera apropiación del concepto de "consumidor verde" y "consumidor responsable", de manera que la propuesta transversal de las tic se convierta en una herramienta no solo tecnológica, sino también de empoderamiento del papel que la sociedad puede representar en el cuidado de los recursos naturales.

  5. Prestroke CHA2DS2-VASc Score and Severity of Acute Stroke in Patients with Atrial Fibrillation: Findings from RAF Study.

    Science.gov (United States)

    Acciarresi, Monica; Paciaroni, Maurizio; Agnelli, Giancarlo; Falocci, Nicola; Caso, Valeria; Becattini, Cecilia; Marcheselli, Simona; Rueckert, Christina; Pezzini, Alessandro; Morotti, Andrea; Costa, Paolo; Padovani, Alessandro; Csiba, Laszló; Szabó, Lilla; Sohn, Sung-Il; Tassinari, Tiziana; Abdul-Rahim, Azmil H; Michel, Patrik; Cordier, Maria; Vanacker, Peter; Remillard, Suzette; Alberti, Andrea; Venti, Michele; D'Amore, Cataldo; Scoditti, Umberto; Denti, Licia; Orlandi, Giovanni; Chiti, Alberto; Gialdini, Gino; Bovi, Paolo; Carletti, Monica; Rigatelli, Alberto; Putaala, Jukka; Tatlisumak, Turgut; Masotti, Luca; Lorenzini, Gianni; Tassi, Rossana; Guideri, Francesca; Martini, Giuseppe; Tsivgoulis, Georgios; Vadikolias, Kostantinos; Liantinioti, Chrissoula; Corea, Francesco; Del Sette, Massimo; Ageno, Walter; De Lodovici, Maria Luisa; Bono, Giorgio; Baldi, Antonio; D'Anna, Sebastiano; Sacco, Simona; Carolei, Antonio; Tiseo, Cindy; Imberti, Davide; Zabzuni, Dorjan; Doronin, Boris; Volodina, Vera; Consoli, Domenico; Galati, Franco; Pieroni, Alessio; Toni, Danilo; Monaco, Serena; Baronello, Mario Maimone; Barlinn, Kristian; Pallesen, Lars-Peder; Kepplinger, Jessica; Bodechtel, Ulf; Gerber, Johannes; Deleu, Dirk; Melikyan, Gayane; Ibrahim, Faisal; Akhtar, Naveed; Mosconi, Maria Giulia; Lees, Kennedy R

    2017-06-01

    The aim of this study was to investigate for a possible association between both prestroke CHA 2 DS 2 -VASc score and the severity of stroke at presentation, as well as disability and mortality at 90 days, in patients with acute stroke and atrial fibrillation (AF). This prospective study enrolled consecutive patients with acute ischemic stroke, AF, and assessment of prestroke CHA 2 DS 2 -VASc score. Severity of stroke was assessed on admission using the National Institutes of Health Stroke Scale (NIHSS) score (severe stroke: NIHSS ≥10). Disability and mortality at 90 days were assessed by the modified Rankin Scale (mRS <3 or ≥3). Multiple logistic regression was used to correlate prestroke CHA 2 DS 2 -VASc and severity of stroke, as well as disability and mortality at 90 days. Of the 1020 patients included in the analysis, 606 patients had an admission NIHSS score lower and 414 patients higher than 10. At 90 days, 510 patients had mRS ≥3. A linear correlation was found between the prestroke CHA 2 DS 2 -VASc score and severity of stroke (P = .001). On multivariate analysis, CHA 2 DS 2 -VASc score correlated with severity of stroke (P = .041) and adverse functional outcome (mRS ≥3) (P = .001). A logistic regression with the receiver operating characteristic graph procedure (C-statistics) evidenced an area under the curve of .60 (P = .0001) for severe stroke. Furthermore, a correlation was found between prestroke CHA 2 DS 2 -VASc score and lesion size. In patients with AF, in addition to the risk of stroke, a high CHA 2 DS 2 -VASc score was independently associated with both stroke severity at onset and disability and mortality at 90 days. Copyright © 2017 National Stroke Association. Published by Elsevier Inc. All rights reserved.

  6. Predictive value of CHADS2 and CHA2DS2-VASc scores for acute myocardial infarction in patients with atrial fibrillation.

    Science.gov (United States)

    Pang, Hui; Han, Bing; Fu, Qiang; Zong, Zhenkun

    2017-07-05

    The presence of acute myocardial infarction (AMI) confers a poor prognosis in atrial fibrillation (AF), associated with increased mortality dramatically. This study aimed to evaluate the predictive value of CHADS 2 and CHA 2 DS 2 -VASc scores for AMI in patients with AF. This retrospective study enrolled 5140 consecutive nonvalvular AF patients, 300 patients with AMI and 4840 patients without AMI. We identified the optimal cut-off values of the CHADS 2 and CHA 2 DS 2 -VASc scores each based on receiver operating characteristic curves to predict the risk of AMI. Both CHADS 2 score and CHA 2 DS 2 -VASc score were associated with an increased odds ratio of the prevalence of AMI in patients with AF, after adjustment for hyperlipidaemia, hyperuricemia, hyperthyroidism, hypothyroidism and obstructive sleep apnea. The present results showed that the area under the curve (AUC) for CHADS 2 score was 0.787 with a similar accuracy of the CHA 2 DS 2 -VASc score (AUC 0.750) in predicting "high-risk" AF patients who developed AMI. However, the predictive accuracy of the two clinical-based risk scores was fair. The CHA 2 DS 2 -VASc score has fair predictive value for identifying high-risk patients with AF and is not significantly superior to CHADS 2 in predicting patients who develop AMI.

  7. Camellia sinensis

    African Journals Online (AJOL)

    STORAGESEVER

    2008-05-16

    May 16, 2008 ... 1Department of Applied Microbiology and Brewing, Nnamdi Azikiwe University, P. M. B 5025, Awka, Nigeria. ... It is isolated from silo, vegetable, dairy foods, red meat ... organism is recognized as a food-borne pathogen. The.

  8. Identification, characterization and utilization of unigene derived microsatellite markers in tea (Camellia sinensis L.

    Directory of Open Access Journals (Sweden)

    Mohapatra Trilochan

    2009-05-01

    Full Text Available Abstract Background Despite great advances in genomic technology observed in several crop species, the availability of molecular tools such as microsatellite markers has been limited in tea (Camellia sinensis L.. The development of microsatellite markers will have a major impact on genetic analysis, gene mapping and marker assisted breeding. Unigene derived microsatellite (UGMS markers identified from publicly available sequence database have the advantage of assaying variation in the expressed component of the genome with unique identity and position. Therefore, they can serve as efficient and cost effective alternative markers in such species. Results Considering the multiple advantages of UGMS markers, 1,223 unigenes were predicted from 2,181 expressed sequence tags (ESTs of tea (Camellia sinensis L.. A total of 109 (8.9% unigenes containing 120 SSRs were identified. SSR abundance was one in every 3.55 kb of EST sequences. The microsatellites mainly comprised of di (50.8%, tri (30.8%, tetra (6.6%, penta (7.5% and few hexa (4.1% nucleotide repeats. Among the dinucleotide repeats, (GAn.(TCn were most abundant (83.6%. Ninety six primer pairs could be designed form 83.5% of SSR containing unigenes. Of these, 61 (63.5% primer pairs were experimentally validated and used to investigate the genetic diversity among the 34 accessions of different Camellia spp. Fifty one primer pairs (83.6% were successfully cross transferred to the related species at various levels. Functional annotation of the unigenes containing SSRs was done through gene ontology (GO characterization. Thirty six (60% of them revealed significant sequence similarity with the known/putative proteins of Arabidopsis thaliana. Polymorphism information content (PIC ranged from 0.018 to 0.972 with a mean value of 0.497. The average heterozygosity expected (HE and observed (Ho obtained was 0.654 and 0.413 respectively, thereby suggesting highly heterogeneous nature of tea. Further, test

  9. VizieR Online Data Catalog: Galactic CHaMP. II. Dense gas clumps. (Ma+, 2013)

    Science.gov (United States)

    Ma, B.; Tan, J. C.; Barnes, P. J.

    2015-04-01

    A total of 303 dense gas clumps have been detected using the HCO+(1-0) line in the CHaMP survey (Paper I, Barnes et al. 2011, J/ApJS/196/12). In this article we have derived the SED for these clumps using Spitzer, MSX, and IRAS data. The Midcourse Space Experiment (MSX) was launched in 1996 April. It conducted a Galactic plane survey (0MSX band wavelengths are centered at 8.28, 12.13, 14.65, and 21.3um. The best image resolution is ~18" in the 8.28um band, with positional accuracy of about 2". Calibrated images of the Galactic plane were obtained from the online MSX image server at the IPAC website. The IRAS performed an all-sky survey at 12, 25, 60, and 100um. The nominal resolution is about 4' at 60um. High Resolution Image Restoration (HIRES) uses the maximum correlation method to produce higher resolution images, better than 1' at 60um. Sources chosen for processing with HIRES were processed at all four IRAS bands with 20 iterations. The Spitzer InfraRed Array Camera (IRAC) is a four-channel camera that provides simultaneous 5.2"x5.2" images at 3.6, 4.5, 5.8, and 8um with an angular resolution of about 2" at 8um. We searched the Spitzer archive at IPAC. Most of these data are from two large survey programs: PID 189 (Churchwell, E., "The SIRTF Galactic Plane Survey") and PID 40791 (Majewski, S., "Galactic Structure and Star Formation in Vela-Carina"). Hill et al. (2005, J/MNRAS/363/405) carried out a 1.2mm continuum emission survey toward 131 star-forming complexes using the Swedish ESO Submillimetre Telescope (SEST) IMaging Bolometer Array (SIMBA). Hill et al. list the 1.2mm flux for 404 sources, 15 of which are in our sample. (2 data files).

  10. Influencia de abonos verdes sobre la dinámica de nitrógeno en un Typic Haplustert del Valle del Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    Breno Augusto Sosa Rodrígues

    2014-12-01

    Full Text Available Este estudio abordó el metabolismo del N, mediado por prácticas agroecológicas como los abonos verdes (AV, que incluyen leguminosas asociadas con rizobios -micorriza arbuscular y mejoran la nutrición de nitrógeno y fósforo. Se evaluó su influencia en la dinámica del nitrógeno de un Typic Haplustert en Candelaria (Colombia. En bloques completos al azar con seis repeticiones, se asoció como AV Mucuna pruriens L. var. Utilis - Zea mays L. var. ICA 305 (tratamiento 1- T1 y, la arvense nativa Rottboellia cochinchinensis L. como Tratamiento 2 - T2. En prefloración de M. pruriens se evaluó en el suelo el contenido de C orgánico (CO, N total (NT, nitrato, amonio, número de copias de gen amoA de las bacterias oxidantes de amonio (BOA, porosidad total del suelo (PPA, temperatura, flujo de gases con efecto invernadero: metano (CH4, dióxido de carbono (CO2 y óxido nitroso (N2O; la materia seca (MS y el contenido de C, N y P en tejidos vegetales. Se registraron concentraciones significativamente (p<0.05 altas de CO, NT, amonio y nitrato, en T2. BOA fue significativamente mayor en T1, coincidiendo con mayor PPA y menor temperatura del suelo. El CO2 atmosférico fue significativamente menor en T1, mientras que CH4 y N2O alcanzaron los valores más altos. Al finalizar el ensayo, AV en T1 aportó cerca de 4 t MS/ha, 1668.3 kg C/ha, 78.7 kg N/ha y 11.0 kg P/ha, con beneficio económico-social de 9.2 ton choclo/ha.

  11. Functional Characterization of Tea (Camellia sinensis MYB4a Transcription Factor Using an Integrative Approach

    Directory of Open Access Journals (Sweden)

    Mingzhuo Li

    2017-06-01

    Full Text Available Green tea (Camellia sinensis, Cs abundantly produces a diverse array of phenylpropanoid compounds benefiting human health. To date, the regulation of the phenylpropanoid biosynthesis in tea remains to be investigated. Here, we report a cDNA isolated from leaf tissues, which encodes a R2R3-MYB transcription factor. Amino acid sequence alignment and phylogenetic analysis indicate that it is a member of the MYB4-subgroup and named as CsMYB4a. Transcriptional and metabolic analyses show that the expression profile of CsMYB4a is negatively correlated to the accumulation of six flavan-3-ols and other phenolic acids. GFP fusion analysis shows CsMYB4a’s localization in the nucleus. Promoters of five tea phenylpropanoid pathway genes are isolated and characterized to contain four types of AC-elements, which are targets of MYB4 members. Interaction of CsMYB4a and five promoters shows that CsMYB4a decreases all five promoters’ activity. To further characterize its function, CsMYB4a is overexpressed in tobacco plants. The resulting transgenic plants show dwarf, shrinking and yellowish leaf, and early senescence phenotypes. A further genome-wide transcriptomic analysis reveals that the expression levels of 20 tobacco genes involved in the shikimate and the phenylpropanoid pathways are significantly downregulated in transgenic tobacco plants. UPLC-MS and HPLC based metabolic profiling reveals significant reduction of total lignin content, rutin, chlorogenic acid, and phenylalanine in CsMYB4a transgenic tobacco plants. Promoter sequence analysis of the 20 tobacco genes characterizes four types of AC-elements. Further CsMYB4a-AC element and CsMYB4a-promoter interaction analyses indicate that the negative regulation of CsMYB4a on the shikimate and phenylpropanoid pathways in tobacco is via reducing promoter activity. Taken together, all data indicate that CsMYB4a negatively regulates the phenylpropanoid and shikimate pathways.Highlight: A tea (Camellia

  12. Ionizing radiation effect on teas of Camellia sinensis plant irradiated with different water activities

    International Nuclear Information System (INIS)

    Fanaro, Gustavo Bernardes

    2013-01-01

    Tea is the most consumed beverage in the world. Teas from Camellia sinensis plant have high levels of antioxidants, which mean that they may have several beneficial effects on health preservation. For centuries, mankind looks for ways to conserve better and for a longer time the food that they eat. The food irradiation process is a largely technique used worldwide, and is recommended by many health agencies and authorities of several countries. The radiation interacts with the material causing two kinds of effects, the direct and the indirect effect. In the direct effect the radiation interacts with the DNA molecule, breaking it, and then inactivates the cell. In the indirect effect, which represents 70% of the interaction, the radiation breaks the water molecule in a process denominated radiolysis, creating a number of free radicals that will interact with the cellular components, leading to the cell death. Therefore, the aim of this work is to study the effects of gamma radiation on two kinds of tea from Camellia sinensis plant irradiated with different water activities. The green tea and black tea samples had their Aw adjusted to three values (high Aw, medium Aw, and low Aw). The samples were irradiated in 60 Co source at doses of 0, 1.0, 1.5, 2.0, 2.5, 5.0, 7.5, and 10.0 kGy. The analyses used were: microbiology by plate count, total phenolic compounds quantification, antioxidant activity by ORAC assay, and identification and quantification of main antioxidants in these beverages. It was noted that the greater the quantity of free water present in the medium, the lower was the dose to achieve microbiological control. The green tea showed to be a little more susceptible to irradiation by high Aw once there was more variation in the amount of flavonoids and phenolics than the black tea, decreasing the amount of these compounds in some doses, but increasing the amount in other ones. However in both teas, these changes can be considered insignificant, since there

  13. Start-up and commercial operation of the Laguna Verde power plants, unit 1

    International Nuclear Information System (INIS)

    Torres R, J.F.

    1991-01-01

    The main features of the unit 1 of the Laguna Verde Power Plant is presented as well as the phases of the start-up process. The process includes various steps and tests up to start the commercial operation. (author)

  14. Options for In Situ Capping of Palos Verdes Shelf Contaminated Sediments

    National Research Council Canada - National Science Library

    Palermo, Michael; Schroeder, Paul; Rivera, Yilda; Ruiz, Carlos; Clarke, Doug; Gailani, Joe; Clausner, James; Hynes, Mary; Fredette, Thomas; Tardy, Barbara

    1999-01-01

    The U.S. Army Engineer Waterways Experiment Station (WES) has performed an evaluation of in situ capping options for sediment restoration of DDT and PCB contaminated sediments on the Palos Verdes (PV...

  15. NPDES Permit for Mesa Verde National Park Water Treatment Plant in Colorado

    Science.gov (United States)

    Under NPDES permit number CO-0034462, the United States Department of the Interior, National Park Service is authorized to discharge from the Mesa Verde National Park water treatment plant, in Montezuma County, Colo.

  16. Effects of past and future groundwater development on the hydrologic system of Verde Valley, Arizona

    Science.gov (United States)

    Garner, Bradley D.; Pool, D.R.

    2013-01-01

    Communities in central Arizona’s Verde Valley must manage limited water supplies in the face of rapidly growing populations. Developing groundwater resources to meet human needs has raised questions about the effects of groundwater withdrawals by pumping on the area’s rivers and streams, particularly the Verde River. U.S. Geological Survey hydrologists used a regional groundwater flow model to simulate the effects of groundwater pumping on streamflow in the Verde River. The study found that streamflow in the Verde River between 1910 and 2005 had been reduced as the result of streamflow depletion by groundwater pumping, also known as capture. Additionally, using three hypothetical scenarios for a period from 2005 to 2110, the study’s findings suggest that streamflow reductions will continue and may increase in the future.

  17. The role of eclogite in the mantle heterogeneity at Cape Verde

    DEFF Research Database (Denmark)

    Barker, Abigail Katrine; Holm, Paul Martin; Troll, Valentin R.

    2014-01-01

    The Cape Verde hotspot, like many other Ocean Island Basalt provinces, demonstrates isotopic heterogeneity on a 100–200 km scale. The heterogeneity is represented by the appearance of an EM1-like component at several of the southern islands and with a HIMU-like component present throughout...... have been limited. We apply the minor elements in olivine approach (Sobolev et al. in Nature 434:590–597, 2005; Science, doi:10.1126/science.1138113, 2007), to determine and quantify the contributions of peridotite, pyroxenite and eclogite melts to the mantle heterogeneity observed at Cape Verde. Cores...... of olivine phenocrysts of the Cape Verde volcanics have low Mn/FeO and low Ni*FeO/MgO that deviate from the negative trend of the global array. The global array is defined by mixing between peridotite and pyroxenite, whereas the Cape Verde volcanics indicate contribution of an additional eclogite source...

  18. New species of Rissoidae from the Cape Verde Islands (Mollusca: Gastropoda) Part 1

    OpenAIRE

    Moolenbeek, R.G.; Rolán, E.

    1988-01-01

    Sediment samples collected at the Cape Verde Islands contained many interesting micromolluscs. Amongst them, four new species of the family Rissoidae ( Alvania peli, A. nicolauensis, A. stocki and A. planciusi).

  19. Search for neutrino oscillations at the palo verde nuclear reactors

    Science.gov (United States)

    Boehm; Busenitz; Cook; Gratta; Henrikson; Kornis; Lawrence; Lee; McKinny; Miller; Novikov; Piepke; Ritchie; Tracy; Vogel; Wang; Wolf

    2000-04-24

    We report on the initial results from a measurement of the antineutrino flux and spectrum at a distance of about 800 m from the three reactors of the Palo Verde Nuclear Generating Station using a segmented gadolinium-loaded scintillation detector. We find that the antineutrino flux agrees with that predicted in the absence of oscillations excluding at 90% C.L. nu;(e)-nu;(x) oscillations with Deltam(2)>1.12x10(-3) eV(2) for maximal mixing and sin (2)2straight theta>0.21 for large Deltam(2). Our results support the conclusion that the atmospheric neutrino oscillations observed by Super-Kamiokande do not involve nu(e).

  20. Laguna Verde simulator: A new TRAC-RT based application

    International Nuclear Information System (INIS)

    Munoz Cases, J.J.; Tanarro Onrubia, A.

    2006-01-01

    In a partnership with GSE Systems, TECNATOM is developing a full scope training simulator for Laguna Verde Unit 2 (LV2). The simulator design is based upon the current 'state-of-the art technology' regarding the simulation platform, instructor station, visualization tools, advanced thermalhydraulics and neutronics models, I/O systems and automated model building technology. When completed, LV2 simulator will achieve a remarkable level of modeling fidelity by using TECNATOM's TRAC-RT advanced thermalhydraulic code for the reactor coolant and main steam systems, and NEMO neutronic model for the reactor core calculations. These models have been utilized up to date for the development or upgrading of nine NPP simulators in Spain and abroad, with more than 8000 hours of training sessions, and have developed an excellent reputation for its robustness and high fidelity. (author)

  1. Techos verdes: una alternativa ecológica

    Directory of Open Access Journals (Sweden)

    Maureen Trebilcock Kelly

    2001-06-01

    Full Text Available Es un hecho que estamos pavimentando nuestro Planeta. Durante el siglo XX, hemos construido aceleradamente ciudades y carreteras, cubriendo y destruyendo, en este proceso, nuestra tierra. Este hecho es más evidente en las áreas urbanas, que aparecen sobrepavimentadas, donde la vegetación cubre apenas un tercio de la superficie, comparado con un 75 a 95% de las áreas rurales. En Chile, las áreas urbanas crecen sin límite aparente, especialmente nuestra capital, con escasez de áreas verdes y con un alarmante aumento en los niveles de contaminación atmosférica y acústica.

  2. Radiological protection in Laguna Verde, the challenge of being better

    International Nuclear Information System (INIS)

    Serrano R, H.

    2008-01-01

    The operation of the nuclear power plants in the last decade is based on the application of standard directed towards the excellence. The nuclear power plant of Laguna Verde (CNLV), is not the exception and in the 18 years of commercial operation, the safety culture has matured in the personnel. Standard and political implemented like in the control of dosimeter alarms, equipment condition, meetings pre-work, the practice of protection to the systems and the fuel, as well as the order and the cleaning have distinguished to the CNLV with other power stations. The sense of property of the personnel towards its work is fundamental for the achievement of results. It is reason for the present work to show since it has been gotten to obtain results directed to the excellence in the activities or of normal operation and recharge, where the security is the principle priority. (Author)

  3. O golfe e os rumos do Cabo Verde independente = Golfing and the independent Cape Verde directions = El golf y los caminos del Cabo Verde independiente

    Directory of Open Access Journals (Sweden)

    Melo, Victor Andrade de

    2016-01-01

    Full Text Available Em função de uma série de peculiaridades, o golfe tem desempenhado um importante papel na história de Cabo Verde. A prática, que tem uma longa trajetória no arquipélago, em diversas ocasiões foi mobilizada a fim de materializar a ideia de que o cabo-verdiano era portador de um alto padrão civilizacional. No período colonial, essa foi uma das estratégias pelos nativos usada para lidar com o jugo da metrópole, argumento utilizado para requisitar maior respeito às especificidades e atenção às necessidades locais. O que terá mudado nas considerações sobre esse esporte quando chegou a independência (1975? Que diferenças podem ser sentidas nas décadas seguintes? Neste artigo, argumentamos que os discursos sobre a modalidade nos ajudam a lançar um olhar sobre os debates acerca dos rumos do país insular nos últimos 40 anos

  4. Developing and modeling of the 'Laguna Verde' BWR CRDA benchmark

    International Nuclear Information System (INIS)

    Solis-Rodarte, J.; Fu, H.; Ivanov, K.N.; Matsui, Y.; Hotta, A.

    2002-01-01

    Reactivity initiated accidents (RIA) and design basis transients are one of the most important aspects related to nuclear power reactor safety. These events are re-evaluated whenever core alterations (modifications) are made as part of the nuclear safety analysis performed to a new design. These modifications usually include, but are not limited to, power upgrades, longer cycles, new fuel assembly and control rod designs, etc. The results obtained are compared with pre-established bounding analysis values to see if the new core design fulfills the requirements of safety constraints imposed on the design. The control rod drop accident (CRDA) is the design basis transient for the reactivity events of BWR technology. The CRDA is a very localized event depending on the control rod insertion position and the fuel assemblies surrounding the control rod falling from the core. A numerical benchmark was developed based on the CRDA RIA design basis accident to further asses the performance of coupled 3D neutron kinetics/thermal-hydraulics codes. The CRDA in a BWR is a mostly neutronic driven event. This benchmark is based on a real operating nuclear power plant - unit 1 of the Laguna Verde (LV1) nuclear power plant (NPP). The definition of the benchmark is presented briefly together with the benchmark specifications. Some of the cross-sections were modified in order to make the maximum control rod worth greater than one dollar. The transient is initiated at steady-state by dropping the control rod with maximum worth at full speed. The 'Laguna Verde' (LV1) BWR CRDA transient benchmark is calculated using two coupled codes: TRAC-BF1/NEM and TRAC-BF1/ENTREE. Neutron kinetics and thermal hydraulics models were developed for both codes. Comparison of the obtained results is presented along with some discussion of the sensitivity of results to some modeling assumptions

  5. Estrategias de mercadeo verde utilizadas por empresas a nivel mundial

    Directory of Open Access Journals (Sweden)

    Castellano, Susie

    2015-09-01

    Full Text Available La preocupación por el medio ambiente se ha convertido en una temática que inquieta a toda la colectividad actual, desde los más pequeños hasta los más grandes, desde la pequeña empresa hasta la gran industria. Sumado a esto, el auge de normativas ambientales que establecen regulaciones al empresario, los obliga a tener una mayor conciencia de los daños que pueden causar sus acciones al medio ambiente. Es por esto, que paulatinamente ha comenzado, por parte de las empresas, la adopción de estrategias en el área de mercadeo verde que les permita comercializar sus productos y servicios de forma que los mismos sean ambientalmente compatibles. En el presente trabajo, se abordaron las diferentes estrategias que han venido asumiendo empresas de diferente índole para hacer frente a tan importante filosofía en el ámbito mundial. Para tal fin, se hizo la revisión y contrastación de artículos escritos en el marco del mercadeo verde por Rivera y Molero (2006, Chamorro (2001, Samper y Echeverri (2008 principalmente, encontrándose que cada vez son más las empresas que se suman a esta forma de mercadear sus procesos y productos y más los consumidores que anteponen criterios ecológicos ante variables de otra índole, modificando sus hábitos de consumo.

  6. Palo Verde Generating Station, Units 4 and 5. License application, general information

    International Nuclear Information System (INIS)

    1978-01-01

    A license application for two more Palo Verde reactors, Units 4 and 5, is presented. The two PWR reactors have a nominal net generating power each of 1,270 MW(e). Containments are steel-lined prestressed cylindrical structures with hemispherical domes. The reactors are replicas of Palo Verde 1, 2 and 3 (see DOCKETS 50528, 50529 and 50530) using the standard Combustion Engineering System 80 (see DOCKET-STN-50470)

  7. Zoanthids of the Cape Verde Islands and their symbionts: previously unexamined diversity in the Northeastern Atlantic

    OpenAIRE

    Reimer, J.D.; Hirose, M.; Wirtz, P.

    2010-01-01

    The marine invertebrate fauna of the Cape Verde Islands contains many endemic species due to their isolated location in the eastern Atlantic, yet research has not been conducted on most taxa here. One such group are the zoanthids or mat anemones, an order of benthic cnidarians (Hexacorallia: Zoantharia) common in many marine environments. In this study, the diversity of zoanthids in the Cape Verde Islands is specifically examined for the first time. Field images and sampling are combined with...

  8. Bioconversion of Agave tequilana fructans by exo-inulinases from indigenous Aspergillus niger CH-A-2010 enhances ethanol production from raw Agave tequilana juice.

    Science.gov (United States)

    Huitrón, Carlos; Pérez, Rosalba; Gutiérrez, Luís; Lappe, Patricia; Petrosyan, Pavel; Villegas, Jesús; Aguilar, Cecilia; Rocha-Zavaleta, Leticia; Blancas, Abel

    2013-01-01

    Agave tequilana fructans are the source of fermentable sugars for the production of tequila. Fructans are processed by acid hydrolysis or by cooking in ovens at high temperature. Enzymatic hydrolysis is considered an alternative for the bioconversion of fructans. We previously described the isolation of Aspergillus niger CH-A-2010, an indigenous strain that produces extracellular inulinases. Here we evaluated the potential application of A. niger CH-A-2010 inulinases for the bioconversion of A. tequilana fructans, and its impact on the production of ethanol. Inulinases were analyzed by Western blotting and thin layer chromatography. Optimal pH and temperature conditions for inulinase activity were determined. The efficiency of A. niger CH-A-2010 inulinases was compared with commercial enzymes and with acid hydrolysis. The hydrolysates obtained were subsequently fermented by Saccharomyces cerevisiae to determine the efficiency of ethanol production. Results indicate that A. niger CH-A-2010 predominantly produces an exo-inulinase activity. Optimal inulinase activity occurred at pH 5.0 and 50 °C. Hydrolysis of raw agave juice by CH-A-2010 inulinases yielded 33.5 g/l reducing sugars, compared with 27.3 g/l by Fructozyme(®) (Novozymes Corp, Bagsværd, Denmark) and 29.4 g/l by acid hydrolysis. After fermentation of hydrolysates, we observed that the conversion efficiency of sugars into ethanol was 97.5 % of the theoretical ethanol yield for enzymatically degraded agave juice, compared to 83.8 % for acid-hydrolyzed juice. These observations indicate that fructans from raw Agave tequilana juice can be efficiently hydrolyzed by using A. niger CH-A-2010 inulinases, and that this procedure impacts positively on the production of ethanol.

  9. Impact of biocontrol Pseudomonas fluorescens CHA0 and a genetically modified derivative on the diversity of culturable fungi in the cucumber rhizosphere.

    Science.gov (United States)

    Girlanda, M; Perotto, S; Moenne-Loccoz, Y; Bergero, R; Lazzari, A; Defago, G; Bonfante, P; Luppi, A M

    2001-04-01

    Little is known about the effects of Pseudomonas biocontrol inoculants on nontarget rhizosphere fungi. This issue was addressed using the biocontrol agent Pseudomonas fluorescens CHA0-Rif, which produces the antimicrobial polyketides 2,4-diacetylphloroglucinol (Phl) and pyoluteorin (Plt) and protects cucumber from several fungal pathogens, including Pythium spp., as well as the genetically modified derivative CHA0-Rif(pME3424). Strain CHA0-Rif(pME3424) overproduces Phl and Plt and displays improved biocontrol efficacy compared with CHA0-Rif. Cucumber was grown repeatedly in the same soil, which was left uninoculated, was inoculated with CHA0-Rif or CHA0-Rif(pME3424), or was treated with the fungicide metalaxyl (Ridomil). Treatments were applied to soil at the start of each 32-day-long cucumber growth cycle, and their effects on the diversity of the rhizosphere populations of culturable fungi were assessed at the end of the first and fifth cycles. Over 11,000 colonies were studied and assigned to 105 fungal species (plus several sterile morphotypes). The most frequently isolated fungal species (mainly belonging to the genera Paecilomyces, Phialocephala, Fusarium, Gliocladium, Penicillium, Mortierella, Verticillium, Trichoderma, Staphylotrichum, Coniothyrium, Cylindrocarpon, Myrothecium, and Monocillium) were common in the four treatments, and no fungal species was totally suppressed or found exclusively following one particular treatment. However, in each of the two growth cycles studied, significant differences were found between treatments (e.g., between the control and the other treatments and/or between the two inoculation treatments) using discriminant analysis. Despite these differences in the composition and/or relative abundance of species in the fungal community, treatments had no effect on species diversity indices, and species abundance distributions fit the truncated lognormal function in most cases. In addition, the impact of treatments at the 32-day

  10. Ammonia IRMS-TPD measurements and DFT calculation on acidic hydroxyl groups in CHA-type zeolites.

    Science.gov (United States)

    Suzuki, Katsuki; Sastre, German; Katada, Naonobu; Niwa, Miki

    2007-12-07

    Brønsted acidity of H-chabazite (CHA) zeolites (Si : Al(2) = 4.2) was investigated by means of ammonia infrared-mass spectrometry/temperature-programmed desorption (IRMS-TPD) methods and density functional calculations. Four IR bands were observed at 3644, 3616, 3575 and 3538 cm(-1), and they were ascribable to the acidic OH groups on four nonequivalent oxygen sites in the CHA structure. The absorption band at 3538 cm(-1) was attributed to the O(4)H in the 6-membered ring (MR), and ammonia adsorption energy (DeltaU) of this OH group was the lowest among the 4 kinds of OH groups. The other 3 bands were assigned to the acidic OH groups in 8MR. It was observed that the DeltaU in 8 and 6MR were 131 (+/-3) and 101 kJ mol(-1), respectively. On the other hand, the density functional theory (DFT) calculations within periodic boundary conditions yielded the adsorption energies on these OH groups in 8 and 6MR to be ca. 130 and 110 kJ mol(-1), respectively, in good agreement with the experimentally-observed values.

  11. X-Ray Processing of ChaMPlane Fields: Methods and Initial Results for Selected Anti-Galactic Center Fields

    Science.gov (United States)

    Hong, JaeSub; van den Berg, Maureen; Schlegel, Eric M.; Grindlay, Jonathan E.; Koenig, Xavier; Laycock, Silas; Zhao, Ping

    2005-12-01

    We describe the X-ray analysis procedure of the ongoing Chandra Multiwavelength Plane (ChaMPlane) Survey and report the initial results from the analysis of 15 selected anti-Galactic center observations (90degusing custom-developed analysis tools appropriate for Galactic sources but also of general use: optimum photometry in crowded fields using advanced techniques for overlapping sources, rigorous astrometry and 95% error circles for combining X-ray images or matching to optical/IR images, and application of quantile analysis for spectral analysis of faint sources. We apply these techniques to 15 anti-Galactic center observations (of 14 distinct fields), in which we have detected 921 X-ray point sources. We present logN-logS distributions and quantile analysis to show that in the hard band (2-8 keV) active galactic nuclei dominate the sources. Complete analysis of all ChaMPlane anti-Galactic center fields will be given in a subsequent paper, followed by papers on sources in the Galactic center and bulge regions.

  12. Design optimization of the Laguna Verde nuclear power station fuel recharge; Optimacion del diseno de recargas de combustible para la Central Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Cortes Campos, Carlos Cristobal [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Montes Tadeo, Jose Luis [Instituto Nacional de Investigaciones Nucleares (ININ), Salazar (Mexico)

    1991-12-31

    It is described, in general terms, the procedure that is followed to accomplish the optimization of the recharge design, and an example is shown where this procedure was applied for the analysis of the type BWR reactor of Unit No. 1 of the Laguna Verde Nuclear Power Station. [Espanol] Se describe en terminos generales el procedimiento que se sigue para realizar la optimacion del diseno de recargas, y se muestra un ejemplo en el que se utilizo dicho procedimiento para el analisis del reactor tipo BWR de la unidad 1, de la Central Laguna Verde (CLV).

  13. Design optimization of the Laguna Verde nuclear power station fuel recharge; Optimacion del diseno de recargas de combustible para la Central Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Cortes Campos, Carlos Cristobal [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Montes Tadeo, Jose Luis [Instituto Nacional de Investigaciones Nucleares (ININ), Salazar (Mexico)

    1992-12-31

    It is described, in general terms, the procedure that is followed to accomplish the optimization of the recharge design, and an example is shown where this procedure was applied for the analysis of the type BWR reactor of Unit No. 1 of the Laguna Verde Nuclear Power Station. [Espanol] Se describe en terminos generales el procedimiento que se sigue para realizar la optimacion del diseno de recargas, y se muestra un ejemplo en el que se utilizo dicho procedimiento para el analisis del reactor tipo BWR de la unidad 1, de la Central Laguna Verde (CLV).

  14. Ammonia-oxidizing activity and microbial community structure in acid tea (Camellia sinensis) orchard soil

    International Nuclear Information System (INIS)

    Okamura, K; Yamada, T; Hiraishi, A; Takanashi, A

    2012-01-01

    The purpose of this study was to determine the ammonia-oxidizing activity and the phylogentic composition of microorganisms involved in acid tea (Camellia sinensis) orchard soil. All soil samples were collected from three sites located in Tahara and Toyohashi, Aichi Prefecture, Japan. The potential nitrification rate (PNR) was measured by the chlorate inhibition method. The soil pH of tea orchards studied ranged from 2.78 to 4.84, differing significantly from sample to sample, whereas that of meadow and unplanted fields ranged from 5.78 to 6.35. The PNR ranged from 0.050 to 0.193 μg NO 2 - -Ng -1 h -1 and were positively correlated with the soil pH (r 2 0.382, p 2 - -Ng -1 h -1 ) and subjected to PCR-aided clone library analyses targeting archaeal and bacterial amoA genes. The detected archaeal clones separated from the cluster of the 'Soil clones' and tightly clustered with the clones originating from other acidic soil environments including the Chinese tea orchard soil. These results suggest that the specific archaeal populations dominate as the ammonia oxidizers in acid tea-orchard soils and possibly other acid soils, independent of geographic locations, which results from the adaptation to specific ecological niches.

  15. Extraction and free radical scavenging activity of polysaccharide from 'Anji Baicha' (Camellia sinensis (L.) O. Kuntze).

    Science.gov (United States)

    Zhang, Zhongshan; Wang, Xiaomei; Li, Jingfen; Wang, Guozhi; Mao, Genxiang

    2016-03-01

    In this study, the optimization of the extraction conditions of polysaccharide from 'Anji Baicha' (Camellia sinensis (L.) O. Kuntze) (AP) was investigated by response surface methodology (RSM). Three main independent variables (extraction temperature, time, ratio of water to raw material) were taken into consideration. And then the free radical scavenging activities of the sample were investigated including scavenging effects of superoxide and hydroxyl radicals. The RSM analysis showed good correspondence between experimental and predicted values.. The optimal condition to obtain the highest yield of AP was determined as follows: temperature 76.79 °C, time 2.48 h, ratio of water to material 22.53 mL/g. For the free radical scavenging activity, the IC50 values of Vc and AP were 7.78 and 83.25 μg/mL. And for the scavenging effect on hydroxyl radical, that of AP and Vc were 1.80 and 1.69 mg/mL. AP showed excellent antioxidant activity. This exhibited AP had a good potential for antioxidant. The purification and structure needs to be study in further. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Efek Kumur Ekstrak Teh Hijab (Camellia sinensis terhadap Derajat Kesamaan dan Volume Saliva Penderita Gingivitis

    Directory of Open Access Journals (Sweden)

    Didi Adriano Anwar

    2015-10-01

    Full Text Available Gingivitis is an inflammatory condition of gingival tissue and caused by the accumulation of dental plaque. Green tea (Camellia sinensis is a plant matter that has been shown to inhibit the growth of acidogenic bacteria and the formation of dental plaque. This study aimed to evaluate the effects of green tea extract on pH and volume of saliva of gingivitis patients. The subjects were 30 male gingivitis patients, 18-25 years old. The subjects were divided into 3 groups according to mouthrinse used (0.25% and 0.5% green tea extract, and 0.1% hexetidine as positive control. The subjects were instructed to gargle during five consecutive days in the morning and at night with 5 ml of the mouthrinse for 30 seconds. The data were taken in the beginning and at the sixth day. Data for salivary volume and pH before and after gargle were compared using MANOVA (p<0.05. The results showed signifcant differences in salivary pH, suggesting that green tea extract can increase the salivary pH of gingivitis patients, and that the 0.5% concentration was the most influential.

  17. Optimization of Agrobacterium tumefaciens-Mediated Transformation Systems in Tea Plant (Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Qianru LV

    2017-05-01

    Full Text Available In this study, an efficient plant regeneration protocol in vitro and transformation by Agrobacterium-mediated method of Camellia sinensis was achieved, which would lay the foundation for genetic improvement of tea plant by genetic engineering technology. The cotyledon callus of C. sinensis were used as the receptors for transformation by Agrobacterium tumefaciens EHA105 containing PS1aG-3. Some factors which affected the result of Agrobacterium-mediated transformation of C. sinensis were studied on the basis of GUS transient expression system. The optimum system of Agrobacterium-mediated transformation was that the cotyledon callus were pre-cultured for 3 d, and then infected by EHA105 for 15 min followed by 3 d co-culture in the dark on the YEB medium containing 150 µmol⋅L−1 acetosyringone (AS. The transient expression rate of GUS gene was 62.6%. After being delayed selective culture for 3 d, infected callus were transferred into the differentiation medium and the root induction medium both of which were supplemented with 100 mg⋅L−1 spectinomycin, and then resistant seedlings of C. sinensis were obtained. The conversion rate was 3.6%.

  18. Metabolic phenotyping of various tea (Camellia sinensis L.) cultivars and understanding of their intrinsic metabolism.

    Science.gov (United States)

    Ji, Hyang-Gi; Lee, Yeong-Ran; Lee, Min-Seuk; Hwang, Kyeong Hwan; Kim, Eun-Hee; Park, Jun Seong; Hong, Young-Shick

    2017-10-15

    Recently, we selected three tea (Camellia sinensis) cultivars that are rich in taste, epigallocatechin-3-O-gallate (EGCG) and epigallocatechin-3-O-(3-O-methyl)-gallate (EGCG3″Me) and then cultivated them through asexual propagation by cutting in the same region. In the present study, proton nuclear magnetic resonance ( 1 H NMR)-based metabolomics was applied to characterize the metabotype and to understand the metabolic mechanism of these tea cultivars including wild type tea. Of the tea leaf metabolite variations, reverse associations of amino acid metabolism with catechin compound metabolism were found in the rich-taste, and EGCG- and EGCG3″Me-rich tea cultivars. Indeed, the metabolism of individual catechin compounds in the EGCG3″Me-rich cultivar differed from those of other tea cultivars. The current study highlights the distinct metabolism of various tea cultivars newly selected for cultivation and the important role of metabolomics in understanding the metabolic mechanism. Thus, comprehensive metabotyping is a useful method to assess and then develop a new plant cultivar. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Green Tea Extract (Camellia sinensis L. Effects on Uric Acid Levels on Hyperuricemia Rats (Rattus norvegicus

    Directory of Open Access Journals (Sweden)

    Putranty Widha Nugraheni

    2017-09-01

    Full Text Available Uric acid is the end product of purine degradation. When uric acid levels exceed normal limits, it will build up and cause hyperuricemia. Allopurinol is one of the most effective and common medicine for hyperuricemia, but it brings serious side effects, therefore it is needed alternative therapy for hyperuricemia. One plant that may be expected to low uric acid levels is green tea (Camellia sinensis L., that contains many antioxidants polyphenols, especially flavonoids. Flavonoid has strong antioxidant properties, act as free radical and metal scavengers, and also xanthine oxidase (XOD inhibitors. This study investigates the potential of green tea using various doses of 150 mg/kg, 300 mg/kg, and 600 mg/kg of body weight in 24 white male rats (Rattus norvegicus Wistar strain that has been received high purine diet in 60 consecutive days. This study used DHBSA methods to measure uric acid levels in blood serum and urine that excreted 8 hours before surgery. Green tea extract that contains polyphenol can inhibit XOD activities, therefore, it leads to decrease uric acid level in blood and increase the excretion through urine by modulating urate gene transporter. A therapy with 600 mg/kg body weight of GTE is the most effective dose to decrease uric acid levels in serum and to increase excretion of exceeding uric acid significantly (p < 0.01, from One Way ANOVA and Tukey analysis.

  20. In vitro inhibition of Helicobacter pylori urease with non and semi fermented Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Shoae Hassani A

    2009-01-01

    Full Text Available Purpose: Helicobacter pylori is the etiological agent in duodenal and peptic ulcers. The growing problem of antibiotic resistance by the organism demands the search for novel compounds, especially from natural sources. This study was conducted to evaluate the effect of Camellia sinensis extracts on the urease enzyme that is a major colonization factor for H. pylori. Methods: Minimum inhibitory concentrations of nonfermented and semifermented C. sinensis methanol: water extracts were assessed by broth dilution method. Examination of the urease function was performed by Mc Laren method, and urease production was detected on 12% SDS polyacrylamide gel electrophoresis from whole cell and membrane bound proteins. Results: Both extracts had inhibitory effects against H. pylori and urease production. At a concentration of 2.5 mg/ml of nonfermented extract and 3.5 mg/ml of semifermented extract the production of Ure A and Ure B subunits of the urease enzyme were inhibited completely. A concentration of 4 mg/ml of nonfermented and 5.5 mg/ml of semifermented extract were bactericidal for H. pylori. Conclusions: C. sinensis extracts, especially the nonfermented, could reduce H. pylori population and inhibit urease production at lower concentrations. The superior effect of nonfermented extract is due to its rich polyphenolic compounds and catechin contents.

  1. Foam Properties and Detergent Abilities of the Saponins from Camellia oleifera

    Science.gov (United States)

    Chen, Yu-Fen; Yang, Chao-Hsun; Chang, Ming-Shiang; Ciou, Yong-Ping; Huang, Yu-Chun

    2010-01-01

    The defatted seed meal of Camellia oleifera has been used as a natural detergent and its extract is commercially utilized as a foam-stabilizing and emulsifying agent. The goal of this study was to investigate the foam properties and detergent ability of the saponins from the defatted seed meal of C. oleifera. The crude saponin content in the defatted seed meal of C. oleifera was 8.34 and the total saponins content in the crude saponins extract was 39.5% (w/w). The foaming power of the 0.5 crude saponins extract solution from defatted seed meal of C. oleifera was 37.1 of 0.5 SLS solution and 51.3% to that of 0.5% Tween 80 solution. The R5 value of 86.0% represents good foam stability of the crude saponins extracted from the defatted seed meal of the plant. With the reduction of water surface tension from 72 mN/m to 50.0 mN/m, the 0.5% crude saponins extract solution has wetting ability. The sebum-removal experiment indicated that the crude saponins extract has moderate detergency. The detergent abilities of the saponins from C. oleifera and Sapindus mukorossi were also compared. PMID:21151446

  2. Black tea (camellia sinensis ) role in modulating antioxidant enzymes and biochemical changes in γ -irradiated rats

    International Nuclear Information System (INIS)

    Osman, N.N.; Hussien, E.M.; Farag, M.F.S.

    2009-01-01

    In the present work, we investigated the efficacy of camellia sinensis beverage in reducing gamma-irradiation - induced oxidative damage to the liver, lipid profile and antioxidant enzymes in adult male rats. Animals were received the black tea beverage (BTB) as a sole source of potable liquid for seven consecutive days before exposing them to single dose of 6 Gy whole-body gamma irradiation . The irradiated rats continued to receive BTB for 21 days before sacrifice. The effect of BTB was assessed by monitoring the plasma aspartate transaminase (AST), alanine transaminase (ALT), acid phosphatase (AcP), total cholesterol (TC), triglycerides (TG), high, low and very low density lipoproteins cholesterol (HDL-C,LDL-C and VLDL-C) as well as protein carbonyl content (PCC). In addition, the concentration of thiobarbituric acid-reactive substances (TBARS), reduced glutathione (GSH) and catalase activity (CAT) in blood and liver of experimental rats. It was observed that tea administration lowers significantly (p< 0.05), the plasma AST, ALT, AcP activities and TC, TG, LDL-C, VLDL-C and PCC concentration as well as blood and liver TBARS. The level of GSH and activity of CAT in the blood and liver tissue were however shown to be significantly elevated (p< 0.05).The results provide useful information for future investigations and strongly implicate the beneficial application of BTB

  3. Absorption and subcellular distribution of cadmium in tea plant (Camellia sinensis cv. "Shuchazao").

    Science.gov (United States)

    Cao, De-Ju; Yang, Xun; Geng, Geng; Wan, Xiao-Chun; Ma, Ru-Xiao; Zhang, Qian; Liang, Yue-Gan

    2018-03-21

    A hydroponic experiment was performed to investigate the Cd absorption and subcellular distribution in tea plant, Camellia sinensis. Increased Cd accumulation potential was observed in the tea plant in a Cd-enriched environment, but most of the Cd was absorbed by the roots of C. sinensis. The Cd in all the root fractions was mostly distributed in the soluble fraction, followed by the cell wall fraction. By contrast, the Cd was least distributed in the organelle fraction. The adsorption of Cd onto the C. sinensis roots was described well by the Langmuir isotherm model than the Freundlich isotherm. Most of the Cd (38.6 to 59.4%) was integrated with pectates and proteins in the roots and leaves. Fourier transform infrared spectroscopy (FTIR) analysis showed that small molecular organic substances, such as amino acids, organic acids, and carbohydrates with N-H, C=O, C-N, and O-H functional groups in the roots, bonded with Cd(II). The Cd accumulation in the C. sinensis leaves occurred in the cell wall and organelle fractions. C. sinensis has great capability to transport Cd, thereby indicating pollution risk. The metal homeostasis of Fe, Mn, Ca, and Mg in C. sinensis was affected when the Cd concentration was 1.0-15.0 mg/L.

  4. Ammonia-oxidizing activity and microbial community structure in acid tea (Camellia sinensis) orchard soil

    Science.gov (United States)

    Okamura, K.; Takanashi, A.; Yamada, T.; Hiraishi, A.

    2012-03-01

    The purpose of this study was to determine the ammonia-oxidizing activity and the phylogentic composition of microorganisms involved in acid tea (Camellia sinensis) orchard soil. All soil samples were collected from three sites located in Tahara and Toyohashi, Aichi Prefecture, Japan. The potential nitrification rate (PNR) was measured by the chlorate inhibition method. The soil pH of tea orchards studied ranged from 2.78 to 4.84, differing significantly from sample to sample, whereas that of meadow and unplanted fields ranged from 5.78 to 6.35. The PNR ranged from 0.050 to 0.193 μg NO2--Ng-1 h-1 and were positively correlated with the soil pH (r2 = 0.382, p<0.001). Bulk DNA was extracted from a tea orchard soil (pH 4.8; PNR, 0.078 μg NO2--Ng-1 h-1) and subjected to PCR-aided clone library analyses targeting archaeal and bacterial amoA genes. The detected archaeal clones separated from the cluster of the 'Soil clones' and tightly clustered with the clones originating from other acidic soil environments including the Chinese tea orchard soil. These results suggest that the specific archaeal populations dominate as the ammonia oxidizers in acid tea-orchard soils and possibly other acid soils, independent of geographic locations, which results from the adaptation to specific ecological niches.

  5. Estimating Biochemical Parameters of Tea (camellia Sinensis (L.)) Using Hyperspectral Techniques

    Science.gov (United States)

    Bian, M.; Skidmore, A. K.; Schlerf, M.; Liu, Y.; Wang, T.

    2012-07-01

    Tea (Camellia Sinensis (L.)) is an important economic crop and the market price of tea depends largely on its quality. This research aims to explore the potential of hyperspectral remote sensing on predicting the concentration of biochemical components, namely total tea polyphenols, as indicators of tea quality at canopy scale. Experiments were carried out for tea plants growing in the field and greenhouse. Partial least squares regression (PLSR), which has proven to be the one of the most successful empirical approach, was performed to establish the relationship between reflectance and biochemical concentration across six tea varieties in the field. Moreover, a novel integrated approach involving successive projections algorithms as band selection method and neural networks was developed and applied to detect the concentration of total tea polyphenols for one tea variety, in order to explore and model complex nonlinearity relationships between independent (wavebands) and dependent (biochemicals) variables. The good prediction accuracies (r2 > 0.8 and relative RMSEP < 10 %) achieved for tea plants using both linear (partial lease squares regress) and nonlinear (artificial neural networks) modelling approaches in this study demonstrates the feasibility of using airborne and spaceborne sensors to cover wide areas of tea plantation for in situ monitoring of tea quality cheaply and rapidly.

  6. White tea (Camellia sinensis extract reduces oxidative stress and triacylglycerols in obese mice

    Directory of Open Access Journals (Sweden)

    Lílian Gonçalves Teixeira

    2012-12-01

    Full Text Available White tea is an unfermented tea made from young shoots of Camellia sinensis protected from sunlight to avoid polyphenol degradation. Although its levels of catechins are higher than those of green tea (derived from the same plant, there are no studies addressing the relationship between this tea and obesity associated with oxidative stress.The objective of this study was to evaluate the effect of white tea on obesity and its complications using a diet induced obesity model. Forty male C57BL/6 mice were fed a high-fat diet to induce obesity (Obese group or the same diet supplemented with 0.5% white tea extract (Obese + WTE for 8 weeks. Adipose tissue, serum lipid profile, and oxidative stress were studied. White tea supplementation was not able to reduce food intake, body weight, or visceral adiposity. Similarly, there were no changes in cholesterol rich lipoprotein profile between the groups. A reduction in blood triacylglycerols associated with increased cecal lipids was observed in the group fed the diet supplemented with white tea. White tea supplementation also reduced oxidative stress in liver and adipose tissue. In conclusion, white tea extract supplementation (0.5% does not influence body weight or adiposity in obese mice. Its benefits are restricted to the reduction in oxidative stress associated with obesity and improvement of hypertriacylglycerolemia.

  7. Epigallocatechin gallate from Camellia sinensis L. (Kuntze is a potential quorum sensing inhibitor in Chromobacterium violaceum

    Directory of Open Access Journals (Sweden)

    Joemar C. Taganna

    2008-06-01

    Full Text Available The problem on the widespread occurrence of antibiotic resistant strains of bacteria calls for novel methods of control of bacterial activity. One of the new viable alternatives to antibiotics is the use of substances that inhibit quorum sensing (QS – a bacterial communication system that has been known to regulate the expression of virulence genes during infection. In this study, epigallocatechin gallate (EGCG from green tea, Camellia sinensis L. (Kuntze was tested for its ability to inhibit QS in a test organism, Chromobacterium violaceum. This microorganism produces a violet-colored substance, violacein, through QS. This study aimed to detect inhibition of QS-regulated violacein production in C. violaceum by EGCG and to determine the dynamics of QS inhibition relative to the concentration of EGCG. The effect of increasing concentration of EGCG on both violacein production and cell density of treated and untreated C. violaceum was determined in a 96-well-microplate format and read at 570nm and 620nm for violacein production and growth, respectively. The results show that addition of EGCG increased the growth of the organism while there is concentration-dependent decrease in the QS-controlled production of violacein. This study thus establishes that EGCG is a potential QS inhibitor and can be further studied and developed for its use as an anti-pathogenic but non-toxic drug.

  8. Conventional and accelerated-solvent extractions of green tea (camellia sinensis) for metabolomics-based chemometrics.

    Science.gov (United States)

    Kellogg, Joshua J; Wallace, Emily D; Graf, Tyler N; Oberlies, Nicholas H; Cech, Nadja B

    2017-10-25

    Metabolomics has emerged as an important analytical technique for multiple applications. The value of information obtained from metabolomics analysis depends on the degree to which the entire metabolome is present and the reliability of sample treatment to ensure reproducibility across the study. The purpose of this study was to compare methods of preparing complex botanical extract samples prior to metabolomics profiling. Two extraction methodologies, accelerated solvent extraction and a conventional solvent maceration, were compared using commercial green tea [Camellia sinensis (L.) Kuntze (Theaceae)] products as a test case. The accelerated solvent protocol was first evaluated to ascertain critical factors influencing extraction using a D-optimal experimental design study. The accelerated solvent and conventional extraction methods yielded similar metabolite profiles for the green tea samples studied. The accelerated solvent extraction yielded higher total amounts of extracted catechins, was more reproducible, and required less active bench time to prepare the samples. This study demonstrates the effectiveness of accelerated solvent as an efficient methodology for metabolomics studies. Copyright © 2017. Published by Elsevier B.V.

  9. Microwave-Assisted Extraction of Polyphenols from Camellia oleifera Fruit Hull

    Directory of Open Access Journals (Sweden)

    Jiahong Chen

    2011-05-01

    Full Text Available The abundant fruit hulls of tea-oil tree (Camellia oleifera are still underutilized and wastefully discaded to pollute the environment. In order to solve this problem and better utilize the fruit hulls of C. oleifera, a microwave-assisted extraction system was used to extract their polyphenols using water as the extraction solvent. A central composite design (CCD was used to monitor the effects of three extraction processing parameters – liquid:solid ratio (mL/g, extraction time (min and extraction temperature (°C – on the polyphenol yield (%. The results showed that the optimal conditions were liquid:solid ratio of 15.33:1 (mL/g, extraction time of 35 min and extraction temperature of 76 °C. Validation tests indicated that under the optimized conditions the actual yield of polyphenols was 15.05 ± 0.04% with RSD = 0.21% (n = 5, which was in good agreement with the predicted yield. Phenolic compounds in the extracts were analysed by HPLC, and gallic acid was found to be the predominant constituent. The total flavonoid content in the extracts was determined and high total flavonoid content was revealed (140.06 mg/g dry material.

  10. Metabolomic unveiling of a diverse range of green tea (Camellia sinensis) metabolites dependent on geography.

    Science.gov (United States)

    Lee, Jang-Eun; Lee, Bum-Jin; Chung, Jin-Oh; Kim, Hak-Nam; Kim, Eun-Hee; Jung, Sungheuk; Lee, Hyosang; Lee, Sang-Jun; Hong, Young-Shick

    2015-05-01

    Numerous factors such as geographical origin, cultivar, climate, cultural practices, and manufacturing processes influence the chemical compositions of tea, in the same way as growing conditions and grape variety affect wine quality. However, the relationships between these factors and tea chemical compositions are not well understood. In this study, a new approach for non-targeted or global analysis, i.e., metabolomics, which is highly reproducible and statistically effective in analysing a diverse range of compounds, was used to better understand the metabolome of Camellia sinensis and determine the influence of environmental factors, including geography, climate, and cultural practices, on tea-making. We found a strong correlation between environmental factors and the metabolome of green, white, and oolong teas from China, Japan, and South Korea. In particular, multivariate statistical analysis revealed strong inter-country and inter-city relationships in the levels of theanine and catechin derivatives found in green and white teas. This information might be useful for assessing tea quality or producing distinct tea products across different locations, and highlights simultaneous identification of diverse tea metabolites through an NMR-based metabolomics approach. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. PENGGUNAAN EKSTRAK TEH HIJAU (Camellia sinensis SEBAGAI PENGHAMBAT PEMBENTUKAN HISTAMIN PADA IKAN SEBELUM DIOLAH

    Directory of Open Access Journals (Sweden)

    Endang Sri Heruwati

    2009-12-01

    Full Text Available Penelitian penggunaan ekstrak teh hijau (Camellia sinensis sebagai penghambat pembentukan histamin pada ikan telah dilakukan. Ikan, terutama dari jenis skombroid, sangat rentan mengalami kerusakan karena terjadinya perubahan asam amino histidin yang terkandung dalam ikan menjadi senyawa histamin yang bersifat alergen, yang dikatalisasi oleh enzim histamin dekarboksilase (HDC. Teh hijau diketahui mengandung polifenol berupa senyawa epigalokatekingalat (EGCG yang merupakan penghambat enzim HDC, sehingga dekarboksilasi histidin menjadi histamin dapat dicegah. Perendaman ikan tongkol dalarn ekstrak teh hijau pada konsentrasi 0, 2, dan 4% dilakukan selama 30 menit, diikuti dengan pernindangan dalam larutan gararn 15% selama 30 menit diteruskan dengan penyimpanan ikan pindang pada suhu kamar. Pengambilan sampel dilakukan setiap hari selarna 4 hari penyimpanan untuk diamati perubahan mutu kimiawi (TVB dan kadar histarnin, mikrobiologi JPC dan bakteri pembentuk histamin, serta organoleptik (kenampakan, bau, tekstur, lendir, rasa. Hasil penelitian menunjukkan bahwa ikan yang direndam dalam ekstrak teh 4% mempunyai kadar histamin 21,3 ppm, jauh lebih rendah dibandingkan dengan ikan yang direndam dalam ekstrak teh 2% dan 0% yang masing-masing mencapai 64,4 pprn dan 101,4 ppm. Penghambatan pembentukan histamin oleh ekstrak teh hijau masih terjadi selama penyimpanan, yang terlihat dari rendahnya jumlah bakteri pembentuk histarnin dan kadar histamin dibandingkan dengan kontrol. Pada penyimpanan hari ke-3, penghambatan pembentukan histamin oleh ekstrak teh hijau tidak efektif, kemungkinan karena terlalu tingginya jurnlah bakteri pembentuk histamin, yaitu mencapai 108 cfu/g.

  12. Daya Antibakteri dan Waktu Kontak Infusa Teh Hijau (Camellia sinensis Terhadap Salmonella typhi Secara In Vitro

    Directory of Open Access Journals (Sweden)

    Dione Margareth Setiawan

    2010-06-01

    Full Text Available Green tea (Camellia sinensis contains cathecin which has been reported to have various pharmacologic properties, such as an antibacterial agent. Salmonella typhi, as agent of typhoid fever, remains a public health problem in tropical countries; about 20 million cases and 600.000 deaths annually all over the world. Objectives of this research were to observe the antibacterial activities and contact time of green tea infusion againsts Salmonella typhi by in vitro experiment. The experiment took place in Microbiology Laboratory, School of Medicine, Padjadjaran University, Bandung, March-April 2009. Methods: In vitro laboratory analytic study has been conducted on green tea infusion of Indonesian and Japanese commercial package againsts Salmonella typhi. The study used agar well diffusion method and analyzed by ANAVA and t-independent test. Results: Only at concentration of 40% (w/v, Indonesian green tea infusion gave an average inhibition area of 3.376±0.334 mm diameter, and 3.571±0.217 mm on Japanese package, while below 40% were 0.707±0.000 mm with no differences between both packages (p>0.551. There has been observed any turbidity in all Muller Hinton liquid media on both packages compared with control medium, also any growth of Salmonella typhi collony in all Muller Hinton agar at concentrations below 40%. Green tea infussion on both packages has been observed to have antibacterial activities at 40% but neither been observed at concentration below 40%.

  13. Antiatherogenic Effect of Camellia japonica Fruit Extract in High Fat Diet-Fed Rats

    Directory of Open Access Journals (Sweden)

    Hyun-Ho Lee

    2016-01-01

    Full Text Available Hypercholesterolemia is a well-known etiological factor for cardiovascular disease and a common symptom of most types of metabolic disorders. Camellia japonica is a traditional garden plant, and its flower and seed have been used as a base oil of traditional cosmetics in East Asia. The present study was carried out to evaluate the effect of C. japonica fruit extracts (CJF in a high fat diet- (HFD- induced hypercholesterolemic rat model. CJF was administered orally at three different doses: 100, 400, and 800 mg·kg−1·day−1 (CJF 100, 400, and 800, resp.. Our results showed that CJF possessed strong cholesterol-lowering potency as indicated by the decrease in serum total cholesterol (TC, triglyceride (TG, and low-density lipoprotein (LDL, accompanied by an increase in serum high-density lipoprotein (HDL. Furthermore, CJF reduced serum lipid peroxidation by suppressing the formation of thiobarbituric acid reactive substance. In addition, oil red O (ORO staining of rat arteries showed decreased lipid-positive staining in the CJF-treated groups compared to the control HFD group. Taken together, these results suggest that CJF could be a potent herbal therapeutic option and source of a functional food for the prevention and treatment of atherosclerosis and other diseases associated with hypercholesterolemia.

  14. Optimization of the Production of 1-Phenylethanol Using Enzymes from Flowers of Tea (Camellia sinensis Plants

    Directory of Open Access Journals (Sweden)

    Fang Dong

    2017-01-01

    Full Text Available 1-Phenylethanol (1PE can be used as a fragrance in food flavoring and cosmetic industries and as an intermediate in the pharmaceutical industry. 1PE can be synthesized from acetophenone, and the cost of 1PE is higher than the cost of acetophenone. Therefore, it is important to establish an effective and low-cost approach for producing 1PE. Our previous studies found that tea (Camellia sinensis flowers, which are an abundant and waste resource, contained enzymes that could transform acetophenone to 1PE. In the present study, we extracted crude enzymes from tea flowers and optimized the production conditions of 1PE using response surface methodology. The optimized conditions were an extraction pH of 7.0, a reaction pH of 5.3, a reaction temperature of 55 °C, a reaction time of 100 min, a coenzyme NADPH concentration of 3.75 μmol/mL in the reaction assay, and a substrate acetophenone concentration of 1.25 μmol/mL in the reaction assay. The results provide essential information for future industrial 1PE production using plant-derived enzymes.

  15. Study on the chemical components of shoots and leaves of Camellia oleifera from different elevations

    International Nuclear Information System (INIS)

    Wu, W.; Shu, Q.; Duan, W.

    2015-01-01

    The correlation between chemical components of shoot and leaf of Camellia oleifera and elevations were discussed, to provide theoretical basis for taking effective cultivation measures to promote the cold resistance of C. oleifera in the future Northward Movement of C. oleifera. The ratio of bound water to free water of the leaf, as well as the contents of holocellulose, cellulose, lignin and benzene-ethanol extracts were determined. The results showed that: In different elevations, the ratio of bound water to free water of the leaf varied from 0.11-0.22, the contents of holocellulose, cellulose, lignin and benzene-ethanol extracts varied from 25.08%-62.72%, 7.72%-36.61%, 11.80%-30.29% and 7.66%-8.57% respectively. In the same elevation, the content of benzene-ethanol extracts of leaf was higher than that of shoot, and the contents of other materials were quite the contrary. The elevation was positively correlated with the ratio of bound water to free water and the contents of holocellulose, cellulose, lignin and benzene-ethanol extracs. The chemical components of shoot and leaf represented extremely significant difference (p<0.01) among different elevations. In the future northward movement of C. oleifera, for the climate characteristics of cooler regions and higher elevation, a serious of cultivation measures, improving the contents of holocellulose, cellulose, lignin, benzene-ethanol extracts and the ratio of water to free water, were taken to improve the cold resistance of C. oleifera. (author)

  16. Nitrogen-doped porous carbon from Camellia oleifera shells with enhanced electrochemical performance

    International Nuclear Information System (INIS)

    Zhai, Yunbo; Xu, Bibo; Zhu, Yun; Qing, Renpeng; Peng, Chuan; Wang, Tengfei; Li, Caiting; Zeng, Guangming

    2016-01-01

    Nitrogen doped porous activated carbon was prepared by annealing treatment of Camellia oleifera shell activated carbon under NH 3 . We found that nitrogen content of activated carbon up to 10.43 at.% when annealed in NH 3 at 800 °C. At 600 °C or above, the N-doped carbon further reacts with NH 3 , leads to a low surface area down to 458 m 2 /g and low graphitization degree. X-ray photoelectron spectroscope (XPS) analysis indicated that the nitrogen functional groups on the nitrogen-doped activated carbons (NACs) were mostly in the form of pyridinic nitrogen. We discovered that the oxygen groups and carbon atoms at the defect and edge sites of graphene play an important role in the reaction, leading to nitrogen atoms incorporated into the lattice of carbon. When temperatures were lower than 600 °C the nitrogen atoms displaced oxygen groups and formed nitrogen function groups, and when temperatures were higher than 600 °C and ~ 4 at.% carbon atoms and part of oxygen function groups reacted with NH 3 . When compared to pure activated carbon, the nitrogen doped activated carbon shows nearly four times the capacitance (191 vs 51 F/g). - Highlights: • The nitrogen content up to 10.43 at % during CAC pyrolysis under NH3 at 800 °C. • The oxygen groups and carbon atoms played an important role in the nitrogen doping. • NAC-600 shows a much higher specific capacitance than CAC.

  17. Prestroke CHA2DS2-VASc Score and Severity of Acute Stroke in Patients with Atrial Fibrillation: findings from RAF Study

    OpenAIRE

    Acciarresi, Monica; Paciaroni, Maurizio; Agnelli, Giancarlo; Falocci, Nicola; Caso, Valeria; Becattini, Cecilia; Marcheselli, Simona; Rueckert, Christina; Pezzini, Alessandro; Morotti, Andrea; Costa, Paolo; Padovani, Alessandro; Csiba, László; Szabó, Lilla; Sohn, Sung-Il

    2017-01-01

    Background and Purpose:\\ud \\ud The aim of this study was to investigate for a possible association between both prestroke CHA2DS2-VASc score and the severity of stroke at presentation, as well as disability and mortality at 90 days, in patients with acute stroke and atrial fibrillation (AF).\\ud Methods:\\ud \\ud This prospective study enrolled consecutive patients with acute ischemic stroke, AF, and assessment of prestroke CHA2DS2-VASc score. Severity of stroke was assessed on admission using t...

  18. New biofunctional effects of the flower buds of Camellia sinensis and its bioactive acylated oleanane-type triterpene oligoglycosides.

    Science.gov (United States)

    Matsuda, Hisashi; Nakamura, Seikou; Morikawa, Toshio; Muraoka, Osamu; Yoshikawa, Masayuki

    2016-10-01

    We review the biofunctional effects of the flower buds of Camellia sinensis and C. sinensis var. assamica, such as antihyperlipidemic, antihyperglycemic, antiobesity, and gastroprotective effects in vivo, and antiallergic, pancreatic lipase inhibitory, and amyloid β (Aβ) aggregation inhibitory activities in vitro. Although the biofunctional effects of tea leaves have been extensively studied, less attention has been given to those of the flowers and seeds of the tea plant. Our studies focused on the saponin constituents of the extracts of the flower buds of C. sinensis cultivated in Japan and China, and C. sinensis var. assamica cultivated in India, and we review their beneficial biofunctions for health promotion.

  19. Is a changing climate affecting the tropical cyclone behavior of Cape Verde?

    Science.gov (United States)

    Emmenegger, T. W.; Mann, M. E.; Evans, J. L.

    2016-12-01

    An existing dataset of synthetic tropical cyclone (TC) tracks derived from climate change simulations were used to explore TC variability within a 250 km radius of the Cape Verde Islands (16.5388N, 23.0418W). The synthetic sets were examined according to genesis point location, track projection, intensity, frequency, and seasonality within the observational era (1851 AD to present). These factors of TC variability have been shown to be strongly related to climate oscillations, thus the historical era was grouped by the increasing and decreasing regimes of sea surface temperature (SST) in the main development region (MDR) of the Atlantic Ocean. Numerous studies have examined Atlantic Basin activity throughout this era; the goal of this study is to investigate possible variations in TC behavior around Cape Verde, ultimately determining whether Cape Verde experiences similar fluctuations in activity as observed basin-wide. We find that several facets of TC variability such as intensity, seasonality, and genesis point location around Cape Verde are not significantly different to that of the entire basin, thus forecasts of the entire basin in these respects may also apply to our site. A long-term trend of increasing TC frequency can be identified basin-wide within the observed set, yet activity around Cape Verde does not display this same behavior observably or in any synthetic set. A relationship between the location of genesis points and the regimes of SST fluctuation is shown to be existent. We find both more observed and synthetic genesis points within the vicinity of Cape Verde during cool periods, and an eastward and equatorward shift in cyclogenesis is evident during warm regimes. This southeastern shift in genesis points attributes to the increased intensities of TCs seen during periods of warmer SST. Years of increased SST are additionally linked to an earlier seasonality in Cape Verde.

  20. HLA polymorphisms in Cabo Verde and Guiné-Bissau inferred from sequence-based typing.

    Science.gov (United States)

    Spínola, Hélder; Bruges-Armas, Jácome; Middleton, Derek; Brehm, António

    2005-10-01

    Human leukocyte antigen (HLA)-A, -B, and -DRB1 polymorphisms were examined in the Cabo Verde and Guiné-Bissau populations. The data were obtained at high-resolution level, using sequence-based typing. The most frequent alleles in each locus was: A*020101 (16.7% in Guiné-Bissau and 13.5% in Cabo Verde), B*350101 (14.4% in Guiné-Bissau and 13.2% in Cabo Verde), DRB1*1304 (19.6% in Guiné-Bissau), and DRB1*1101 (10.1% in Cabo Verde). The predominant three loci haplotype in Guiné-Bissau was A*2301-B*1503-DRB1*1101 (4.6%) and in Cabo Verde was A*3002-B*350101-DRB1*1001 (2.8%), exclusive to northwestern islands (5.6%) and absent in Guiné-Bissau. The present study corroborates historic sources and other genetic studies that say Cabo Verde were populated not only by Africans but also by Europeans. Haplotypes and dendrogram analysis shows a Caucasian genetic influence in today's gene pool of Cabo Verdeans. Haplotypes and allele frequencies present a differential distribution between southeastern and northwestern Cabo Verde islands, which could be the result of different genetic influences, founder effect, or bottlenecks. Dendrograms and principal coordinates analysis show that Guineans are more similar to North Africans than other HLA-studied sub-Saharans, probably from ancient and recent genetic contacts with other peoples, namely East Africans.

  1. O verde produtivo na AMP no horizonte 2020

    Directory of Open Access Journals (Sweden)

    Hélder Marques

    2015-06-01

    Full Text Available Pensar a forma como se estruturará o verde produtivo na Área Metropolitana do Porto, num corte temporal que se fecha no horizonte 2020, implica não só um diagnóstico do que ele é, mas também, e sobretudo, a capacidade de compreender as principais alterações em curso, procurando distinguir as que são, ou parecem ser, meramente conjunturais, daquelas que, uma vez instaladas, têm capacidade suficiente para serem determinantes no curto e médio prazo. Depois é necessário estabelecer, em conformidade, os principais objetivos a atingir a partir dos desígnios das políticas públicas consensualizadas, ou seja, quais são os valores de largo espectro a atingir, neste caso a sustentabilidade dos sistemas produtivos, a adequação ambiental e paisagística, a que acresce a criação de valor. São também observadas as condicionantes, até porque o complexo agroflorestal é talvez aquele que, no domínio dos sistemas produtivos de criação de valor, está mais condicionado por decisões que são estranhas à nossa soberania, quer se trate da administração central ou local, quanto mais não fosse porque as políticas de incentivos e preços são essencialmente determinadas pela PAC. Passa-se, depois, a uma caracterização de síntese, recorrendo a um conjunto de indicadores, os quais, uma vez agregados em diferentes variáveis, permitem um maior poder heurístico. Fecha-se com um esboço e tipificação do modelo territorial expectável no curto prazo, assim como dos principais sistemas produtivos que lhe estão associados. Nesse sentido, foram definidos quatro macro territórios, a saber: i -Territórios de “interdição”; ii - Territórios de “renaturalização”; iii - Novos territórios de amenidade e dominância do verde produtivo; iv - Territórios de dominância das fileiras produtivas intensivas.

  2. Chuva de sementes em remanescentes florestais de Campo Verde, MT

    Directory of Open Access Journals (Sweden)

    William Pietro-Souza

    2014-08-01

    Full Text Available O objetivo deste trabalho consistiu em avaliar sazonalmente a produção de sementes provenientes de fragmentos florestais presentes na zona rural de Campo Verde, MT. Essa caracterização ocorreu em termos de produção de sementes e riqueza de espécies vegetais. Foram selecionados três fragmentos florestais caracterizados como Floresta Estacional Semidecidual. Em cada fragmento, cinco coletores foram instalados e confeccionados com canos de PVC (1 m²; malha de náilon de 0,001 m e 0,15 m de profundidade do bojo. O material foi coletado mensalmente, cujas sementes foram quantificadas e separadas conforme a síndrome de dispersão, etapa sucessional e forma de vida. Houve a determinação da densidade, frequência absoluta, índice de diversidade e equitabilidade. Ao todo, foram obtidas 3.622 sementes, pertencentes a 74 táxons. Maiores densidades de sementes foram observadas durante os meses de setembro, outubro e novembro. As lianas Gouania sp., Fridericia speciosa, Heteropterys sp. e Distictella sp. responderam com 55,95% do total de sementes aportadas. Das espécies que compuseram a chuva de sementes, 74% não são dispersas pelo vento. Todavia, quando se verificou a quantidade de diásporos coletados, formas dispersas pelo vento foram predominantes, representando 76% do total. Citam-se como táxons arbóreos importantes para a recomposição florestal na região de Campo Verde, situada no Sudeste de Mato Grosso: Tachigali rubiginosa, Siparuna guianensis, Nectandra sp., Cordia alliodora, Alibertia sp., Terminalia brasiliensis e Myrcia sp. Essas espécies devem ser alvo de estudos mais específicos relacionados ao seu potencial para recuperação de ambientes degradados, considerando-se as Áreas de Preservação Permanente e Reservas Legais.

  3. Modernization of the turbo in the Laguna Verde Nuclear Power Plant; Modernizacion del turbogrupo en la Central Nuclear de Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Liebana, B.; Merino, A.; Cobos, A.; Gonzalez, J. J.

    2010-07-01

    The power increase of the Laguna Verde Nuclear Power Plant is a project for the rehabilitation and modernization of the turbo and associated equipment to get an increase of its power and of its service life. The project scope includes the design, the engineering, the equipment supply, the installation, the testing and the commissioning. This paper describes the first phase of the project.

  4. Effect of nicotine and preventive role of camellia sinensis on the histomorphology of developing epiphyseal plate of thigh bone of chick

    International Nuclear Information System (INIS)

    Shan, M.; Butt, S.A.

    2014-01-01

    Objective: To determine the effect of nicotine and camellia sinensis (green tea) on the developing epiphyseal plate of thigh bone of chick. Design: Randomized controlled trial. Place and Duration of Study: Army medical college, Rawalpindi, Pakistan from April 2012 to May 2012. Material and Method: Freshly laid fertilized eggs of Fayoumi breed chick eggs were selected at zero hour of incubation. Four groups were made, group G1 was control group treated with normal saline. Experimental group G2 was treated with camellia sinensis extract (green tea), group G3 was given nicotine whereas group G4 was injected with working solution nicotine and camellia sinensis (green tea), in 0.1 ml quantity. Double exposure one at 48 hour of incubation and other at 48 hours after hatching of chicks. SPSS version 15 was used to analyze the data. Results: It was observed that the weight of chick at one month of age and weight of femur of chicks of nicotine treated groups G3 and group G4 were reduced in comparison to control group G1. Mean number of cells in hypertrophy zone of developing epiphyseal plate of thigh bone were reduced of nicotine treated groups in comparison to control group. Conclusion: Camellia sinensis (green tea) helped to reduce the harmful effects of nicotine treated group but cannot reverse the oxidative injury. (author)

  5. Profiling the Fatty Acids Content of Ornamental Camellia Seeds Cultivated in Galicia by an Optimized Matrix Solid-Phase Dispersion Extraction

    Directory of Open Access Journals (Sweden)

    Carmen Garcia-Jares

    2017-10-01

    Full Text Available Camellia (genus of flowering plants of fam. Theaceae is one of the main crops in Asia, where tea and oil from leaves and seeds have been utilized for thousands of years. This plant is excellently adapted to the climate and soil of Galicia (northwestern Spain and northern Portugal where it is grown not only as an ornamental plant, but to be evaluated as a source of bioactive compounds. In this work, the main fatty acids were extracted from Camellia seeds of four varieties of Camellia: sasanqua, reticulata, japonica and sinensis, by means of matrix-solid phase dispersion (MSPD, and analyzed by gas chromatography (GC with MS detection of the corresponding methyl esters. MSPD constitutes an efficient and greener alternative to conventional extraction techniques, moreover if it is combined with the use of green solvents such as limonene. The optimization of the MSPD extraction procedure has been conducted using a multivariate approach based on strategies of experimental design, which enabled the simultaneous evaluation of the factors influencing the extraction efficiency as well as interactions between factors. The optimized method was applied to characterize the fatty acids profiles of four Camellia varieties seeds, allowing us to compare their fatty acid composition.

  6. The external morphology of the mouthparts, and observations on feeding and behavior of Tuckerella japonica on Camellia sinensis in the continental United States

    Science.gov (United States)

    Tuckerella japonica Ehara (Acari: Tetranychoidea: Tuckerellidae) is found where longitudinal splitting occurs on exposed green periderm tissue of shoots on certain varieties or seedling plants of Camellia sinensis (L.) O. Kuntze (Theales: Theaceae) in the continental United States. The mite is able ...

  7. Profiling the Fatty Acids Content of Ornamental Camellia Seeds Cultivated in Galicia by an Optimized Matrix Solid-Phase Dispersion Extraction

    Science.gov (United States)

    Garcia-Jares, Carmen; Sanchez-Nande, Marta; Lamas, Juan Pablo; Lores, Marta

    2017-01-01

    Camellia (genus of flowering plants of fam. Theaceae) is one of the main crops in Asia, where tea and oil from leaves and seeds have been utilized for thousands of years. This plant is excellently adapted to the climate and soil of Galicia (northwestern Spain) and northern Portugal where it is grown not only as an ornamental plant, but to be evaluated as a source of bioactive compounds. In this work, the main fatty acids were extracted from Camellia seeds of four varieties of Camellia: sasanqua, reticulata, japonica and sinensis, by means of matrix-solid phase dispersion (MSPD), and analyzed by gas chromatography (GC) with MS detection of the corresponding methyl esters. MSPD constitutes an efficient and greener alternative to conventional extraction techniques, moreover if it is combined with the use of green solvents such as limonene. The optimization of the MSPD extraction procedure has been conducted using a multivariate approach based on strategies of experimental design, which enabled the simultaneous evaluation of the factors influencing the extraction efficiency as well as interactions between factors. The optimized method was applied to characterize the fatty acids profiles of four Camellia varieties seeds, allowing us to compare their fatty acid composition. PMID:29039745

  8. Chaînes d'exploits scénarios de hacking avancés et prévention

    CERN Document Server

    Whitaker, Andrew; Voth, Jack B

    2009-01-01

    Un pirate informatique s'appuie rarement sur une unique attaque, mais utilise plutôt des chaînes d'exploits, qui impliquent plusieurs méthodes et attaques coordonnées, pour atteindre sa cible et arriver à ses fins. Ces chaînes d'exploits sont généralement complexes et difficiles à prévenir. Or la plupart des ouvrages de sécurité ne les couvrent pas, ou sinon de manière superficielle. Cet ouvrage présente en profondeur les principales chaînes d'exploits qui sévissent actuellement. À travers des exemples basés sur des stratégies d'attaques réelles, utilisant les outils actuels les plus courants et visant des cibles importantes comme des données bancaires ou de sécurité sociale, vous découvrirez le spectre complet des attaques, des réseaux sans-fil à l'accès physique en passant par l'ingénierie sociale. Dans chaque scénario, les exploits sont décortiqués un à un en vue d'expliquer la chaîne qui va conduire à l'attaque finale. Les mesures de prévention à appliquer pour éviter...

  9. CHADS2 and modified CHA2DS2-VASc scores for the prediction of congestive heart failure in patients with nonvalvular atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Yorihiko Koeda

    2017-10-01

    Conclusion: Calculation of the CHADS2 and mCHA2DS2-VASc scores in order to evaluate the risk of systemic thromboembolism was useful to predict the onset of CHF, but not all-cause death, in patients with NVAF.

  10. Use of the CHA2DS2VASc score to reduce utilisation of transoesophageal echocardiography prior to ablation for atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Charlotte Atkinson

    2017-10-01

    Full Text Available Transoesophageal echocardiography (TOE is frequently performed prior to atrial fibrillation (AF ablation to exclude left atrial appendage (LAA thrombus. However, patients undergoing AF ablation are usually anticoagulated, thus making the presence of thrombus unlikely in most cases. This study aimed to determine whether the CHA2DS2VASc scoring system can be used to identify patients that do not require TOE prior to AF ablation. In this single-centre retrospective study, local institutional and primary care databases and electronic patient records were searched to identify patients that had undergone TOE prior to AF ablation. Patient demographics, CHA2DS2VASc score, TOE findings and anticoagulation status were collected for analysis. Over a 7-year period (2008–2014, 332 patients (age 57 ± 10 years; 74% male underwent TOE prior to proposed AF ablation. CHA2DS2VASc scores of 0, 1, 2 and >2 were found in 39, 34, 15 and 12% of patients, respectively. The prevalence of LAA thrombus was 0.6% (2 patients and these 2 patients had risk scores of 2 and 4. No patients with a score of 0 or 1 had LAA thrombus. Patients that are classed as low risk by the CHA2DS2VASc score do not require a pre-ablation TOE to screen for LAA thrombus provided they are adequately anticoagulated. This would lead to a significant reduction in health care expenditures by reducing unnecessary TOE requests and thereby improve patient experience.

  11. CHADS2 and CHA2DS2-VASc score to assess risk of stroke and death in patients paced for sick sinus syndrome

    DEFF Research Database (Denmark)

    Svendsen, Jesper Hastrup; Nielsen, Jens Cosedis; Darkner, Stine

    2013-01-01

    The risk of stroke in patients with atrial fibrillation (AF) can be assessed by use of the CHADS2 and the CHA2DS2-VASc score system. We hypothesised that these risk scores and their individual components could also be applied to patients paced for sick sinus syndrome (SSS) to evaluate risk of str...

  12. Decreased Renal Function Is Associated with Elevated CHA2DS2VASC and R2CHADS2 Scores in Non-Valvular Atrial Fibrillation Patients Presenting with Stroke.

    Science.gov (United States)

    Vindhyal, Mohinder; Vindhyal, Shravani R; Haneke, Travis; Ndunda, Paul M; Eid, Freidy; Kallail, K James

    2017-12-11

    Introduction Atrial fibrillation (AF), the most common cardiac arrhythmia, affects approximately 2.3 million patients in the United States, costing around $26 billion. Atrial fibrillation is associated with a two- to seven-fold increased risk of stroke, one of the most serious complications. Chronic kidney disease affects approximately 13% of the US population and has been associated with higher rates of AF than the general population. In patients with chronic kidney disease (CKD), the risk of stroke increases as the glomerular filtration rate (GFR) decreases, especially in CKD stages three and four. Several risks stratification scores such as CHADS2 (congestive heart failure, hypertension, age, diabetes mellitus, stroke), CHA2DS2VASc (congestive heart failure, hypertension, age, diabetes mellitus, stroke, vascular disease, age, sex), and R2CHADS2 (renal failure, congestive heart failure, age, diabetes, stroke) scores are used for stroke risk assessment in patients with non-valvular atrial fibrillation (NVAF). This study investigates the association between renal functions and risk stratification scoring systems in patients with non-valvular AF presenting with stroke. Methods Using the convenience sampling method, 171 subjects were selected from the eligible population (n = 386). A Pearson product-moment correlation coefficient was calculated to determine the association between the GFR and each of the CHA2DS2VASc and R2CHADS2 scores. In addition, a Pearson product-moment correlation coefficient was calculated to determine the association between the CHA2DS2VASc and R2CHADS2 scores. Results The selected population represented 44.3% of the eligible subjects. Of these, 88% were Caucasian, 60% were female, and the mean age was 78 years. The mean CHA2DS2VASc score was six (range 2-9). The mean eGFR was 69.77 (range 6-108). Both the mode and the median CHA2DS2VASc score was four (range 2-8). A weak, but significant, negative correlation was found between renal

  13. The geology of Pedra Verde region, Ceara, Brazil

    International Nuclear Information System (INIS)

    Korpershoek, H.R.; Mendonca, J.A.C. de; Torquato, J.R.

    1979-01-01

    The upper Proterozoic Mambira Formation (≥ 1.1000 m.y.) consists of > 1000 m of micaschists with subordinate quartzites and limestones, its upper part, the ''Pedra Verde Phyllite'', is composed of phyelitic slump breccias, with abundance of pyrite. The Mambira formation crops out in the west flank of the tope Anticline, formed by ∼ 600 m of quartzites with sillimanite and/or andalusite (Sao Joaquim Formation), underlain by granitoid gneisses, representing the amphibolite facies. The contact between the Sao Joaquim and Mabira Formations appears to be tectonic. The folding and the metamorphism of the latter date from the Brazilian Cycle, which also affected the gneisses, causing homogeneization of the whole-rock K/Ar ages around 500 m.y. After erosion of some 10.000 m of sedimentary re-activation of the faults, which may already have formed during the deposition of the Mambira Formation resulted in the development of the Ubari Graben. The above formations are unconformably overlain by 300-350 m of subhorizontal Shallow-Marine sandstones belonging to the Serra Grande Formation, of upper silurian to lower devonian ages [pt

  14. Analysis of the stability of events occurred in Laguna Verde

    International Nuclear Information System (INIS)

    Castillo D, R.; Ortiz V, J.; Calleros M, G.

    2005-01-01

    The new fuel designs for operation cycles more long have regions of uncertainty bigger that those of the old fuels, and therefore, they can have oscillations of power when an event is presented that causes that the reactor operates to high power and low flow of coolant. During the start up of the reactor there are continued procedures that avoid that oscillations are presented with that which makes sure the stable behavior of the reactor. However, when the reactor is operating to nominal conditions and they are shot or they are transferred to low speed the recirculation pumps, it cannot make sure that the reactor doesn't present oscillations of power when entering to the restricted operation regions. The methods of stability analysis commonly use signs of neutronic noise that require to be stationary, but after a transitory one where they commonly get lost the recirculation pumps the signs they don't have the required characteristics, for what they are used with certain level of uncertainty by the limited validity of the models. In this work the Prony method is used to determine the reactor stability, starting from signs of transitory and it is compared with autoregressive models. Four events are analyzed happened in the Laguna Verde power plant where the reactor was in the area of high power and low flow of coolant, giving satisfactory results. (Author)

  15. Palo Verde nuclear generating station EASEplus SIMULATE model

    International Nuclear Information System (INIS)

    McDonald, W.F.; Reed, M.L.; Fauste, J.L.

    1992-01-01

    The Palo Verde on-site reactor engineers have an extremely powerful and accurate tool for quickly predicting the effects of reactor power maneuvers on core axial shape index (ASI) and xenon worth. They can analyze postulated future power maneuvers quickly and supply the reactor operators with valuable predictions without having to consult with the off-site nuclear analysis group. The tool developed by the nuclear analysis group was an advanced nodal code with a graphic user interface (GUI) driver for ease of use. The advanced nodal code used was the Studsvik of America SIMULATE-3 Version 2.20-DSI. This SIMULATE version was compiled for use on a personal computer (PC) with a Definicon Systems' 50-MHz coprocessor board. The GUI face used was Expert-EASE Systems' EASE+SIM3 Version 3.0 pre-/postprocessor. The system was installed on Compaq Deskpro 386/20e PCs located in the control room of each of the three units, in the reactor engineering office, in the nuclear analysis office, and in the control room of the training simulator

  16. Dating the magmatism of Maio, Cape Verde Islands

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, J G [Newcastle upon Tyne Univ. (UK). School of Physics; Le Bas, M J [Leicester Univ. (UK). Dept. of Geology; Furnes, H [Bergen Univ. (Norway). Geologisk Inst.

    1983-07-01

    Conventional K-Ar and /sup 40/Ar//sup 39/Ar studies of Mesozoic ocean floor basalts and Tertiary plutonic and volcanic rocks from Maio, Cape Verde Islands, have been determined to elucidate the magmatic evolution of this ocean island. Pillow lavas of the Basement Complex yield a minimum age of 113 +- 8 Ma though thermal overprinting of their formation age by the younger Central Intrusive Complex (CIC) and subsequent sheet intrusions is in some cases almost total. Activity in the CIC began before 20 Ma and plutons continued to develop until about 8 Ma, the youngest ages possibly indicating a cooling history of more than 2 Ma for these bodies relative to their volcanic counterparts. Sheet intrusion occurred throughout the period 20 to 9 Ma though the peak of this activity probably occurred 11 Ma ago. Field relations allow the time of thrusting(s) on the Monte Branco Thrust to be bracketed between 9 and 7 Ma. Volcanic activity began in the Tertiary, probably before 12 Ma, and culminated in the development of a stratovolcano at 7 Ma.

  17. Severe Accident Simulation of the Laguna Verde Nuclear Power Plant

    Directory of Open Access Journals (Sweden)

    Gilberto Espinosa-Paredes

    2012-01-01

    Full Text Available The loss-of-coolant accident (LOCA simulation in the boiling water reactor (BWR of Laguna Verde Nuclear Power Plant (LVNPP at 105% of rated power is analyzed in this work. The LVNPP model was developed using RELAP/SCDAPSIM code. The lack of cooling water after the LOCA gets to the LVNPP to melting of the core that exceeds the design basis of the nuclear power plant (NPP sufficiently to cause failure of structures, materials, and systems that are needed to ensure proper cooling of the reactor core by normal means. Faced with a severe accident, the first response is to maintain the reactor core cooling by any means available, but in order to carry out such an attempt is necessary to understand fully the progression of core damage, since such action has effects that may be decisive in accident progression. The simulation considers a LOCA in the recirculation loop of the reactor with and without cooling water injection. During the progression of core damage, we analyze the cooling water injection at different times and the results show that there are significant differences in the level of core damage and hydrogen production, among other variables analyzed such as maximum surface temperature, fission products released, and debris bed height.

  18. “Aunque verde, todo cinturón Aprieta”

    Directory of Open Access Journals (Sweden)

    Eulalia Borja Bedoya

    2016-05-01

    Full Text Available Medellín, en su afán de venderse al mundo como una ciudad de servicios se ha vuelto hipócrita con sus ciudadanos y ha venido construyendo desde los centros de poder trasnacionales unos modelos de ciudad excluyentes, que cada vez intentan acabar con esos que no han tenido mucho, pero que luchan con lo poco, que se han tomado a Medellín y han construido otras maneras de vivirse la ladera, siempre en una lucha constante, reivindicando su derecho a la ciudad; Las laderas de Medellín si bien se han ido conformando en gran parte como cinturones de miseria, al mismo tiempo también lo han hecho como territorios de vida y resistencia. Allá se siembra y se aprende a vivir con dignidad aunque sin mucho dinero, saben qué es lo verde porque vienen del campo y saben cultivar la tierra, son conscientes de que habitan un territorio con agua, árboles, suelos para cuidar y respetar y es por eso que durante todos estos años han sabido hacerse una misma con la montaña que los acogió cuando la ciudad entera les dio la espalda.

  19. Nanoencapsulation of the sasanquasaponin from Camellia oleifera, its photo responsiveness and neuroprotective effects.

    Science.gov (United States)

    Ye, Yong; Xing, Haiting; Li, Yue

    2014-01-01

    Sasanquasaponin, a bioactive compound isolated from seeds of Camellia oleifera, shows central effects in our previous research. In order to investigate its neuroprotective effects, a new kind of nanocapsule with photo responsiveness was designed to deliver sasanquasaponin into the brain and adjusted by red light. The nanocapsule was prepared using sasanquasaponin emulsified with soybean lecithin and cholesterol solution. The natural phaeophorbide from silkworm excrement as a photosensitizer was added in the lipid phase to make the nanocapsules photo responsive. The physicochemical properties of encapsulation efficiency, size distribution, morphology and stability were measured using high-performance liquid chromatography, particle size analyzer, transmission electron microscope, differential scanning calorimetry and thermogravimetry. Photo responsiveness was determined by the sasanquasaponin release in pH 7.5 phosphate buffer under the laser at 670 nm. The neuroprotective effects were evaluated by the expression of tyrosine hydroxylase (TH), decrease of inflammatory cytokines TNF-α and IL-1β in the brain, and amelioration of kainic acid-induced behavioral disorder in mice. The nanocapsules had higher encapsulation efficiency and stability when the phaeophorbide content was 2% of lecithin weight. The average size was 172.2 nm, distributed in the range of 142-220 nm. The phaeophorbide was scattered sufficiently in the outer lecithin layer of the nanocapsules and increased the drug release after irradiation. TH expression in brain tissues and locomotive activities in mice were reduced by kainic acid, but could be improved by the sasanquasaponin nanocapsules after tail vein injection with 15 minutes of irradiation at the nasal cavity. The sasanquasaponin took effect through inflammatory alleviation in central tissues. The sasanquasaponin nanocapsules with phaeophorbide have photo responsiveness and neuroprotective effects under the irradiation of red light. This

  20. Transcriptome-wide identification of Camellia sinensis WRKY transcription factors in response to temperature stress.

    Science.gov (United States)

    Wu, Zhi-Jun; Li, Xing-Hui; Liu, Zhi-Wei; Li, Hui; Wang, Yong-Xin; Zhuang, Jing

    2016-02-01

    Tea plant [Camellia sinensis (L.) O. Kuntze] is a leaf-type healthy non-alcoholic beverage crop, which has been widely introduced worldwide. Tea is rich in various secondary metabolites, which are important for human health. However, varied climate and complex geography have posed challenges for tea plant survival. The WRKY gene family in plants is a large transcription factor family that is involved in biological processes related to stress defenses, development, and metabolite synthesis. Therefore, identification and analysis of WRKY family transcription factors in tea plant have a profound significance. In the present study, 50 putative C. sinensis WRKY proteins (CsWRKYs) with complete WRKY domain were identified and divided into three Groups (Group I-III) on the basis of phylogenetic analysis results. The distribution of WRKY family transcription factors among plantae, fungi, and protozoa showed that the number of WRKY genes increased in higher plant, whereas the number of these genes did not correspond to the evolutionary relationships of different species. Structural feature and annotation analysis results showed that CsWRKY proteins contained WRKYGQK/WRKYGKK domains and C2H2/C2HC-type zinc-finger structure: D-X18-R-X1-Y-X2-C-X4-7-C-X23-H motif; CsWRKY proteins may be associated with the biological processes of abiotic and biotic stresses, tissue development, and hormone and secondary metabolite biosynthesis. Temperature stresses suggested that the candidate CsWRKY genes were involved in responses to extreme temperatures. The current study established an extensive overview of the WRKY family transcription factors in tea plant. This study also provided a global survey of CsWRKY transcription factors and a foundation of future functional identification and molecular breeding.

  1. Proteomic analysis of tea plants (Camellia sinensis with purple young shoots during leaf development.

    Directory of Open Access Journals (Sweden)

    Qiongqiong Zhou

    Full Text Available Tea products made from purple leaves are highly preferred by consumers due to the health benefits. This study developed a proteome reference map related to color changes during leaf growth in tea (Camellia sinensis plant with purple young shoots using two-dimensional electrophoresis (2-DE. Forty-six differentially expressed proteins were detected in the gel and successfully identified by using MALDI-TOF/TOF-MS. The pronounced changes in the proteomic profile between tender purple leaves (TPL and mature green leaves (MGL included: 1 the lower activity of proteins associated with CO2 assimilation, energy metabolism and photo flux efficiency and higher content of anthocyanins in TPL than those in MGL may protect tender leaves against photo-damage; 2 the higher abundance of chalcone synthase (CHS, chalcone isomerase (CHI and flavonol synthase (FLS likely contributes to the synthesis of anthocyanins, catechins and flavonols in TPL tissues; 3 higher abundance of stress response proteins, such as glutathione S-transferases (GST and phospholipid hydroperoxide glutathione peroxidase (PHGPx, could enhance the tolerance of TPL tissues to adverse condition in; and 4 the increased abundance of proteins related to protein synthesis, nucleic acids and cell wall proteins should be beneficial for the proliferation and expansion of leaf cell in TPL tissues. qPCR analysis showed that the expression of differentially abundant proteins was regulated at the transcriptional level. Therefore, the results indicated that higher abundance of CHI and CHS may account for the production of the purple-shoot phenotype in Wuyiqizhong 18 and thereby, enhancing the anthocyanin biosynthesis. The higher abundance of glutamine synthetase (GS proteins related to the theanine biosynthesis may improve the flavor of tea products from TPL materials. Thus, this work should help to understand the molecular mechanisms underlying the changes in leaf color alteration.

  2. Amelioration of Gamma-hexachlorocyclohexane (Lindane induced renal toxicity by Camellia sinensis in Wistar rats

    Directory of Open Access Journals (Sweden)

    W. L. N. V. Vara Prasad

    2016-11-01

    Full Text Available Aim: A study to assess the toxic effects of gamma-hexachlorocyclohexane (γ-HCH (lindane and ameliorative effects of Camellia sinensis on renal system has been carried out in male Wistar rats. Materials and Methods: Four groups of rats with 18 each were maintained under standard laboratory hygienic conditions and provided feed and water ad libitum. γ-HCH was gavaged at 20 mg/kg b.wt. using olive oil as vehicle to Groups II. C. sinensis at 100 mg/kg b.wt. was administered orally in distilled water to Group IV in addition to γ-HCH 20 mg/kg b.wt. up to 45 days to study ameliorative effects. Groups I and III were treated with distilled water and C. sinensis (100 mg/kg b.wt., respectively. Six rats from each group were sacrificed at fortnight intervals. Serum was collected for creatinine estimation. The kidney tissues were collected in chilled phosphate buffer saline for antioxidant profile and in also 10% buffered formalin for histopathological studies. Results: γ-HCH treatment significantly increased serum creatinine and significantly reduced the renal antioxidative enzymes catalase, superoxide dismutase, and glutathione peroxidase. Grossly, severe congestion was noticed in the kidneys. Microscopically, kidney revealed glomerular congestion, atrophy, intertubular hemorrhages, degenerative changes in tubular epithelium with vacuolated cytoplasm, desquamation of epithelium and urinary cast formation. A significant reduction in serum creatinine levels, significant improvement in renal antioxidant enzyme activities and near to normal histological appearance of kidneys in Group IV indicated that the green tea ameliorated the effects of γ-HCH, on renal toxicity. Conclusion: This study suggested that C. sinensis extract combined with γ-HCH could enhance antioxidant/detoxification system which consequently reduced the oxidative stress thus potentially reducing γ-HCH toxicity and tissue damage.

  3. Nitrogen-doped porous carbon from Camellia oleifera shells with enhanced electrochemical performance

    Energy Technology Data Exchange (ETDEWEB)

    Zhai, Yunbo, E-mail: ybzhai@hnu.edu.cn [College of Environmental Science and Engineering, Hunan University, Changsha 410082 (China); Key Laboratory of Environmental Biology and Pollution Control, Hunan University, Ministry of Education, Changsha 410082 (China); Xu, Bibo [College of Environmental Science and Engineering, Hunan University, Changsha 410082 (China); Key Laboratory of Environmental Biology and Pollution Control, Hunan University, Ministry of Education, Changsha 410082 (China); Zhu, Yun [Office of Scientific R& D, Hunan University, Changsha 410082 (China); Qing, Renpeng; Peng, Chuan; Wang, Tengfei; Li, Caiting; Zeng, Guangming [College of Environmental Science and Engineering, Hunan University, Changsha 410082 (China); Key Laboratory of Environmental Biology and Pollution Control, Hunan University, Ministry of Education, Changsha 410082 (China)

    2016-04-01

    Nitrogen doped porous activated carbon was prepared by annealing treatment of Camellia oleifera shell activated carbon under NH{sub 3}. We found that nitrogen content of activated carbon up to 10.43 at.% when annealed in NH{sub 3} at 800 °C. At 600 °C or above, the N-doped carbon further reacts with NH{sub 3}, leads to a low surface area down to 458 m{sup 2}/g and low graphitization degree. X-ray photoelectron spectroscope (XPS) analysis indicated that the nitrogen functional groups on the nitrogen-doped activated carbons (NACs) were mostly in the form of pyridinic nitrogen. We discovered that the oxygen groups and carbon atoms at the defect and edge sites of graphene play an important role in the reaction, leading to nitrogen atoms incorporated into the lattice of carbon. When temperatures were lower than 600 °C the nitrogen atoms displaced oxygen groups and formed nitrogen function groups, and when temperatures were higher than 600 °C and ~ 4 at.% carbon atoms and part of oxygen function groups reacted with NH{sub 3}. When compared to pure activated carbon, the nitrogen doped activated carbon shows nearly four times the capacitance (191 vs 51 F/g). - Highlights: • The nitrogen content up to 10.43 at % during CAC pyrolysis under NH3 at 800 °C. • The oxygen groups and carbon atoms played an important role in the nitrogen doping. • NAC-600 shows a much higher specific capacitance than CAC.

  4. Genetic diversity and domestication origin of tea plant Camellia taliensis (Theaceae) as revealed by microsatellite markers.

    Science.gov (United States)

    Zhao, Dong-Wei; Yang, Jun-Bo; Yang, Shi-Xiong; Kato, Kenji; Luo, Jian-Ping

    2014-01-09

    Tea is one of the most popular beverages in the world. Many species in the Thea section of the Camellia genus can be processed for drinking and have been domesticated. However, few investigations have focused on the genetic consequence of domestication and geographic origin of landraces on tea plants using credible wild and planted populations of a single species. Here, C. taliensis provides us with a unique opportunity to explore these issues. Fourteen nuclear microsatellite loci were employed to determine the genetic diversity and domestication origin of C. taliensis, which were represented by 587 individuals from 25 wild, planted and recently domesticated populations. C. taliensis showed a moderate high level of overall genetic diversity. The greater reduction of genetic diversity and stronger genetic drift were detected in the wild group than in the recently domesticated group, indicating the loss of genetic diversity of wild populations due to overexploitation and habitat fragmentation. Instead of the endangered wild trees, recently domesticated individuals were used to compare with the planted trees for detecting the genetic consequence of domestication. A little and non-significant reduction in genetic diversity was found during domestication. The long life cycle, selection for leaf traits and gene flow between populations will delay the emergence of bottleneck in planted trees. Both phylogenetic and assignment analyses suggested that planted trees may have been domesticated from the adjacent central forest of western Yunnan and dispersed artificially to distant places. This study contributes to the knowledge about levels and distribution of genetic diversity of C. taliensis and provides new insights into genetic consequence of domestication and geographic origin of planted trees of this species. As an endemic tea source plant, wild, planted and recently domesticated C. taliensis trees should all be protected for their unique genetic characteristics, which

  5. 14CO2 fixation in leaf discs of Camellia sinensis (L.) O. Kuntze

    International Nuclear Information System (INIS)

    Aoki, Satoshi

    1979-01-01

    The effects of light intensity, sodium bicarbonate concentration and temperature on the rate of bicarbonate uptake in leaf discs of Camellia sinensis were investigated by measuring 14 C uptake from NaH 14 CO 3 . The photosynthetic activity of the discs was rather stable even at room temperature up to 48 hours after they were punched from leaves, and at the time, the activity was reduced only by 30% as compared to that at the beginning. The photosynthetic rate in leaf discs obtained in the morning was higher than that obtained in the afternoon. When the photosynthetic rate was measured under various light intensities, the light saturation point as well as the maximum photosynthetic rate in the leaf discs was higher in bicarbonate solution at 110 mM than at 20 mM. With the increase of the bicarbonate concentration, the photosynthetic rate increased, and was saturated at 110 mM under both low and high intensity light, and it suggests that CO 2 fertilization is possible under the shading treatment. The optimal temperature for leaf-disc photosynthesis at high and low bicarbonate concentrations was 30 deg. C and 35 deg. C, respectively, and the temperature factor Q 10 at 20 - 30 deg. C at high and low bicarbonate concentrations was 1.85 and 1.52, respectively. The Q 10 of leaf-disc photosynthesis was higher than that of whole-leaf photosynthesis, which suggested that the leaf discs were able to utilize bicarbonate more efficiently than the whole leaves. Use of leaf discs made it possible to handle many samples at one time with simple and cheap apparatuses. (Kaihara, S.)

  6. NMR Metabolic profiling of green tea (Camellia sinensis L.) leaves grown at Kemuning, Indonesia

    Science.gov (United States)

    Wahyuni, D. S. C.; Kristanti, M. W.; Putri, R. K.; Rinanto, Y.

    2017-01-01

    Green tea (Camellia sinensis L.) has been famous as a beverage and natural medicine. It contains a broad range of primary and secondary metabolites i.e. polyphenols. Nuclear Magnetic Resonance (NMR) has been widely used for metabolic profiling in medicinal plants. It provides a very fast and detailed analysis of the biomolecular composition of crude extracts. Moreover, an NMR spectrum is a physical characteristic of a compound and thus highly reproducible. Therefore, this study aims to profile metabolites of three different varieties of green tea C. Sinensis grown in Kemuning, Middle Java. Three varieties of green tea collected on Kemuning (TR1 2025, Gambung 4/5, and Chiaruan 143) were used in this study. 1H-NMR spectra were recorded at 230C on a 400 MHz Agilent WB (Widebore). The analysis was performed on dried green tea leaves and analyzed by 1H-NMR, 2D-J-resolved and 1H-1H correlated spectroscopy (COSY). MestRenova version 11.0.0 applied to identify metabolites in samples. A 1H-NMR spectrum of tea showed amino acids and organic acids signal at the area δ 0.8-4.0. These were theanine, alanine, threonine, succinic acid, aspartic acid, lactic acid. Anomeric protons of carbohydrate were shown by the region of β-glucose, α-glucose, fructose and sucrose. The phenolic region was depicted at area δ 5.5-8.5. Epigallocatechin derivates and caffeine were detected in the tea leaves. The detail compound identification was observed and discussed in the text.

  7. NMR Metabolic profiling of green tea (Camellia sinensis L.) leaves grown at Kemuning, Indonesia

    International Nuclear Information System (INIS)

    Wahyuni, D. S. C.; Kristanti, M. W.; Putri, R. K.; Rinanto, Y.

    2017-01-01

    Green tea (Camellia sinensis L.) has been famous as a beverage and natural medicine. It contains a broad range of primary and secondary metabolites i.e. polyphenols. Nuclear Magnetic Resonance (NMR) has been widely used for metabolic profiling in medicinal plants. It provides a very fast and detailed analysis of the biomolecular composition of crude extracts. Moreover, an NMR spectrum is a physical characteristic of a compound and thus highly reproducible. Therefore, this study aims to profile metabolites of three different varieties of green tea C. Sinensis grown in Kemuning, Middle Java. Three varieties of green tea collected on Kemuning (TR1 2025, Gambung 4/5, and Chiaruan 143) were used in this study. 1H-NMR spectra were recorded at 230C on a 400 MHz Agilent WB (Widebore). The analysis was performed on dried green tea leaves and analyzed by 1H-NMR, 2D-J-resolved and 1H-1H correlated spectroscopy (COSY). MestRenova version 11.0.0 applied to identify metabolites in samples. A 1 H-NMR spectrum of tea showed amino acids and organic acids signal at the area δ 0.8–4.0. These were theanine, alanine, threonine, succinic acid, aspartic acid, lactic acid. Anomeric protons of carbohydrate were shown by the region of β-glucose, α-glucose, fructose and sucrose. The phenolic region was depicted at area δ 5.5-8.5. Epigallocatechin derivates and caffeine were detected in the tea leaves. The detail compound identification was observed and discussed in the text. (paper)

  8. Separation and purification of both tea seed polysaccharide and saponin from camellia cake extract using macroporous resin.

    Science.gov (United States)

    Yang, Pengjie; Zhou, Mingda; Zhou, Chengyun; Wang, Qian; Zhang, Fangfang; Chen, Jian

    2015-02-01

    A novel method to separate and purify tea seed polysaccharide and tea seed saponin from camellia cake extract by macroporous resin was developed. Among four kinds of resins (AB-8, NKA-9, XDA-6, and D4020) tested, AB-8 macroporous resin possessed optimal separating capacity for the two substances and thus was selected for the separation, in which deionized water was used to elute tea seed polysaccharide, 0.25% NaOH solution to remove the undesired pigments, and 90% ethanol to elute tea seed saponin. Further dynamic adsorption/desorption experiments on AB-8 resin-based column chromatography were conducted to obtain the optimal parameters. Under optimal dynamic adsorption and desorption conditions, 18.7 and 11.8% yield of tea seed polysaccharide and tea seed saponin were obtained with purities of 89.2 and 96.0%, respectively. The developed method provides a potential approach for the large-scale production of tea seed polysaccharide and tea seed saponin from camellia cake. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Validation of SIMULATE-3K for stability analysis of Laguna Verde nuclear plant

    Energy Technology Data Exchange (ETDEWEB)

    Castillo, Rogelio, E-mail: rogelio.castillo@inin.gob.mx [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Estado de México 52750 (Mexico); Alonso, Gustavo, E-mail: gustavo.alonso@inin.gob.mx [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Estado de México 52750 (Mexico); Instituto Politecnico Nacional, Unidad Profesional Adolfo Lopez Mateos, Ed. 9, Lindavista, D.F. 07300 (Mexico); Ramírez, J. Ramón, E-mail: ramon.ramirez@inin.gob.mx [Instituto Nacional de Investigaciones Nucleares, Carretera México-Toluca s/n, La Marquesa, Ocoyoacac, Estado de México 52750 (Mexico)

    2013-12-15

    Highlights: • Neutronic/thermal hydraulic event in Laguna Verde is modeled. • A good agreement is obtained between SIMULATE-3K results and data plant for frequency and DR. • Other noise analysis techniques are used for the same purpose with good agreement. • Validation of SIMULATE-3K for stability analysis of Laguna Verde is confirmed - Abstract: Boiling Water Reactors are two phase flow systems which are susceptible to different types of flow instabilities. Among these are the coupled neutronic/thermal-hydraulic instabilities, these may compromise established fuel safety limits. These instabilities are characterized by periodic core-power and hydraulic oscillations. SIMULATE-3K code has been tested for stability analysis for several benchmarks, however to qualify the SIMULATE-3K code for a particular power plant a specific reactor plant analysis must be done. In this paper, the plant model of Laguna Verde Nuclear Power Plant is built and SIMULATE-3K is tested against the 1995 coupled neutronic/thermal-hydraulic instability event of Laguna Verde. Results obtained show the adequacy of this code to specific Laguna Verde power plant stability analysis.

  10. 78 FR 34373 - Campo Verde Solar, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2013-06-07

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER13-1541-000] Campo Verde Solar, LLC; Supplemental Notice That Initial Market- Based Rate Filing Includes Request for Blanket Section 204 Authorization This is a supplemental notice in the above-referenced proceeding of Campo Verde...

  11. O arquipélago “literopintado”: escritura literária de autoria feminina em Cabo Verde

    Directory of Open Access Journals (Sweden)

    Simone Caputo Gomes

    2010-12-01

    Full Text Available Este artigo tem por objetivo estudar a representação de Cabo Verde pela literatura de autoria feminina, que retrata – lê, pinta, desenha, esculpe, escreve, imagina – suas belas paisagens, seu cotidiano popular, seus perfis de mulher, sua riqueza cultural.Palavras-chave: Literatura feminina; Cabo Verde; Representação cultural.

  12. 75 FR 13606 - Arizona Public Service Company, Palo Verde Nuclear Generating Station, Units 1, 2, and 3...

    Science.gov (United States)

    2010-03-22

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. STN 50-528, STN 50-529, and STN 50-530; NRC-2010-0114] Arizona Public Service Company, Palo Verde Nuclear Generating Station, Units 1, 2, and 3; Environmental...-74, issued to Arizona Public Service Company (APS, the licensee), for operation of the Palo Verde...

  13. 77 FR 38280 - Verde Energy USA New York, LLC; Supplemental Notice That Initial Market-Based Rate Filing...

    Science.gov (United States)

    2012-06-27

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER12-2071-000] Verde Energy USA New York, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for... Verde Energy USA New York, LLC's application for market-based rate authority, with an accompanying rate...

  14. 78 FR 32240 - Notice of Inent (NOI) To Prepare an Environmental Impact Statement (EIS) for the Oro Verde Solar...

    Science.gov (United States)

    2013-05-29

    ... DEPARTMENT OF DEFENSE Notice of Inent (NOI) To Prepare an Environmental Impact Statement (EIS) for the Oro Verde Solar Project at Edwards Air Force Base and County of Kern, CA AGENCY: Department of the... with the development of the Oro Verde Solar Project (OVSP) on Edwards AFB. The OVSP is a solar...

  15. 76 FR 43684 - Verde Energy USA Trading, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2011-07-21

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER11-4041-000] Verde Energy USA Trading, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for... Verde Energy USA Trading, LLC's application for market-based rate authority, with an accompanying rate...

  16. 75 FR 8149 - Arizona Public Service Company, et al. Palo Verde Nuclear Generating Station, Units 1, 2, and 3...

    Science.gov (United States)

    2010-02-23

    ...] Arizona Public Service Company, et al. Palo Verde Nuclear Generating Station, Units 1, 2, and 3... NPF-74, issued to the Arizona Public Service Company (APS, or the licensee), for operation of the Palo Verde Nuclear Generating Station (PVNGS, the facility), Units 1, 2, and 3, respectively, located in...

  17. Analysis of the stability of events occurred in Laguna Verde; Analisis de estabilidad de eventos ocurridos en Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Castillo D, R.; Ortiz V, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Calleros M, G. [CFE, Central Nucleoelectrica Laguna Verde, Carretera Cardel-Nautla Km. 42.5, Alto Lucero, Veracruz (Mexico)

    2005-07-01

    The new fuel designs for operation cycles more long have regions of uncertainty bigger that those of the old fuels, and therefore, they can have oscillations of power when an event is presented that causes that the reactor operates to high power and low flow of coolant. During the start up of the reactor there are continued procedures that avoid that oscillations are presented with that which makes sure the stable behavior of the reactor. However, when the reactor is operating to nominal conditions and they are shot or they are transferred to low speed the recirculation pumps, it cannot make sure that the reactor doesn't present oscillations of power when entering to the restricted operation regions. The methods of stability analysis commonly use signs of neutronic noise that require to be stationary, but after a transitory one where they commonly get lost the recirculation pumps the signs they don't have the required characteristics, for what they are used with certain level of uncertainty by the limited validity of the models. In this work the Prony method is used to determine the reactor stability, starting from signs of transitory and it is compared with autoregressive models. Four events are analyzed happened in the Laguna Verde power plant where the reactor was in the area of high power and low flow of coolant, giving satisfactory results. (Author)

  18. Groundwater resources of Mosteiros basin, island of Fogo, Cape Verde, West Africa

    Science.gov (United States)

    Heilweil, Victor M.; Gingerich, Stephen B.; Plummer, Niel; Verstraeten, Ingrid M.

    2010-01-01

    Groundwater resources in Cape Verde provide water for agriculture, industry, and human consumption. These resources are limited and susceptible to contamination. Additional groundwater resources are needed for continued agricultural development, particularly during times of drought, but increased use and (or) climatic change may have adverse effects on the quantity and quality of freshwater available. In volcanic island aquifers such as those of Cape Verde, a lens of fresh groundwater typically ?floats? upon a layer of brackish water at the freshwater/saltwater boundary, and increased pumping may cause salt water intrusion or other contamination. A recent U.S. Geological Survey study assessed baseline groundwater conditions in watersheds on three islands of Cape Verde to provide the scientific basis for sustainably developing water resources and minimizing future groundwater depletion and contamination.

  19. Low concentrations of persistent organic pollutants (POPs) in air at Cape Verde.

    Science.gov (United States)

    Nøst, Therese Haugdahl; Halse, Anne Karine; Schlabach, Martin; Bäcklund, Are; Eckhardt, Sabine; Breivik, Knut

    2018-01-15

    Ambient air is a core medium for monitoring of persistent organic pollutants (POPs) under the Stockholm Convention and is used in studies of global transports of POPs and their atmospheric sources and source regions. Still, data based on active air sampling remain scarce in many regions. The primary objectives of this study were to (i) monitor concentrations of selected POPs in air outside West Africa, and (ii) to evaluate potential atmospheric processes and source regions affecting measured concentrations. For this purpose, an active high-volume air sampler was installed on the Cape Verde Atmospheric Observatory at Cape Verde outside the coast of West Africa. Sampling commenced in May 2012 and 43 samples (24h sampling) were collected until June 2013. The samples were analyzed for selected polychlorinated biphenyls (PCBs), polybrominated diphenyl ethers (PBDEs), hexachlorobenzene (HCB) and chlordanes. The concentrations of these POPs at Cape Verde were generally low and comparable to remote sites in the Arctic for several compounds. Seasonal trends varied between compounds and concentrations exhibited strong temperature dependence for chlordanes. Our results indicate net volatilization from the Atlantic Ocean north of Cape Verde as sources of these POPs. Air mass back trajectories demonstrated that air masses measured at Cape Verde were generally transported from the Atlantic Ocean or the North African continent. Overall, the low concentrations in air at Cape Verde were likely explained by absence of major emissions in areas from which the air masses originated combined with depletion during long-range atmospheric transport due to enhanced degradation under tropical conditions (high temperatures and concentrations of hydroxyl radicals). Copyright © 2017 The Author(s). Published by Elsevier B.V. All rights reserved.

  20. Bats of Mesa Verde National Park, Colorado: composition, reproduction, and roosting habits.

    Science.gov (United States)

    O'Shea, Thomas J.; Cryan, Paul M.; Snider, E. Apple; Valdez, Ernest W.; Ellison, Laura E.; Neubaum, Daniel J.

    2011-01-01

    We determined the bat fauna at Mesa Verde National Park (Mesa Verde) in 2006 and 2007, characterized bat elevational distribution and reproduction, and investigated roosting habits of selected species. We captured 1996 bats of 15 species in mist nets set over water during 120 nights of sampling and recorded echolocation calls of an additional species. The bat fauna at Mesa Verde included every species of bat known west of the Great Plains in Colorado, except the little brown bat (Myotis lucifugus). Some species showed skewed sex ratios, primarily due to a preponderance of males. Thirteen species of bats reproduced at Mesa Verde. Major differences in spring precipitation between the 2 years of our study were associated with differences in reproductive rates and, in some species, with numbers of juveniles captured. Reduced reproductive effort during spring drought will have a greater impact on bat populations with the forecasted increase in aridity in much of western North America by models of global climate change. We radiotracked 46 bats of 5 species to roosts and describe the first-known maternity colonies of spotted bats (Euderma maculatum) in Colorado. All 5 species that we tracked to diurnal roosts relied almost exclusively on rock crevices rather than trees or snags, despite the presence of mature forests at Mesa Verde and the use of trees for roosts in similar forests elsewhere by some of these species. Comparisons with past bat surveys at Mesa Verde and in surrounding areas suggest no dramatic evidence for effects of recent stand-replacing fires on the composition of the bat community.

  1. The cone snails of Cape Verde: Marine endemism at a terrestrial scale

    Directory of Open Access Journals (Sweden)

    Howard Peters

    2016-07-01

    Full Text Available Cape Verde in the Eastern Atlantic is typical of many island groups in supporting a wealth of endemic species both terrestrial and marine. Marine gastropod molluscs of the genus Conus, commonly known as cone snails, occur in coastal tropical waters throughout the globe, but in Cape Verde their endemism reaches its apogee with 53 out of 56 species occurring nowhere else, the majority of which are restricted to single islands and frequently to single bays. However, Cape Verde is rapidly moving to a tourism-based economy with a projected boom in infrastructure development often coincidental with the shallow-water habitat of many range-restricted Conus. The conservation assessment of Conus to standards of the International Union for the Conservation of Nature (IUCN Red List of Endangered Species, found that 45.3% of 53 species assessed from Cape Verde are threatened or near-threatened with extinction compared to 7.4% of 579 species in the rest of the world. The only three Conus species globally assessed as Critically Endangered and on the cusp of extinction are all endemic to Cape Verde. Our analysis of Conus species distribution, together with spatial data of coastal protected areas and tourism development zones, identify important areas for future research and new marine protection. Our findings show that endemism with its associated risks for Conus in Cape Verde has worldwide parallels with many non-marine taxa, while our proposed strategy for Conus conservation extends beyond the confines of the country and this taxonomic group.

  2. Value of Combining Left Atrial Diameter and Amino-terminal Pro-brain Natriuretic Peptide to the CHA2DS2-VASc Score for Predicting Stroke and Death in Patients with Sick Sinus Syndrome after Pacemaker Implantation

    Directory of Open Access Journals (Sweden)

    Bin-Feng Mo

    2017-01-01

    Conclusions: CHA2DS2-VASc score is valuable for predicting stroke and death risk in patients with SSS after pacemaker implantation. The addition of LAD and NT-proBNP to the CHA2DS2-VASc score improved its predictive power for stroke and death, respectively, in this patient cohort. Future prospective studies are warranted to validate the benefit of adding LAD and NT-proBNP to the CHA2DS2-VASc score for predicting stroke and death risk in non-AF populations.

  3. FOGO-2014: Monitoring the Fogo 2014 Eruption, Cape Verde

    Science.gov (United States)

    Fernandes, Rui; Faria, Bruno

    2015-04-01

    Fogo volcano, located in the Cape Verde Archipelago offshore Western Africa, is a complete stratovolcano system that was created by the Cape Verde hotspot, forming the island of Fogo. The top (Pico do Fogo) reaches ~2830m above sea level, and raises ~1100m above Chã das Caldeiras, an almost flat circular area with approximately 10 kilometres in the north-south direction and 7 kilometres in the east-west direction. Chã das Caldeiras, surrounded towards the West by the ~1000m high Bordeira rampart, has been inhabited since the early 20th Century, because it is one of the most productive agricultural areas in this semi-arid country. Fogo volcano erupted on November 23, 2014 (~10:00UTC) on a subsidiary vent of the main cone, after 19 years of inactivity. C4G (Collaboratory for Geosciences), a distributed research infrastructure created in 2014 in the framework of the Portuguese Roadmap for Strategic Research Infrastructures, immediately offered support to the Cape Verdean authorities, with the goal of complementing the permanent geophysical monitoring network operated in Fogo island by INMG, the Cape Verdean Meteorological and Geophysical Institute. This permanent network is composed of seven seismographic stations and three tiltmeter stations, and the data is transmitted in real time to the INMG geophysical laboratory in São Vicente Island, where it is analysed on a routine basis. Pre-eruptive activity started to be detected by the permanent monitoring network on October 2014, with earthquakes occurring at depths larger than 15 km. These events led to a first volcanic warning to the Cape Verdean Civil Protection Agency. On November 22 several volcano-tectonic earthquakes were recorded at shallow depths, indicating shallow fracturing. On the basis of this activity, INMG issued a formal alert of an impending eruption to the Civil Protection Agency, ~24 hours before the onset of the eruption. Volcanic tremor and clear tiltmeter signals were recorded about one hour

  4. Chemistry technician performance evaluation program Palo Verde Nuclear Generating Station

    International Nuclear Information System (INIS)

    Shawver, J.M.

    1992-01-01

    The Arizona Nuclear Power Project (ANPP), a three-reactor site located 50 miles west of Phoenix, Arizona, has developed and implemented a program for evaluating individual chemistry technician analytical performance on a routine basis. About 45 chemistry technicians are employed at the site, 15 at each operating unit. The technicians routinely perform trace level analyses for impurities of concern to PWRs. Each month a set of blind samples is provided by an outside vendor. The blind samples contain 16 parameters which are matrixed to approximate the PWR's primary and secondary cycles. Nine technicians receive the samples, three from each operating unit, and perform the required analyses. Acceptance criteria for successful performance on the blind parameters is based on the values found in the Institute of Nuclear Power Operations (INPO) Document 83-016, Revision 2, August 1989, Chemistry Quality Control Program. The goal of the program is to have each technician demonstrate acceptable performance on each of 16 analytical parameters. On completion of each monthly set, a summary report of all of the analytical results for the sample set is prepared. From the summary report, analytical bias can be detected, technician performance is documented, and overall laboratory performance can be evaluated. The program has been very successful at satisfying the INPO requirement that the analytical performance of each individual technician should be checked on at least a six-month frequency for all important parameters measured. This paper describes the program as implemented at the Palo Verde Nuclear Generating Station and provides a summary report and trend and bias graphs for illustrative purposes

  5. Training in fundamentals of radiological coverage in Laguna Verde NPP

    International Nuclear Information System (INIS)

    Lara H, M. A.

    2014-10-01

    In 2010, the Institute of Nuclear Power Operations (INPO) celebrates the Knowledge Transfer and Retention Workshop, an event where nuclear regulators and operators presented the strategies that various NPP to worldwide were implemented to mitigate the consequences of this generational change and take advantage of it, the trend in the presented works was the same: the generational change occurs in a faster way that the transfer of knowledge, the future was already here and many NPP had not been adequately prepared to train its nuclear technicians and engineers in the tasks demanded by the industry of them, so in addition to preparing these workers to forced marches was necessary to establish strategies to retain at more experienced staff in the industry. The Laguna Verde NPP has not been exempt to this process; the preparation of personnel squares to replace those that reaching retirement age in the Comision Federal de Electricidad (CFE) has become extensive in the last five years, sometimes leading to have personnel covering functions without an alternate to the next lower position, the cause? Not enough staff. In the specific case of radiation protection (Rp) the time required for obtaining the status of Rp technician according to the ANSI/ANS 3.1 standard is 2 years, one of the tasks that most occupies part of these two years is training in radiological coverage, this training requires a mix of knowledge and experience, recently one of the concepts used for training in Rp is the evaluation and management of the radiological risk, topic that is considered in this technical work. (Author)

  6. Revestimentos biodegradaveis para conservação do coco 'anão verde'

    OpenAIRE

    Josane Maria Resende

    2007-01-01

    Resumo: A água de coco verde é extremamente perecível após a colheita dos frutos e sua qualidade está diretamente relacionada às condições do ambiente de armazenagem. Portanto, são necessárias tecnologias que permitam a conservação do coco verde por um período superior a trinta dias para que o fruto possa ser exportado e comercializado mantendo a água em condições apropriadas para o consumo ao natural. O presente trabalho teve o objetivo de desenvolver revestimentos biodegradáveis para prolon...

  7. Considerations for increasing unit 1 spent fuel pool capacity at the Laguna Verde station

    International Nuclear Information System (INIS)

    Vera, A.

    1992-01-01

    To increase the spent fuel storage capacity at the Laguna Verde Station in a safe and economical manner and assure a continuous operation of the first Mexican Nuclear Plant, Comision Federal de Electricidad (CFE), the Nation's Utility, seeked alternatives considering the overall world situation, the safety and licensing aspects, as well as the economics and the extent of the nuclear program of Mexico. This paper describes the alternatives considered, their evaluation and how the decision taken by CFE in this field, provides the Laguna Verde Station with a maximum of 37 years storage capacity plus full core reserve

  8. Red continua de espacios públicos verdes a escala municipal: el caso de Madrid

    OpenAIRE

    Casado Postigo, Pablo

    2015-01-01

    La ubicación marginal y el aislamiento de los Parques Urbanos implican infrautilización y deterioro de los mismos. Su interconexión mediante una red verde peatonal con limitaciones al tráfico rodado, supone una puesta en valor de todo el sistema de espacios libres y zonas verdes de la ciudad y un importante incentivo para desviar determinados flujos rodados a otras vías cercanas, rescatando así, espacios urbanos a favor del peatón. Esta conexión ayuda a minimizar la fragmentación del espacio ...

  9. Application of a new methodology on the multicycle analysis for the Laguna Verde NPP en Mexico

    International Nuclear Information System (INIS)

    Cortes C, Carlos C.

    1997-01-01

    This paper describes the improvements done in the physical and economic methodologies on the multicycle analysis for the Boiling Water Reactors of the Laguna Verde NPP in Mexico, based on commercial codes and in-house developed computational tools. With these changes in our methodology, three feasible scenarios are generated for the operation of Laguna Verde Nuclear Power Plant Unit 2 at 12, 18 and 24 months. The physical economic results obtained are showed. Further, the effect of the replacement power is included in the economic evaluation. (author). 11 refs., 3 figs., 7 tabs

  10. Oral receptivity of Aedes aegypti from Cape Verde for yellow fever, dengue, and chikungunya viruses.

    Science.gov (United States)

    Vazeille, Marie; Yébakima, André; Lourenço-de-Oliveira, Ricardo; Andriamahefazafy, Barrysson; Correira, Artur; Rodrigues, Julio Monteiro; Veiga, Antonio; Moreira, Antonio; Leparc-Goffart, Isabelle; Grandadam, Marc; Failloux, Anna-Bella

    2013-01-01

    At the end of 2009, 21,313 cases of dengue-3 virus (DENV-3) were reported in the islands of Cape Verde, an archipelago located in the Atlantic Ocean 570 km from the coast of western Africa. It was the first dengue outbreak ever reported in Cape Verde. Mosquitoes collected in July 2010 in the city of Praia, on the island of Santiago, were identified morphologically as Aedes aegypti formosus. Using experimental oral infections, we found that this vector showed a moderate ability to transmit the epidemic dengue-3 virus, but was highly susceptible to chikungunya and yellow fever viruses.

  11. The apid cuckoo bees of the Cape Verde Islands (Hymenoptera, Apidae).

    Science.gov (United States)

    Straka, Jakub; Engel, Michael S

    2012-01-01

    The apid cuckoo bees of the Cape Verde Islands (Republic of Cape Verde) are reviewed and five species recognized, representing two genera. The ammobatine genus Chiasmognathus Engel (Nomadinae: Ammobatini), a specialized lineage of cleptoparasites of nomioidine bees is recorded for the first time. Chiasmognathus batelkaisp. n. is distinguished from mainland African and Asian species. The genus Thyreus Panzer (Apinae: Melectini) is represented by four species - Thyreus denoliisp. n., Thyreus batelkaisp. n., Thyreus schwarzisp. n., and Thyreus aistleitnerisp. n. Previous records of Thyreus scutellaris (Fabricius) from the islands were based on misidentifications.

  12. Confort térmico en espacios verdes urbanos de ambientes áridos.

    OpenAIRE

    Alejandra Kurbán; Mario Cúnsulo

    2017-01-01

    En la planificación bioclimática de las ciudades y particularmente las ubicadas en  ambientes áridos, los espacios verdes representan un potencial  higrotérmico desaprovechado como mitigadores del clima urbano. El trabajo cuantifica el confort térmico de espacios verdes urbanos (EVU) de una ciudad del centro-oeste de Argentina localizada en la Diagonal Árida Sudamericana, a partir del Índice UTCI.  Este índice se calcula a partir de mediciones climáticas en 19 EVU, realizadas en el verano del...

  13. Association of epicardial adipose tissue thickness and inflammation parameters with CHA2DS2-VASc score in patients with nonvalvular atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Akdag S

    2015-11-01

    Full Text Available Serkan Akdag, Hakki Simsek, Musa Sahin, Aytac Akyol, Ramazan Duz, Naci Babat Department of Cardiology, Yuzuncu Yil University Medical Faculty, Van, Turkey Background: Epicardial adipose tissue (EAT, mean platelet volume (MPV, platelet-to- lymphocyte ratio (PLR, and neutrophil-to-lymphocyte ratio (NLR have been shown to be helpful in predicting adverse cardiovascular events. However, to date, in the literature, there have been no studies demonstrating the relationship between EAT, MPV, PLR, NLR, and thromboembolism risk in atrial fibrillation (AF. Therefore, we examined the relationship between EAT, MPV, PLR, NLR, and CHA2DS2-VASc score used for the evaluation of thromboembolism risk in patients with AF.Methods: The study included 96 consecutive patients with AF and 52 age- and sex-matched control subjects. We calculated CHA2DS2-VASc risk score for each patient and measured baseline EAT thickness, MPV, PLR, NLR, left atrial volume index, and left ventricular ejection fraction.Results: The group with high CHA2DS2-VASc score had higher EAT (7.2±1.5 vs 5.9±1.2 mm, P<0.001, MPV (9.1±1.1 vs 8.4±1.0 fL, P=0.004, PLR (152.3±28.4 vs 126.7±25.4, P=0.001, and NLR (4.0±1.6 vs 3.2±1.3, P<0.001 compared to group with low-intermediate CHA2DS2-VASc score. Moreover, CHA2DS2-VASc score was found to be positively correlated with EAT (r=0.623, P<0.001, MPV (r=0.350, P=0.004, PLR (r=0.398, P=0.001, and NLR (r=0.518, P<0.001.Conclusion: Our study results demonstrated that EAT thickness, MPV, PLR, and NLR were associated with the thromboembolic risk exhibited by CHA2DS2-VASc score in patients with nonvalvular AF. Keywords: atrial fibrillation, epicardial adipose tissue, platelet, neutrophil, mean platelet volume

  14. Nanoencapsulation of the sasanquasaponin from Camellia oleifera, its photo responsiveness and neuroprotective effects

    Directory of Open Access Journals (Sweden)

    Ye Y

    2014-09-01

    Full Text Available Yong Ye, Haiting Xing, Yue Li Department of Pharmaceutical Engineering, School of Chemistry and Chemical Engineering, South China University of Technology, Guangzhou, People’s Republic of China Abstract: Sasanquasaponin, a bioactive compound isolated from seeds of Camellia oleifera, shows central effects in our previous research. In order to investigate its neuroprotective effects, a new kind of nanocapsule with photo responsiveness was designed to deliver sasanquasaponin into the brain and adjusted by red light. The nanocapsule was prepared using sasanquasaponin emulsified with soybean lecithin and cholesterol solution. The natural phaeophorbide from silkworm excrement as a photosensitizer was added in the lipid phase to make the nanocapsules photo responsive. The physicochemical properties of encapsulation efficiency, size distribution, morphology and stability were measured using high-performance liquid chromatography, particle size analyzer, transmission electron microscope, differential scanning calorimetry and thermogravimetry. Photo responsiveness was determined by the sasanquasaponin release in pH 7.5 phosphate buffer under the laser at 670 nm. The neuroprotective effects were evaluated by the expression of tyrosine hydroxylase (TH, decrease of inflammatory cytokines TNF-α and IL-1ß in the brain, and amelioration of kainic acid-induced behavioral disorder in mice. The nanocapsules had higher encapsulation efficiency and stability when the phaeophorbide content was 2% of lecithin weight. The average size was 172.2 nm, distributed in the range of 142–220 nm. The phaeophorbide was scattered sufficiently in the outer lecithin layer of the nanocapsules and increased the drug release after irradiation. TH expression in brain tissues and locomotive activities in mice were reduced by kainic acid, but could be improved by the sasanquasaponin nanocapsules after tail vein injection with 15 minutes of irradiation at the nasal cavity. The

  15. Gene expression profile indicates involvement of NO in Camellia sinensis pollen tube growth at low temperature.

    Science.gov (United States)

    Pan, Junting; Wang, Weidong; Li, Dongqin; Shu, Zaifa; Ye, Xiaoli; Chang, Pinpin; Wang, Yuhua

    2016-10-18

    Nitric oxide (NO) functions as a critical signaling molecule in the low-temperature stress responses in plants, including polarized pollen tube growth in Camellia sinensis. Despite this, the potential mechanisms underlying the participation of NO in pollen tube responses to low temperature remain unclear. Here, we investigate alterations to gene expression in C. sinensis pollen tubes exposed to low-temperature stress and NO using RNA-Seq technology, in order to find the potential candidate genes related to the regulation of pollen tube elongation by NO under low-temperature stress. Three libraries were generated from C. sinensis cv. 'Longjingchangye' pollen tubes cultured at 25 °C (CsPT-CK) and 4 °C (CsPT-LT) or with 25 μM DEA NONOate (CsPT-NO). The number of unigenes found for the three biological replications were 39,726, 40,440 and 41,626 for CsPT-CK; 36,993, 39,070 and 39,439 for CsPT-LT; and 39,514, 38,298 and 39,061 for CsPT-NO. A total of 36,097 unique assembled and annotated sequences from C. sinensis pollen tube reads were found in a BLAST search of the following databases: NCBI non-redundant nucleotide, Swiss-prot protein, Kyoto Encyclopedia of Genes and Genomes, Cluster of Orthologous Groups of proteins, and Gene Ontology. The absolute values of log 2 Ratio > 1 and probability > 0.7 were used as the thresholds for significantly differential gene expression, and 766, 497 and 929 differentially expressed genes (DEGs) were found from the comparison analyses of the CK-VS-LT, CK-VS-NO and LT-VS-NO libraries, respectively. Genes related to metabolism and signaling pathways of plant hormones, transcription factors (TFs), vesicle polarized trafficking, cell wall biosynthesis, the ubiquitination machinery of the ubiquitin system and species-specific secondary metabolite pathways were mainly observed in the CK-VS-LT and CK-VS-NO libraries. Differentially expressed unigenes related to the inhibition of C. sinensis pollen tube growth under low

  16. Morphological, physiological and biochemical responses of camellia oleifera to low-temperature stress

    International Nuclear Information System (INIS)

    Hu, J.; Shu, Q.; Fu, S.; Wu, W.

    2016-01-01

    Camellia oleifera Abel originates from China and is high healthy effect food oil species. It is also a high additional plant in southern China and can help to keep some people of mountain area out of poverty. In recent years, climate change has been abnormal frequently. Abnormal low temperature in winter and late spring coldness may cause the hard hit to C. oleifera farmers. Freezing injury can be caused by sudden decreases in temperature in winter. However, C. oleifera varieties differ in their hardiness to low temperatures. The paper investigated cold-resistance mechanisms by determining and analyzing the morphological, physiological and biochemical characteristics of C. oleifera from eastern, western and southern Anhui, respectively. Sensitivity to low temperature was assessed via the number of leaves in spring shoots, leaf thickness, the activities of protective enzymes such as CAT, POD and SOD, and the inclusion contents of WSS, FPro, MDA, benzene-alcohol extracts and lignin. The results showed that C. oleifera varieties had different physiological and biochemical, and morphological responses to low winter temperatures. In different regions, the number of leaves, leaf thickness, WSS content, FPro content and MDA content varied from 5.2-7.8, 398.79 micro m-465.27 micro m, 23.41 mg/g-24.74 mg/g, 41.86 micro g/g-44.18 micro g/g and 10.08 micro mol/g-14.51 micro mol/g, respectively. The varieties from eastern Anhui, the leaf thickness were thicker. Meanwhile, the protective enzyme activities and inclusion contents were relatively higher. The protective enzyme activities and chemical components contents such as benzene-alcohol extract and lignin represented significantly difference (p<0.05) among three regions. In the future, for the abnormal low temperature in winter, a serious of cultivation measures such as improving the contents of WSS, FPro, benzene-alcohol extract and lignin, were taken to enhance the cold resistance of C. oleifera. The result broadens the

  17. Martin Chalfie y la proteína verde fluorescente Martin Chalfie y la proteína verde fluorescente

    Directory of Open Access Journals (Sweden)

    Zacarías Pereira Vega

    2012-12-01

    Full Text Available The history of the green fluorescent protein (GFP starts with Osamu Shimomura at the beginning of the 1960s, with his discovery from the extracts of the Aequorea victoria jellyfish. However, it is not until the beginning of the 1990s, that the neurobiologist Martin Chalfie, applying genetic engineering tech- niques, achieved for the first time the heterology expression of the GFP in prokaryotes (E. coli and eukaryotes (Caernohabditis elegans, from a clone of the jellyfish’s gen that codifies the GFP prepared by Douglas Prasher. Besides fluorescing in green, the results from this work also demonstrated that it does not require any other cofactor or enzyme of the jellyfish for its expression or for the own forming of a fluorophore. At the same time, Chalfie proposed that the GFP could be used for the marking of cells on living ani- mals or the tag of proteins. Based upon these results, many scientists started working on research related to the GFP; actually this protein is used on different fields such as biotechnol- ogy, development biology, environmental chemistry and medicine. In the case of the latter, it has helped to elucidate the cellular mechanisms from which diseases are made of. Science owes Roger Tsien, amongst other contributions, the creation of differ- ent mutations of the GFP.La historia de la proteína verde fluorescente (GFP se inicia con Osamu Shimomura a principios de la década de 1960, con su descubrimiento de esta proteína a partir de extractos de la medusa Aequorea victoria. Sin embargo, es a principios de la década de 1990 que el neurobiólogo Martin Chalfie, aplicando técnicas de ingeniería genética, logra por primera vez la expresión heteróloga de la GFP en procariotas (Escherichia coli y eucariotas (Caernohabditis elegans, a partir de un clon del gen de la medusa que codifica a la GFP, preparado por Douglas Prasher. Además de fluorescer en verde, los resultados de este trabajo también demostraron que no se

  18. Proposal for implementation of alternative source term in the nuclear power plant of Laguna Verde; Propuesta de implementacion del termino fuente alternativo en la central nuclear Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Bazan L, A.; Lopez L, M.; Vargas A, A.; Cardenas J, J. B. [Comision Federal de Electricidad, Central Nucleoelectrica Laguna Verde, Km. 7.5 Carretera Veracruz-Medellin, Dos Bocas, Veracruz (Mexico)], e-mail: ariadna.bazan@cfe.gob.mx

    2009-10-15

    In 2010 the nuclear power plant of Laguna Verde will implement the extended power upbeat in both units of the plant. Agree with methodology of NEDC-33004P-A, (constant pressure power up rate), and the source term of core, for accidents evaluations, were increased in proportion to the ratio of power level. This means that for the case of a design basis accident of loss of coolant an increase of power of 15% originated an increase of 15% in dose to main control room. Using the method of NEDC-33004P-A to extended power upbeat conditions was determined that the dose value to main control room is very near to regulatory limit established by SRP 6.4. By the above and in order to recover the margin, the nuclear power plant of Laguna Verde will calculate an alternative source term following the criteria established in RG 1.183 (alternative radiological source term for evaluating DBA at nuclear power reactor). This approach also have a more realistic dose value using the criterion of 10-CFR-50.67, in addition is predicted to get the benefit of additional operational flexibilities. This paper present the proposal of implementing the alternative source term in Laguna Verde. (Author)

  19. Soil and Water Conservation Strategies in Cape Verde (Cabo Verde in Portuguese and Their Impacts on Livelihoods: An Overview from the Ribeira Seca Watershed

    Directory of Open Access Journals (Sweden)

    Isaurinda Baptista

    2015-01-01

    Full Text Available Severe land degradation has strongly affected both people’s livelihood and the environment in Cape Verde (Cabo Verde in Portuguese, a natural resource poor country. Despite the enormous investment in soil and water conservation measures (SWC or SLM, which are visible throughout the landscape, and the recognition of their benefits, their biophysical and socioeconomic impacts have been poorly assessed and scientifically documented. This paper contributes to filling this gap, by bringing together insights from literature and policy review, field survey and participatory assessment in the Ribeira Seca Watershed through a concerted approach devised by the DESIRE project (the “Desire approach”. Specifically, we analyze government strategies towards building resilience against the harsh conditions, analyze the state of land degradation and its drivers, survey and map the existing SWC measures, and assess their effectiveness against land degradation, on crop yield and people’s livelihood. We infer that the relative success of Cape Verde in tackling desertification and rural poverty owes to an integrated governance strategy that comprises raising awareness, institutional framework development, financial resource allocation, capacity building, and active participation of rural communities. We recommend that specific, scientific-based monitoring and assessment studies be carried out on the biophysical and socioeconomic impact of SLM and that the “Desire approach” be scaled-up to other watersheds in the country.

  20. The Chaîne des Puys and Limagne Fault World Heritage project: a view from a scientist

    Science.gov (United States)

    van Wyk de Vries, B.

    2013-12-01

    The development of the Chaîne des Puys and Limagne Fault World Heritage UNESCO project has taken about five years, since the Laboratoire Magmas et Volcans was approached by the local Auvergne government. Before this we had been working locally with organisations such as the Lemptégy volcano and Vulcania to help disseminate geoscience ideas to the general public, however the UNESCO project has lead us to do much more outreach. It has also stimulated our research and has taught us to better explain this to the lay person. In visiting other heritage projects, where we have exchanged ideas and best practice, we have been able to help other sites and improve what we do. These links are particularly important, as they can be used to help broaden the outlook of the general public and local actors, and increase further earth science literacy. I have noticed a strong increase in the awareness of the volcanoes, and volcanism as a result of the Chaîne des Puys and Limagne Fault project. I think that, before, many locals considered the volcanoes only as their special back garden, for easy walks and views and leisure, or for that matter farming, mining and hunting. However, now, there is a greater sense of pride rooted in the increased awareness of their geological significance in a historical and global context. While this effect is clear for the volcanoes, it is not yet apparent for the fault. The lay person has no clear concept of a rift and a fault. Thus, one of our major present challenges is to open the public's eyes to the fault. This is vital for the UNESCO project not only for educational reasons, but also because the fault scarp is a natural barrier that protects the rest of the property from urban development. Only if there is awareness of its nature and significance will it be an effective defence. To arrive at this goal, there is now a local government sponsored project to create and disseminate fault walks, fault viewpoints and fault information points. This is

  1. A method for fast determination of epigallocatechin gallate (EGCG, epicatechin (EC, catechin (C and caffeine (CAF in green tea using HPLC Método rápido para determinação de galato de epigalocatequina (EGCG, epicatequina (EC, catequina (C e cafeína (CAF em chá verde usando CLAE

    Directory of Open Access Journals (Sweden)

    Samuel T. Saito

    2006-06-01

    Full Text Available Tea has been considered a medicine and a healthy beverage since ancient times, but recently it has received a great deal of attention because of its antioxidant properties. Green tea polyphenols have demonstrated to be an effective chemopreventive agent. Recently, investigators have found that EGCG, one of the green tea catechins, could have anti-HIV effects when bound to CD4 receptor. Many factors can constitute important influences on the composition of tea, such as species, season, age of the leaf, climate, and horticultural practices (soil, water, minerals, fertilizers. This paper presents an HPLC analytical methodology development, using column RP-18 and mobile phase composed by water, acetonitrile, methanol, ethyl acetate, glacial acetic acid (89:6:1:3:1 v/v/v/v/v for simultaneous determination and quantification of caffeine (CAF, catechin (C, epicatechin (EC and epigallocatechin gallate (EGCG in samples of Camellia sinensis (green tea grown in Brazil and harvested in spring, in summer and in autumn, in comparison to Brazilian black tea, to samples of Japanese and Chinese green tea and to two standardized dry extracts of green tea. The method has been statistically evaluated and has proved to be adequate to qualitative and quantitative determination of the samples.O chá vem sendo considerado uma bebida saudável e com propriedades medicinais desde tempos bem remotos, mas recentemente tem ganhado grande interesse no meio científico devido a suas atividades como antioxidante. Os polifenóis do chá verde vêm demonstrando possuir atividades quimiopreventivas. Recentemente, pesquisadores descobriram que o EGCG, a principal catequina do chá verde, poderia ter efeito anti-HIV quando acoplado ao receptor CD4. Muitos fatores podem influenciar de forma significativa na composição do chá, como sua espécie, estação que foi colhida, idade da folha, clima e técnicas de cultura (solo, irrigação e fertilizantes. Este artigo vem apresentar

  2. Chirp subbottom profiler data collected in Pamlico Sound on cruise RVRiggs_05_23_24_2012 of RV Riggs for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...

  3. Chirp subbottom profiler data collected in Pamlico Sound on cruise EPamSh-2016 of RV Riggs for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...

  4. Chirp subbottom profiler data collected in Pamlico Sound on cruise RVRiggs_07_31_2013 of RV Riggs for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...

  5. Chirp subbottom profiler data collected in Pamlico Sound on cruise RVRiggs_07_30_2013 of RV Riggs for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...

  6. Chirp subbottom profiler data collected in Pamlico Sound on cruise SndPt_05_21_22_2012 of RV Riggs for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers...

  7. Chirp subbottom profiler data collected in Pamlico Sound on cruise RVRiggs_05_20_22_2014 of RV Riggs for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Edgetech 216 chirp data (SEG-Y format) collected for the Coastal Hydrodynamics and Natural Geologic Evolution (CHaNGE) project, OCE-1130843. Survey area covers the...

  8. Bacterial Feeders, the Nematode Caenorhabditis elegans and the Flagellate Cercomonas longicauda, have different Effects on Outcome of Competition among the Pseudomonas Biocontrol Strains CHA0 and DSS73

    DEFF Research Database (Denmark)

    Pedersen, Annette; Nybroe, Ole; Winding, Anne

    2009-01-01

    How bacterial feeding fauna affects colonization and survival of bacteria in soil is not well understood, which constrains the applicability of bacterial inoculants in agriculture. This study aimed to unravel how food quality of bacteria and bacterial feeders with different feeding habits (the......50090 or one of two biocontrol strains P. fluorescens CHA0 or Pseudomonas sp. DSS73) or combinations of two bacterial strains. DSM50090 is a suitable food bacterium, DSS73 is of intermediate food quality, and CHA0 is inedible to the bacterial feeders. Bacterial and protozoan cell numbers were measured...... predation pressure. Hence, the results suggested that the outcome of competition among bacteria depended on their ability to cope with the prevailing bacterial predator....

  9. Variation of theanine, phenolic, and methylxanthine compounds in 21 cultivars of Camellia sinensis harvested in different seasons.

    Science.gov (United States)

    Fang, Rui; Redfern, Sally P; Kirkup, Don; Porter, Elaine A; Kite, Geoffrey C; Terry, Leon A; Berry, Mark J; Simmonds, Monique S J

    2017-04-01

    This is the first study to use chemometric methods to differentiate among 21 cultivars of Camellia sinensis from China and between leaves harvested at different times of the year using 30 compounds implicated in the taste and quality of tea. Unique patterns of catechin derivatives were observed among cultivars and across harvest seasons. C. sinensis var. pubilimba (You 510) differed from the cultivars of C. sinensis var. sinensis, with higher levels of theobromine, (+)-catechin, gallocatechin, gallocatechin gallate and theasinensin B, and lower levels of (-)-epicatechin, (-)-epigallocatechin (EGC) and (-)-epigallocatechin gallate (EGCG), respectively. Three cultivars of C. sinensis var. sinensis, Fuyun 7, Qiancha 7 and Zijuan contained significantly more caffeoylquinic acids than others cultivars. A Linear Discriminant Analysis model based on the abundance of 12 compounds was able to discriminate amongst all 21 tea cultivars. Harvest time impacted the abundance of EGC, theanine and afzelechin gallate. Copyright © 2016. Published by Elsevier Ltd.

  10. Structural, morphological, and optical properties of tin(IV) oxide nanoparticles synthesized using Camellia sinensis extract: a green approach

    Science.gov (United States)

    Selvakumari, J. Celina; Ahila, M.; Malligavathy, M.; Padiyan, D. Pathinettam

    2017-09-01

    Tin oxide (SnO2) nanoparticles were cost-effectively synthesized using nontoxic chemicals and green tea ( Camellia sinensis) extract via a green synthesis method. The structural properties of the obtained nanoparticles were studied using X-ray diffraction, which indicated that the crystallite size was less than 20 nm. The particle size and morphology of the nanoparticles were analyzed using scanning electron microscopy and transmission electron microscopy. The morphological analysis revealed agglomerated spherical nanoparticles with sizes varying from 5 to 30 nm. The optical properties of the nanoparticles' band gap were characterized using diffuse reflectance spectroscopy. The band gap was found to decrease with increasing annealing temperature. The O vacancy defects were analyzed using photoluminescence spectroscopy. The increase in the crystallite size, decreasing band gap, and the increasing intensities of the UV and visible emission peaks indicated that the green-synthesized SnO2 may play future important roles in catalysis and optoelectronic devices.

  11. Formation and emission of linalool in tea (Camellia sinensis) leaves infested by tea green leafhopper (Empoasca (Matsumurasca) onukii Matsuda).

    Science.gov (United States)

    Mei, Xin; Liu, Xiaoyu; Zhou, Ying; Wang, Xiaoqin; Zeng, Lanting; Fu, Xiumin; Li, Jianlong; Tang, Jinchi; Dong, Fang; Yang, Ziyin

    2017-12-15

    Famous oolong tea (Oriental Beauty), which is manufactured by tea leaves (Camellia sinensis) infected with tea green leafhoppers, contains characteristic volatile monoterpenes derived from linalool. This study aimed to determine the formation mechanism of linalool in tea exposed to tea green leafhopper attack. The tea green leafhopper responsible for inducing the production of characteristic volatiles was identified as Empoasca (Matsumurasca) onukii Matsuda. E. (M.) onukii attack significantly induced the emission of linalool from tea leaves (ptea leaves exposed to E. (M.) onukii attack. This information should prove helpful for the future use of stress responses of plant secondary metabolism to improve quality components of agricultural products. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. EFEITO DA ADUBAÇÃO VERDE NA CULTURA DO MILHO (Zea mays L.

    Directory of Open Access Journals (Sweden)

    Maxwel Rodrigues Nascimento

    2017-03-01

    Full Text Available A adubação verde consiste no cultivo de diferentes espécies vegetais em uma mesma área, em sucessão ou simultaneamente com a finalidade principal de melhorar a fertilidade do solo. Prefere-se assim, aquelas que produzam maior volume de matéria seca, estejam menos sujeitas a pragas e doenças e que possuam sementes relativamente uniformes e fáceis de semear. As plantas da família Fabaceae são as mais utilizadas na adubação verde por apresentarem elevado potencial em fixar o nitrogênio atmosférico.  Objetivou-se com a realização deste trabalho elaborar uma revisão de literatura sobre o rendimento da cultura do milho em consórcio e sucessão às espécies vegetais utilizadas para adubação verde. Com base nos resultados obtidos é possível inferir que a prática da adubação verde na cultura do milho é viável, além de melhorar a fertilidade e as características físicas do solo diminui a dependência por adubos minerais.

  13. Laguna Verde nuclear power plant: an experience to consider in advanced BWR design

    International Nuclear Information System (INIS)

    Fuentes Marquez, L.

    2001-01-01

    Laguna Verde is a BWR 5 containment Mark II. Designed by GE, two external re-circulation loops, each of them having two speed re-circulation pump and a flow control valve to define the drive flow and consequently the total core flow an power control by total core flow. Laguna Verde Design and operational experience has shown some insights to be considering in design for advanced BRW reactors in order to improve the potential of nuclear power plants. NSSS and Balance of plant design, codes used to perform nuclear core design, margins derived from engineering judgment, at the time Laguna Verde designed and constructed had conducted to have a plant with an operational license, generating with a very good performance and availability. Nevertheless, some design characteristics and operational experience have shown that potential improvements or areas of opportunity shall be focused in the advanced BWR design. Computer codes used to design the nuclear core have been evolved relatively fast. The computers are faster and powerful than those used during the design process, also instrumentation and control are becoming part of this amazing technical evolution in the industry. The Laguna Verde experience is the subject to share in this paper. (author)

  14. Optimizing soil and water management in dryland farming systems in Cabo Verde

    NARCIS (Netherlands)

    Santos Baptista Costa, Dos I.

    2016-01-01

    “Optimizing Soil and Water Management in Dryland Farming Systems in Cabo Verde”

    Isaurinda Baptista

    Summary

    Soil and land degradation poses a great challenge for sustainable development worldwide and, in Cabo Verde, has strongly affected both

  15. New aspects in the radiological emergency plan outside the Nuclear power plant of Laguna Verde

    International Nuclear Information System (INIS)

    Alva L, S.

    1991-01-01

    The Mexican government through the National Commission of Nuclear Safety and Safeguards has imposed to the Federal Commission of Electricity to fulfill the requirement of having a functional Emergency Plan and under the limits that the regulator organisms in the world have proposed. The PERE (Plan of External Radiological Emergency) it has been created for the Nuclear Power station of Laguna Verde, Mexico

  16. Verde urbano e processi ambientali: per una progettazione di paesaggio multifunzionale

    Directory of Open Access Journals (Sweden)

    Raffaele Pelorosso

    2013-04-01

    Full Text Available L’impermeabilizzazione delle superfici determina un’alterazione del sistema idrologico, con un incremento dei volumi e dei picchi dei deflussi delle acque meteoriche. Il fenomeno è destinato a progredire, sia per il contributo che vi deriva dalla costante crescita delle superfici urbanizzate (urban sprawl, sia per i cambiamenti climatici in atto, che accentuano la frequenza delle piogge critiche. Una serie di misure e tecniche (Best Management Practices, BMPs sono state sviluppate per la gestione sostenibile delle acque meteoriche urbane. Alcune  BMPs (es: verde pensile, bacini di detenzione/ritenzione, zone umide possono svolgere inoltre una funzione ecologica (divenendo habitat per specie animali e vegetali, di termoregolazione, estetica e di promozione del capitale sociale. È quindi necessario sperimentare metodologie di progettazione e gestione del verde urbano e periurbano, la cui multifunzionalità consente di perseguire la strada della sostenibilità ambientale. Su tale traccia, questo lavoro presenta un percorso metodologico orientato a valutare alcune strategie integrate di controllo dei deflussi urbani, attraverso l’aumento della permeabilità di alcune parti sensibili di città. Il verde, quindi, non è visto come semplice infrastruttura necessaria a soddisfare generici standard urbanistici, ma ne sono analizzate le funzionalità, in questa prima fase di carattere idrologico, ma che, in prospettiva, con la stessa armatura verde, esso può assumere un ruolo ecologico, sociale, di mitigazione del clima e di emissione di gas clima-alteranti.

  17. Cape Verde Report on the Observance of Standards and Codes : Accounting and Auditing

    OpenAIRE

    World Bank

    2012-01-01

    This Report on the Observance of Standards and Codes (ROSC) provides an assessment of the strengths and weaknesses of the existing financial reporting infrastructure that underpins financial accounting and auditing practices in Cape Verde. The assessment focuses on six pillars of financial reporting infrastructure: statutory framework, professional education and training, accountancy profe...

  18. Geochemical stratigraphy of submarine lavas (3-5 Ma) from the Flamengos Valley, Santiago, Cape Verde

    DEFF Research Database (Denmark)

    Barker, Abigail K; Holm, Paul Martin; Peate, David W.

    2009-01-01

    New high-precision Pb-Sr-Nd isotope, major and trace element and mineral chemistry data are presented for the submarine stage of ocean island volcanism on Santiago, one of the southern islands of the Cape Verde archipelago. Pillow basalts and hyaloclastites in the Flamengos Valley are divided...

  19. Mesa Verde: A Study of Man in an Agricultural Setting. Student Manual.

    Science.gov (United States)

    Community Health Service (DHEW/PHS), Bethesda, MD.

    This student manual contains information and guides to assist the secondary student in functioning as an archeologist. Included are fables, pictures for analysis, a time line and description of the pre-history of Mesa Verde, Colorado. The manual concludes with artifact identification word sheets. A related document is ED 001 722. (AWW)

  20. Immigration and Resiliency: Unpacking the Experiences of High School Students from Cape Verde and Ethiopia

    Science.gov (United States)

    Hersi, Afra Ahmed

    2011-01-01

    This article explores the complex factors, both individual and social, that contribute to the resiliency and academic achievement of six adolescent African immigrant students from Cape Verde and Ethiopia who were enrolled in a small high school in the United States. The school was designed specifically for recent adolescent immigrant students.…

  1. Synthesis of Upper Verde River research and monitoring 1993-2008

    Science.gov (United States)

    Daniel G. Neary; Alvin L. Medina; John N. Rinne

    2012-01-01

    This volume is a state-of-knowledge synthesis of monitoring and research conducted on the Upper Verde River (UVR) of Arizona. It contains information on the history, hydrology, soils, geomorphology, vegetation, and fish fauna of the area that can help land managers and other scientists in successfully conducting ecosystem management and future monitoring and research...

  2. Promoting Distance Education in Higher Education in Cape Verde and Mozambique

    Science.gov (United States)

    Ramos, Fernando; Taju, Gulamo; Canuto, Louisette

    2011-01-01

    Over the past six years, the authors have been project leaders for three distance education initiatives in Cape Verde and Mozambique: (1) a blended learning master's degree in multimedia in education for faculty in Cape Verdean public higher education institutions (2005-2008); (2) a teacher training programme for 1375 elementary teachers provided…

  3. Verde plant bug is associated with cottong boll rot in South Texas cotton

    Science.gov (United States)

    Verde plant bug was the dominant boll-feeding sucking bug species (>98% of insects collected using a beat bucket) from peak to late bloom in cotton fields near the coast along the Coastal Bend of South Texas, from Port Lavaca to the Lower Rio qrande Valley in 2010 and 2011. It was common in fields w...

  4. Environmental Education Evaluation at the School: An Example in Sao Nicolau Island, Cape Verde

    Science.gov (United States)

    Graziani, Pietro; Cabral, Daniel; Santana, Nelson

    2013-01-01

    Monte Gordo Natural Park (MGNP) is part of the Cape Verde (CV) Protected Areas National Network. In order to create an effective Environmental Education (EE) curriculum, it is crucial to first identify the level of environmental knowledge of both teachers and students. In 2007 we implemented a set of four surveys to students and educators and…

  5. Impacts of the Conservation Education Program in Serra Malagueta Natural Park, Cape Verde

    Science.gov (United States)

    Burnett, Edmund; Sills, Erin; Peterson, M. Nils; DePerno, Christopher

    2016-01-01

    Environmental and conservation education programs are commonly offered in the rapidly expanding network of protected areas in developing countries. There have been few evaluations of these programs and their impacts on participants. At Serra Malagueta Natural Park in Cape Verde, we assessed changes in environmental knowledge, opinions, and…

  6. Lotus alianus, a new species from Cabo Verde and nomeenclatural notes on Lotus section Pedrosia (Fabaceae)

    Science.gov (United States)

    Lotus alianus J.H. Kirkbr., sp. nov., is described and illustrated. It is a rare endemic species from the Republic of Cape Verde, and is found in dry habitats on just two islands, Ilhas de Santo Antao and Sao Vicente. In addition, two species names are synonymized with L. creticus L., and a lectotyp...

  7. The volcanic and geochemical development of São Nicolau, Cape Verde Islands

    DEFF Research Database (Denmark)

    Duprat, Helene Inga; Holm, Paul Martin; Sherson, Jacob Friis

    2007-01-01

    We present 34 new age results from 40 Ar/39 Ar incremental heating analyses of groundmass separates from volcanic rocks from São Nicolau, Cape Verde. Combining the age results with field observations, we show that the volcanic activity that formed the island occurred in four separate stages: 1: >6...

  8. Design optimization for fuel reloading in Laguna Verde nuclear power plant

    International Nuclear Information System (INIS)

    Cortes Campos, C.C.; Montes Tadeo, J.L.

    1991-01-01

    Procedure followed to perform the design optimation in fuel reloading is described in general words and also is shown an example in which such procedure was uses for analysis of BWR type reactor in unit 1 of Laguna Verde nuclear power plant (Author)

  9. Internal event analysis of Laguna Verde Unit 1 Nuclear Power Plant. System Analysis

    International Nuclear Information System (INIS)

    Huerta B, A.; Aguilar T, O.; Nunez C, A.; Lopez M, R.

    1993-01-01

    The Level 1 results of Laguna Verde Nuclear Power Plant PRA are presented in the I nternal Event Analysis of Laguna Verde Unit 1 Nuclear Power Plant , CNSNS-TR-004, in five volumes. The reports are organized as follows: CNSNS-TR-004 Volume 1: Introduction and Methodology. CNSNS-TR-004 Volume 2: Initiating Event and Accident Sequences. CNSNS-TR-004 Volume 3: System Analysis. CNSNS-TR-004 Volume 4: Accident Sequence Quantification and Results. CNSNS-TR-004 Volume 5: Appendices A, B and C. This volume presents the results of the system analysis for the Laguna Verde Unit 1 Nuclear Power Plant. The system analysis involved the development of logical models for all the systems included in the accident sequence event tree headings, and for all the support systems required to operate the front line systems. For the Internal Event analysis for Laguna Verde, 16 front line systems and 5 support systems were included. Detailed fault trees were developed for most of the important systems. Simplified fault trees focusing on major faults were constructed for those systems that can be adequately represent,ed using this kind of modeling. For those systems where fault tree models were not constructed, actual data were used to represent the dominant failures of the systems. The main failures included in the fault trees are hardware failures, test and maintenance unavailabilities, common cause failures, and human errors. The SETS and TEMAC codes were used to perform the qualitative and quantitative fault tree analyses. (Author)

  10. Modernization of the turbo in the Laguna Verde Nuclear Power Plant

    International Nuclear Information System (INIS)

    Liebana, B.; Merino, A.; Cobos, A.; Gonzalez, J. J.

    2010-01-01

    The power increase of the Laguna Verde Nuclear Power Plant is a project for the rehabilitation and modernization of the turbo and associated equipment to get an increase of its power and of its service life. The project scope includes the design, the engineering, the equipment supply, the installation, the testing and the commissioning. This paper describes the first phase of the project.

  11. A volcanological and geochemical investigation of Boa Vistta, Cape Verde Islands

    DEFF Research Database (Denmark)

    Dyhr, Charlotte Thorup; Holm, Paul Martin

    2009-01-01

    Boa Vista, the easternmost island in the Cape Verde archipelago, consists of volcanic products, minor intrusions and a thin partial sedimentary cover. The first 15 age results from 40Ar/39Ar incremental heating analysis of groundmass separates from volcanic and plutonic rocks from Boa Vista are p...

  12. Mesa Verde: A Study of Man in an Agricultural Setting. Library Packet.

    Science.gov (United States)

    Community Health Service (DHEW/PHS), Bethesda, MD.

    This collection of secondary readings contains general information about the ecology of living space, and specific information about the prehistory ecology of Mesa Verde, Colorado. There is also a section on how anthropologists use trees to date artifacts. A related document is indexed as ED 001 721. (AWW)

  13. Zoanthids of the Cape Verde Islands and their symbionts: previously unexamined diversity in the Northeastern Atlantic

    NARCIS (Netherlands)

    Reimer, J.D.; Hirose, M.; Wirtz, P.

    2010-01-01

    The marine invertebrate fauna of the Cape Verde Islands contains many endemic species due to their isolated location in the eastern Atlantic, yet research has not been conducted on most taxa here. One such group are the zoanthids or mat anemones, an order of benthic cnidarians (Hexacorallia:

  14. Sediment transport on the Palos Verdes shelf, California

    Science.gov (United States)

    Ferre, B.; Sherwood, C.R.; Wiberg, P.L.

    2010-01-01

    Sediment transport and the potential for erosion or deposition have been investigated on the Palos Verdes (PV) and San Pedro shelves in southern California to help assess the fate of an effluent-affected deposit contaminated with DDT and PCBs. Bottom boundary layer measurements at two 60-m sites in spring 2004 were used to set model parameters and evaluate a one-dimensional (vertical) model of local, steady-state resuspension, and suspended-sediment transport. The model demonstrated skill (Brier scores up to 0.75) reproducing the magnitudes of bottom shear stress, current speeds, and suspended-sediment concentrations measured during an April transport event, but the model tended to underpredict observed rotation in the bottom-boundary layer, possibly because the model did not account for the effects of temperature-salinity stratification. The model was run with wave input estimated from a nearby buoy and current input from four to six years of measurements at thirteen sites on the 35- and 65-m isobaths on the PV and San Pedro shelves. Sediment characteristics and erodibility were based on gentle wet-sieve analysis and erosion-chamber measurements. Modeled flow and sediment transport were mostly alongshelf toward the northwest on the PV shelf with a significant offshore component. The 95th percentile of bottom shear stresses ranged from 0.09 to 0.16 Pa at the 65-m sites, and the lowest values were in the middle of the PV shelf, near the Whites Point sewage outfalls where the effluent-affected layer is thickest. Long-term mean transport rates varied from 0.9 to 4.8 metric tons m-1 yr-1 along the 65-m isobaths on the PV shelf, and were much higher at the 35-m sites. Gradients in modeled alongshore transport rates suggest that, in the absence of a supply of sediment from the outfalls or PV coast, erosion at rates of ???0.2 mm yr-1 might occur in the region southeast of the outfalls. These rates are small compared to some estimates of background natural sedimentation

  15. Ancient mortars from Cape Verde: mineralogical and physical characterization

    Science.gov (United States)

    Rocha, Fernando; Costa, Cristiana; Velosa, Ana; Quintela, Ana; Terroso, Denise; Marques, Vera

    2014-05-01

    Times and locations of different building constructions means different knowledge, habits, different construction methods and materials. The study and safeguarding of the architectural heritage takes nowadays a progressive importance as a vehicle for transmission of cultures and history of nations. The coatings are of great importance in the durability of a building due to the protective role of the masonry. The compatibility between the materials with which they are executed (masonry, mortar and grout settlement) promotes the proper functioning of the wall and a consequent increase in durability. Therefore, it becomes important to study and characterize the mortar coating of buildings to know its characteristics and to use compatible materials in the rehabilitation and maintenance of buildings. This study aims to characterize the chemical, physical, mechanical and mineralogical mortar samples collected in buildings in three islands of Cape Verde, for the conservation, rehabilitation and preservation of them. The collected samples belong to buildings constructed in the end of XIX century and in the beginning of XX century. In order to characterize the mortar samples some tests was made, such as X-Ray Diffraction, X- Ray Fluorescence, acid attack and mechanical strength. The samples were divided into three groups depending on origin; so we have a first group collected on the island of Santiago, the second on the island of Saint Vincent and the third on the island of Santo Antao. The samples are all carbonated, but Santiago samples have a lower carbonates content. In terms of insoluble residue (from the acid attack) it was concluded that the samples have similar value ranging from 9 to 26%. The compressive strength of the mortars have a range between 1.36 and 4.55 MPa, which is related to the presence of more binder in samples with higher resistance. The chemical and mineralogical analyzes showed that these consist of lime mortars (binder), natural pozzolan and

  16. Physiochemical characteristics, fatty acid profile and tocopherol composition of the oil from Camellia oleifera Abel cultivated in Henan, China

    Directory of Open Access Journals (Sweden)

    J. B. Hu

    2018-06-01

    Full Text Available As a unique woody oil tree, Camellia oleifera Abel originates from southern China and is now being cultivated in central China, such as the southern Henan province. The aim of this work is to determine some physiochemical parameters, fatty acid profile and tocopherol composition of the Camellia oleifera seed oils harvested in southern Henan in the 2016 season. The lipid contents of the kernel are in the range of 28.39- 56.94% on dry matter. The acid value (AV, saponification value (SV, iodine value (IV, and refractive index of the oils are in the ranges: 0.22-5.17 mg KOH/g, 178.90-196.91 mg KOH/g, 82.0-87.1 g I2/100g, and 1.4667-1.4720 (nD25 , respectively. The main fatty acids are: palmitic 7.07-9.52%, palmitoleic 0.09-0.22%, stearic 1.45-2.94%, oleic 77.02-84.33%, linoleic 5.19-11.23%, linolenic 0.53-0.70% and arachidic 0.22-0.70%. The sn-2 fatty acid composition is: 84.36-91.33% oleic, 7.14-14.22% linoleic, and 0.89-1.96% others. The tocopherol content is in the range of 39.55-75.94 mg/100g oil, including mainly α-tocopherol (33.98-67.82 mg/100g and γ-tocopherol (5.57- 8.27 mg/100g when the oils are extracted with hexane; and 14.91-44.36 mg/100g, including mainly α-tocopherol (9.42-37.08 mg/100g and γ-tocopherol (5.50-7.33 mg/100g when the oils are extracted by ethyl ether. The physiochemical properties C. oleifera seed oils from southern Henan are similar to those from other districts of China.

  17. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Science.gov (United States)

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  18. From introduced American weed to Cape Verde Islands endemic: the case of Solanum rigidum Lam. (Solanaceae, Solanum subgenus Leptostemonum).

    Science.gov (United States)

    Knapp, Sandra; Vorontsova, Maria S

    2013-01-01

    A Solanum species long considered an American introduction to the Cape Verde Islands off the west coast of Africa is identified as Solanum rigidum, a member of the Eggplant clade of Old World spiny solanums (Solanum subgenus Leptostemonum) and is probably endemic to the Cape Verde Islands. Collections of this species from the Caribbean are likely to have been introduced from the Cape Verde Islands on slave ships. We discuss the complex nomenclatural history of this plant and provide a detailed description, illustration and distribution map. The preliminary conservation status of Solanum rigidum is Least Concern, but needs to be reassessed in light of its endemic rather than introduced status.

  19. The Cosmological Vision of the Yoruba-Idààcha of Benin Republic (West Africa): A Light on Yoruba History and Culture

    Science.gov (United States)

    Sègla, Aimé Dafon

    The essay examines Idààcha cosmological vision as a kind of incorporation of Yoruba cosmology. It shows a process where the two strands, that is to say, knowledge and belief can not be readily distinguished. The divinatory traditional calendar is indeed based on a scale of fixed number values whose definitions are drawn from the concepts early traditional people have of the universe. Thus, the signification of the terms that designate entities such as angle, circle, center of the circle, midnight, time zone, the number of days in a week, etc., in the Yoruba dialect Idààcha, mirrors cosmological standards. These words constitute a landscape of memory shedding light on early Yoruba culture and history. Hence, Idààcha being a significant western periphery of the Yoruba region, we examine why its divinatory calendar would preserve an older spatio-temporal logic, beyond Ifè and Oyo revisionism in Yoruba history. Finally, the article points out that the translation of spatial and geometrical relations into temporal terms and vice-versa may suggest a new indexical approach to the study of cosmology in relation to the human body. As the body is in the mind, we say in relation to the human mind.

  20. Occurrence of an unknown Atlantic eruption in the Chaîne des Puys volcanic field (Massif Central, France)

    Science.gov (United States)

    Jouannic, G.; Walter-Simonnet, A. V.; Bossuet, G.; Cubizolle, H.; Boivin, P.; Devidal, J. L.; Oberlin, C.

    2014-08-01

    A volcanic ash layer, called MF1, was recently identified in Holocene sediments from the Gourgon and Molhiac peat bogs (Monts du Forez, French Massif Central). This ash layer consists of colorless shards with a heterogeneous trachytic to rhyolitic composition. The trace elements analyzed by Laser Ablation Inductively Coupled Plasma Mass Spectrometry (LA-ICP-MS) attest to a local origin. Radiocarbon dating of peat samples taken within and below the ash layer indicates the best age at 6339 ± 61 cal yr BP, i.e. an age contemporaneous with the volcanic activity of Montchal, Montcineyre and Pavin volcanoes from the Chaîne des Puys volcanic field. These volcanoes are characterized by basaltic and trachytic products, thus the rhyolitic composition of MF1 tephra suggests that it is likely originated from an unknown eruption. These results again confirm the interest of studying the distal volcanic ash fallouts in order to establish or specify records of past eruptions of volcanic fields. Identification of this new tephra layer also provides an additional tephrochronological marker for Eastern French Massif Central.

  1. Grand Sarcoui volcano (Chaîne des Puys, Massif Central, France), a case study for monogenetic trachytic lava domes

    Science.gov (United States)

    Miallier, D.; Pilleyre, T.; Boivin, P.; Labazuy, P.; Gailler, L.-S.; Rico, J.

    2017-10-01

    The Grand Sarcoui is a prominent trachytic volcano of the intraplate Quaternary volcanic field of Chaîne des Puys (Massif Central, France), which fulfills basic requirements for being qualified as monogenetic. Grand Sarcoui looks like a simple axisymmetric lava dome, but close observation reveals a complex and dissymmetric structure and composition. The construction of the dome, about 12.5 ka ago, combined both endogenous and exogenous growth which resulted in variable modes of emplacement and textures of the lava. One of its most interesting features is a large ( 0.29 106 m2) fan of deposits bearing hummocks and secondary hydro-eruption craters. Cross sections of these deposits demonstrate that they originated from a sector collapse accompanied by a blast-like event. The dome is covered by a thin layer of lapilli and ash, attributed to a delayed summit eruption which occurred about 10.6 ka ago, surprisingly late after its construction. So, this volcano has, at a reduced scale, features that are more usually observed in large composite volcanoes. However, some of these features differ slightly from those that have been documented to date, and they remain partly unexplained. This shows that monogenetic, well preserved, trachytic lava domes, are uncommon and poorly known, unlike rhyolitic, andesitic and dacitic domes.

  2. Larvicidal activity against Aedes aegypti of Foeniculum vulgare essential oils from Portugal and Cape Verde.

    Science.gov (United States)

    Rocha, Diara Kady; Matosc, Olivia; Novoa, Maria Teresa; Figueiredo, Ana Cristina; Delgado, Manuel; Moiteiro, Cristina

    2015-04-01

    Dengue is a potentially fatal mosquito-borne infection with 50 million cases per year and 2.5 billion people vulnerable to the disease. This major public health problem has recurrent epidemics in Latin America and occurred recently in Cape Verde and Madeira Island. The lack of anti-viral treatment or vaccine makes the control of mosquito vectors a high option to prevent virus transmission. Essential oil (EO) constituents can affect insect's behaviour, being potentially effective in pest control. The present study evaluated the potential use of Foenicultm vulgare (fennel) EO in the control of the dengue vector Aedes aegypti. EOs isolated from fennel aerial parts collected in Cape Verde and from a commercial fennel EO of Portugal were analysed by NMR, GC and GC-MS. trans-Anethole (32 and 30%, respectively), limonene (28 and 18%, respectively) and fenchone (10% in both cases) were the main compounds identified in the EOs isolated from fennel from Cape Verde and Portugal, respectively. The larvicidal activity of the EOs and its major constituents were evaluated, using WHO procedures, against third instar larvae ofAe. aegypti for 24 h. Pure compounds, such as limonene isomers, were also assayed. The lethal concentrations LC50, C90 and LC99 were determined by probit analysis using mortality rates of bioassays. A 99% mortality of Ae. aegypti larvae was estimated at 37.1 and 52.4 µL L-1 of fennel EOs from Cape Verde and Portugal, respectively. Bioassays showed that fennel EOs from both countries displayed strong larvicidal effect against Ae. aegypti, the Cape Verde EO being as active as one of its major constituents, (-)-limonene.

  3. Recent research advances and ethno-botanical history of miang, a traditional fermented tea (Camellia sinensis var. assamica) of northern Thailand

    OpenAIRE

    Chartchai Khanongnuch; Kridsada Unban; Apinun Kanpiengjai; Chalermpong Saenjum

    2017-01-01

    Miang is an ethnic fermented tea leaf (Camellia sinensis var. assamica) from northern Thailand. It has a long history of sociocultural relationship with northern Thai people. Unlike other types of tea, miang is a unique product that is known as chewing tea or eating tea. In addition, it is also a specific food for traditional religious ceremonies and funerals. Although chewing of miang has become less popular among younger generations, there remains a demand for miang in specific areas of nor...

  4. Genetic Variation of Flavonols Quercetin, Myricetin, and Kaempferol in the Sri Lankan Tea (Camellia sinensis L. and Their Health-Promoting Aspects

    Directory of Open Access Journals (Sweden)

    Brasathe Jeganathan

    2016-01-01

    Full Text Available Flavonol glycosides in tea leaves have been quantified as aglycones, quercetin, myricetin, and kaempferol. Occurrence of the said compounds was reported in fruits and vegetable for a long time in association with the antioxidant potential. However, data on flavonols in tea were scanty and, hence, this study aims to envisage the flavonol content in a representative pool of accessions present in the Sri Lankan tea germplasm. Significant amounts of myricetin, quercetin, and kaempferol have been detected in the beverage type tea accessions of the Sri Lankan tea germplasm. This study also revealed that tea is a good source of flavonol glycosides. The Camellia sinensis var. sinensis showed higher content of myricetin, quercetin, and total flavonols than var. assamica and ssp. lasiocalyx. Therefore flavonols and their glycosides can potentially be used in chemotaxonomic studies of tea germplasm. The nonbeverage type cultivars, especially Camellia rosaflora and Camellia japonica Red along with the exotic accessions resembling China type, could be useful in future germplasm studies because they are rich sources of flavonols, namely, quercetin and kaempferol, which are potent antioxidants. The flavonol profiles can be effectively used in choosing parents in tea breeding programmes to generate progenies with a wide range of flavonol glycosides.

  5. Relationship of CHA2DS2-VASc and CHADS2 score to left atrial remodeling detected by velocity vector imaging in patients with atrial fibrillation.

    Directory of Open Access Journals (Sweden)

    Yihui Li

    Full Text Available BACKGROUND: The CHADS2/CHA2DS2-VASc scores are used to predict thrombo-embolic/stroke in patients with nonvalvular atrial fibrillation (AF. Nevertheless, limited data are available regarding the association between these risk stratification for stroke and left atrial (LA remodeling status of AF patients. The purpose of this study was to explore the association between these scores and LA remodeling status assessed quantificationally by echocardiography in AF patients. METHODS: One hundred AF patients were divided into 3 groups based on the CHA2DS2-VASc/CHADS2 score: the score of 0 (low stroke risk, the score of 1 (moderate stroke risk and the score of ≥2 (high stroke risk. All patients were performed through conventional and velocity vector imaging echocardiography. Echocardiographic parameters: maximum LA volume index (LAVImax, LA total emptying fraction (LAEFt and LA mean strain were obtained to assess quantificationally LA remodeling status. RESULTS: On categorizing with CHA2DS2-VASc, the score of 1 group showed augment in LAVImax and attenuation in LA mean strain derived from VVI, compared with the score of 0 group (LAVImax: 40.27±21.91 vs. 26.79±7.87, p=0.002; LA mean strain: 15.18±6.36 vs. 22±8.54, p=0.001. On categorizing with the CHADS2 score, similar trends were seen between the score of ≥2 and 1 groups (LAVImax: 43.72±13.77 vs. 31.41±9.50, p<0.001; LA mean strain: 11.01±5.31 vs. 18.63±7.00, p<0.001. With multivariate logistic regression, LAVImax (odds ratio: 0.92 , 95% C=I: 0.85 to 0.98, p= 0.01 and LA mean strain reflecting LA remodeling (odds ratio: 1.10, 95% CI: 1.02 to 1.19, p=0.01 were strongly predictive of the CHA2DS2-VASc score of 0. CONCLUSIONS: The superiority of the CHADS2 score may lay in identifying LA remodeling of AF patients with high stroke risk. Whereas, the CHA2DS2-VASc score was better than the CHADS2 score at identifying LA remodeling of AF patients presenting low stroke risk.

  6. Impact of CHA2DS2VASc Score on Candidacy for Anticoagulation in Patients With Atrial Fibrillation: A Multi-payer Analysis.

    Science.gov (United States)

    Patel, Aarti A; Nelson, Winnie W; Schein, Jeff

    2016-10-01

    The purpose of this study is to report on the effect of using CHA 2 DS 2 VASc (congestive heart failure, hypertension, age ≥75 years [doubled], type 1 or type 2 diabetes mellitus, stroke or transient ischemic attack or thromboembolism [doubled], vascular disease [prior myocardial infarction, peripheral artery disease, or aortic plaque], age 65-75 years, sex category [female]) rather than CHADS 2 (congestive heart failure, hypertension, age ≥75 years, diabetes mellitus, and prior stroke) to determine candidacy for anticoagulant prophylaxis in insured patients with atrial fibrillation (AF). Six administrative claims databases that included medical and pharmacy claims for patients aged ≥18 years with a new or existing diagnosis of AF and patient outcomes assessed for 1 year after diagnosis were analyzed. Retrospective health plan data analyses were performed using a software tool (Anticoagulant Quality Improvement Analyzer). Study measures included stroke risk (identified by CHADS 2 and CHA 2 DS 2 VASc scores), bleeding risk (identified by the Anticoagulation and Risk Factors in Atrial Fibrillation score), and anticoagulant use. A total of 115,906 patients with AF (range of mean ages among the 6 databases, 56-79 years) met the inclusion criteria. All ranges reported represent the minimum and maximum values among the 6 databases. Using the CHA 2 DS 2 VASc compared with the CHADS 2 index to assess stroke risk resulted in a 23% to 32% increase in patients considered potential candidates for anticoagulant prophylaxis. This translated to a 38% to 114% increase in the number of ostensibly undertreated patients. Among patients with high stroke and low bleeding risk, 18% to 28% more patients were considered potential candidates for anticoagulation treatment using CHA 2 DS 2 VASc compared with CHADS 2 , or a 57% to 151% increase in the number of undertreated patients. Use of the CHA 2 DS 2 VASc score to determine the risk of stroke increased the number of AF patients for

  7. Atividade das glicosidases na presença de chá verde e de chá preto

    OpenAIRE

    Pereira,L.L.S.; Souza,S.P.; Silva,M.C; Carvalho,G.A.; Santos,C.D.; Corrêa,A.D.; Abreu,C.M.P.

    2010-01-01

    Várias plantas têm sido consideradas produtos terapêuticos, dentre elas destacam-se os chás verde e preto, popularmente utilizados para controle da hiperglicemia e obesidade. Objetivou-se neste trabalho avaliar o potencial inibitório sobre as enzimas α-amilase, α e β-glicosidases e o teor de compostos fenólicos do chá verde e do chá preto. O teor de compostos fenólicos encontrados foram de 80,8 ± 0,43 mg g-1 no chá preto e 32,0 ± 0,12 mg g-1 no chá verde. O chá verde e o chá pr...

  8. Chemometric characterization of alembic and industrial sugar cane spirits from cape verde and ceará, Brazil.

    Science.gov (United States)

    Pereira, Regina F R; Vidal, Carla B; de Lima, Ari C A; Melo, Diego Q; Dantas, Allan N S; Lopes, Gisele S; do Nascimento, Ronaldo F; Gomes, Clerton L; da Silva, Maria Nataniela

    2012-01-01

    Sugar cane spirits are some of the most popular alcoholic beverages consumed in Cape Verde. The sugar cane spirit industry in Cape Verde is based mainly on archaic practices that operate without supervision and without efficient control of the production process. The objective of this work was to evaluate samples of industrial and alembic sugar cane spirits from Cape Verde and Ceará, Brazil using principal component analysis. Thirty-two samples of spirits were analyzed, twenty from regions of the islands of Cape Verde and twelve from Ceará, Brazil. Of the samples obtained from Ceará, Brazil seven are alembic and five are industrial spirits. The components analyzed in these studies included the following: volatile organic compounds (n-propanol, isobutanol, isoamylic, higher alcohols, alcoholic grade, acetaldehyde, acetic acid, acetate); copper; and sulfates.

  9. Impact of Diagenesis on Biosignature Preservation Potential in Playa Lake Evaporites of the Verde Formation, Arizona: Implications for Mars Exploration

    Science.gov (United States)

    Shkolyar, S.; Farmer, J. D.

    2016-05-01

    We studied evaporite subfacies in the Verde Fmn., AZ. We identified diagenetic pathways and assessed how diagenesis affected biosignature preservation potential (BPP) in each. Results revealed eight pathways, each with diverse impacts on BPP.

  10. Chemometric Characterization of Alembic and Industrial Sugar Cane Spirits from Cape Verde and Ceará, Brazil

    Directory of Open Access Journals (Sweden)

    Regina F. R. Pereira

    2012-01-01

    Full Text Available Sugar cane spirits are some of the most popular alcoholic beverages consumed in Cape Verde. The sugar cane spirit industry in Cape Verde is based mainly on archaic practices that operate without supervision and without efficient control of the production process. The objective of this work was to evaluate samples of industrial and alembic sugar cane spirits from Cape Verde and Ceará, Brazil using principal component analysis. Thirty-two samples of spirits were analyzed, twenty from regions of the islands of Cape Verde and twelve from Ceará, Brazil. Of the samples obtained from Ceará, Brazil seven are alembic and five are industrial spirits. The components analyzed in these studies included the following: volatile organic compounds (n-propanol, isobutanol, isoamylic, higher alcohols, alcoholic grade, acetaldehyde, acetic acid, acetate; copper; and sulfates.

  11. O sistema de animação Web da Rota dos Vinhos Verdes(Norte de Portugal

    Directory of Open Access Journals (Sweden)

    José Luís Reis

    2016-01-01

    Full Text Available The Web animation system of the Vinhos Verdes Route, assists, through a Web based technology platform, individuals to organize visits to places of tourist interest in the Vinhos Verdes Region. The animation system managed the content associated with the route members, the locations that contain services/ activities, the routes, the news and events that constitute a repository of all relevant information inherent to the heritage associated with wine tourism in the Vinhos Verdes Region. The animation system, which includes a Database Management System, interacts with a map‑based Framework of the Google Maps system, and is integrated in the Vinhos Verdes Region Web portal, establishing itself as one of the technical tools used by marketing, particularly to disseminate content, to understand the visitor’s origin and how they navigate in the Web animation system.

  12. Vegetation classification and distribution mapping report Mesa Verde National Park

    Science.gov (United States)

    Thomas, Kathryn A.; McTeague, Monica L.; Ogden, Lindsay; Floyd, M. Lisa; Schulz, Keith; Friesen, Beverly A.; Fancher, Tammy; Waltermire, Robert G.; Cully, Anne

    2009-01-01

    The classification and distribution mapping of the vegetation of Mesa Verde National Park (MEVE) and surrounding environment was achieved through a multi-agency effort between 2004 and 2007. The National Park Service’s Southern Colorado Plateau Network facilitated the team that conducted the work, which comprised the U.S. Geological Survey’s Southwest Biological Science Center, Fort Collins Research Center, and Rocky Mountain Geographic Science Center; Northern Arizona University; Prescott College; and NatureServe. The project team described 47 plant communities for MEVE, 34 of which were described from quantitative classification based on f eld-relevé data collected in 1993 and 2004. The team derived 13 additional plant communities from field observations during the photointerpretation phase of the project. The National Vegetation Classification Standard served as a framework for classifying these plant communities to the alliance and association level. Eleven of the 47 plant communities were classified as “park specials;” that is, plant communities with insufficient data to describe them as new alliances or associations. The project team also developed a spatial vegetation map database representing MEVE, with three different map-class schemas: base, group, and management map classes. The base map classes represent the fi nest level of spatial detail. Initial polygons were developed using Definiens Professional (at the time of our use, this software was called eCognition), assisted by interpretation of 1:12,000 true-color digital orthophoto quarter quadrangles (DOQQs). These polygons (base map classes) were labeled using manual photo interpretation of the DOQQs and 1:12,000 true-color aerial photography. Field visits verified interpretation concepts. The vegetation map database includes 46 base map classes, which consist of associations, alliances, and park specials classified with quantitative analysis, additional associations and park specials noted

  13. Human factors engineering control-room-design review/audit report: Palo Verde Nuclear Generating Station, Arizona Public Service Company

    International Nuclear Information System (INIS)

    Savage, J.W.; Lappa, D.A.

    1981-01-01

    A human factors engineering design review of the Palo Verde control room simulator was performed at the site on September 15 through September 17, 1981. Observed human factors design discrepancies were given priority ratings. This report summarizes the team's observations of the control room design and layout and of the control room operators' interface with the control room environment. A list of the human factors strengths observed in the Palo Verde control room simulator is given

  14. Chaînes opératoires and resource-exploitation strategies in chimpanzee (Pan troglodytes) nut cracking.

    Science.gov (United States)

    Carvalho, Susana; Cunha, Eugénia; Sousa, Cláudia; Matsuzawa, Tetsuro

    2008-07-01

    We apply archaeological methods to extend our knowledge of chimpanzee material culture. The chaîne opératoire conceptual framework, as introduced by ethnography, established technology as a phased process. Prehistoric archaeology adopted this concept to elucidate technological variability in tool-making procedures, based on knowledge of tool functions or subsistence patterns. We focused on the detection of operational sequences by wild chimpanzees (Pan troglodytes verus) when nut cracking with lithic implements at the sites of Bossou and Diecké, Guinea, West Africa. Thus, while it has recently been claimed that chimpanzees leave behind recognizable assemblages of stone hammers that can be morphologically distinguished from Oldowan hammers, this is the first study to focus specifically on the existence of operational sequences during the utilization of stone tools by wild chimpanzees. By combining primatological and archaeological methods and examining ecological areas inhabited by different chimpanzee groups, we sought technological variability and identified variables influencing regional diversity in tool typology and technology. We compared three case studies: (1) Bossou-direct recording of experimental nut-cracking sessions; (2) Bossou- direct and indirect monitoring of nut-cracking sites in the wild; (3) Diecké-indirect monitoring of nut-cracking sites in the wild. Results suggest that chimpanzees perform sequences of repeated tool transport and nut cracking. Data show discrimination of tool functions based on tool features. We identified the most technologically complex tool for nut cracking, which was composed of four stones. We found regional diversity in chimpanzee stone assemblages. Raw-material type and tool mobility constrain technological development in human and nonhuman primates. Spatial analysis of tool distribution indicates a pattern of resource-exploitation strategy, revealing affinities with Oldowan.

  15. The effect of CHA-doped Sr addition to the mechanical strength of metakaolin dental implant geopolymer composite

    Science.gov (United States)

    Sunendar, Bambang; Fathina, Afiya; Harmaji, Andrie; Mardhian, Deby Fajar; Asri, Lia; Widodo, Haris Budi

    2017-09-01

    The prospective material for implant plate required sufficient mechanical properties to maintain fracture fixation and resist physiological stress until bone healing process finished. Various problem implant plate based on metal and polymer materials when used as fixation for bone defect case induced developmental of bioceramic for implant plate materials. Materials that now has been attract a lot of attention is carbonate apatite and strontium as doping which known to have good biocompability along with biointegrity and mechanical charateristics. Other materials that have been known to have good mechanical properties are metakaolin and use of chitosan as coupling agent. Metakaolin and carbonate apatite can be produced by sol-gel methode which simpler, economical and energy-saving procedure furthermore use of chitosan which is widely found in the nature of Indonesia can be used to encourage the utilization of natural resources. The aim fo this paper is to investigated effect of CHA-doped Sr 5 (%) mol addition to the mechanical strength of metakaolin dental implant geoploymer composite. In this paper metakaolin is used as geopolymerization precursors. The test results have shown that addition of filler of apatite carbonate doped 5% mol strontium can be said to increase the value of mechnical properties but high concentration of calcium in the nanocomposite also can complicate the equilibrium of the geopolymerization process and induce alkali aggregate reactivity (AAR). The sample group of nanocomposite of metakaolin and carbonate apatite-doped 5% mol strontium (2: 1% wt) with 2% chitosan as a coupling agent based on geopolymerization for implant plate application has the best mechanical properties among all sample groups but does not qualify as an implant plate on cortical bone but can be used for the application of the implant plate on the trabecular bone specifically and potentially as a bone initiator.

  16. Value of Combining Left Atrial Diameter and Amino-terminal Pro-brain Natriuretic Peptide to the CHA2DS2-VASc Score for Predicting Stroke and Death in Patients with Sick Sinus Syndrome after Pacemaker Implantation.

    Science.gov (United States)

    Mo, Bin-Feng; Lu, Qiu-Fen; Lu, Shang-Biao; Xie, Yu-Quan; Feng, Xiang-Fei; Li, Yi-Gang

    2017-08-20

    The CHA2DS2-VASc score is used clinically for stroke risk stratification in patients with atrial fibrillation (AF). We sought to investigate whether the CHA2DS2-VASc score predicts stroke and death in Chinese patients with sick sinus syndrome (SSS) after pacemaker implantation and to evaluate whether the predictive power of the CHA2DS2-VASc score could be improved by combining it with left atrial diameter (LAD) and amino-terminal pro-brain natriuretic peptide (NT-proBNP). A total of 481 consecutive patients with SSS who underwent pacemaker implantation from January 2004 to December 2014 in our department were included. The CHA2DS2-VASc scores were retrospectively calculated according to the hospital medical records before pacemaker implantation. The outcome data (stroke and death) were collected by pacemaker follow-up visits and telephonic follow-up until December 31, 2015. During 2151 person-years of follow-up, 46 patients (9.6%) suffered stroke and 52 (10.8%) died. The CHA2DS2-VASc score showed a significant association with the development of stroke (hazard ratio [HR] 1.45, 95% confidence interval [CI] 1.20-1.75, Ppacemaker implantation. The addition of LAD and NT-proBNP to the CHA2DS2-VASc score improved its predictive power for stroke and death, respectively, in this patient cohort. Future prospective studies are warranted to validate the benefit of adding LAD and NT-proBNP to the CHA2DS2-VASc score for predicting stroke and death risk in non-AF populations.

  17. Ionizing radiation effect on teas of Camellia sinensis plant irradiated with different water activities; Efeito da radiacao ionizante em chas da planta Camellia sinensis irradiados com diferentes atividades de agua

    Energy Technology Data Exchange (ETDEWEB)

    Fanaro, Gustavo Bernardes

    2013-07-01

    Tea is the most consumed beverage in the world. Teas from Camellia sinensis plant have high levels of antioxidants, which mean that they may have several beneficial effects on health preservation. For centuries, mankind looks for ways to conserve better and for a longer time the food that they eat. The food irradiation process is a largely technique used worldwide, and is recommended by many health agencies and authorities of several countries. The radiation interacts with the material causing two kinds of effects, the direct and the indirect effect. In the direct effect the radiation interacts with the DNA molecule, breaking it, and then inactivates the cell. In the indirect effect, which represents 70% of the interaction, the radiation breaks the water molecule in a process denominated radiolysis, creating a number of free radicals that will interact with the cellular components, leading to the cell death. Therefore, the aim of this work is to study the effects of gamma radiation on two kinds of tea from Camellia sinensis plant irradiated with different water activities. The green tea and black tea samples had their Aw adjusted to three values (high Aw, medium Aw, and low Aw). The samples were irradiated in {sup 60}Co source at doses of 0, 1.0, 1.5, 2.0, 2.5, 5.0, 7.5, and 10.0 kGy. The analyses used were: microbiology by plate count, total phenolic compounds quantification, antioxidant activity by ORAC assay, and identification and quantification of main antioxidants in these beverages. It was noted that the greater the quantity of free water present in the medium, the lower was the dose to achieve microbiological control. The green tea showed to be a little more susceptible to irradiation by high Aw once there was more variation in the amount of flavonoids and phenolics than the black tea, decreasing the amount of these compounds in some doses, but increasing the amount in other ones. However in both teas, these changes can be considered insignificant, since

  18. Plan verde: un instrumento para la gestión y fomento de áreas verdes en el gran Santiago

    Directory of Open Access Journals (Sweden)

    Claudio Nilo Orellana

    2003-09-01

    Full Text Available La ciudad de Santiago, cuenta con una importante falencia de espacios verdes. La Organización Mundial de la Salud (OMS recomienda que las ciudades tengan 9 metros cuadrados por habitante. Por su parte, el Plan de Prevención y Descontaminación para la Región Metropolitana (PPDA se ha propuesto como meta lograr que el área Metropolitana logre un promedio de 6 metros cuadrados por habitante.

  19. Modernization of electric power systems of the Laguna Verde Nuclear Power Plant; Modernizacion de los sistemas electricos de potencia de la Central Nuclear de Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Gabaldon, M. A.; Gonzalez, J. J.; Prieto, I.

    2011-07-01

    The Power Increase Project of Laguna Verde Nuclear Plant has entailed the replacement, in one unique outage, of the main power electrical systems of the Plant (Isolated Phase Bars, Generator Circuit Breaker and Main Transformer) as well as the replacement of the Turbo-group. The simultaneous substitution of these entire system has never been done by any other Plant in the world, representing an engineering challenge that embraced the design of the new equipment up to the planning, coordination and management of the construction and commissioning works, which were successfully carried out by Iberdrola within the established outage period /47 days) for both units. (Author)

  20. Corredores verdes urbanos: estudo da viabilidade de conexão das áreas verdes de Vitória

    Directory of Open Access Journals (Sweden)

    Homero Marconi Penteado

    2007-12-01

    Full Text Available Grande parte dos profissionais de planejamento urbano tem buscado melhorar a qualidade de vida da população e a aplicação de princípios de sustentabilidade, que se refletem, na maioria dos casos, na busca de ampliação das áreas verdes, sejam na forma de parques, praças, arborização de vias ou mesmo incentivo aos jardins particulares. Esta pesquisa apresenta o resultado do estudo de viabilidade de criação de corredores verdes urbanos na cidade de Vitória, estabelecendo uma rede de conexões utilizando-se de sua malha viária, visando incrementar as condições ecológicas e paisagísticas urbanas e melhores condições de circulação de pedestres e ciclistas. Está alicerçada nos conceitos desenvolvidos pela ecologia da paisagem, baseada em fragmentos, corredores e matriz. A metodologia adotada foi aplicada em uma área teste, onde foram realizados levantamentos preliminares, mapeamento das áreas verdes, seleção de vias para implantação de corredores, avaliação dos possíveis corredores, inventário e análise das vias, diretrizes para estabelecimento dos corredores, ensaio projetual e criação de uma rede de corredores verdes. Dentre os principais resultados, verificou-se a possibilidade de criação de corredores com pequenas modificações nos perfis de vias que permitiriam a inserção de vegetação contínua, calçadas e ciclovias com consequências diretas (otimização das condições microclimáticas, melhoria na paisagem, atratividade para pequenos animais, incentivo ao percurso não motorizado, entre outros e indiretas (redução das partículas em suspensão, redução dos níveis de ruído e do consumo de combustíveis etc..

  1. Secuencia didáctica en química verde

    OpenAIRE

    Cortés Rodríguez, Adriana Janneth

    2017-01-01

    Esta propuesta presenta los resultados del diseño e implementación de una secuencia didáctica cuya finalidad es adaptar los principios de la Química Verde (QV) en el ámbito escolar, a través de actividades específicas que se enmarcan dentro del diseño del Protocolo Verde o Practica Amigable para el Medio Ambiente. La metodología de investigación – acción desarrollada permitió la reflexión de los estudiantes sobre los principios de la QV en relación con la identificación del cambio de color, e...

  2. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    DEFF Research Database (Denmark)

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente from...... Cretaceous age for limestones deposited on the seafloor and later uplifted. The Cape Verde Rise is indicated to have fully formed in the early Miocene around 22 Ma, accompanied by the initial alkaline volcanism. Considerable volcanism on Sal, Boa Vista, and Maio took place in the Miocene and Pliocene...

  3. Seismic qualification tests of fans of the NPP of Laguna Verde U-1 and U-2

    International Nuclear Information System (INIS)

    Jarvio C, G.; Garcia H, E. E.; Arguelles F, R.; Vela H, A.; Naranjo U, J. L.

    2013-10-01

    This work presents the results of the seismic qualification tests applied to the fans that will be installed in the control panels of the three divisions of the diesel generators of the nuclear power plant (NPP) of Laguna Verde, Unit-1 and Unit-2. This seismic qualification process of the fans was carried out using two specimens that were tested in the seismic table (vibrating) of the Engineering Institute of Universidad Nacional Autonoma de Mexico (UNAM), in accordance with the requirements of the standard IEEE 344-1975, to satisfy the established requirements of seismic qualification in the technical specifications and normative documents required by the nuclear standards, in order to demonstrate its application in the diesel generators Divisions I, II and III of the NPP. The seismic qualification tests were developed on specimens that were retired of the NPP of Laguna Verde recently with a service life of 7.75 years. (Author)

  4. Start up and commercial operation of Laguna Verde nuclear power plant. Unit 1

    International Nuclear Information System (INIS)

    Torres Ramirez, J.F.

    1991-01-01

    Prior to start up of Laguna Verde nuclear power plant preoperational tests and start tests were performed and they are described in its more eminent aspects. In relation to commercial operation of nuclear station a series of indicator were set to which allow the measurement of performance in unit 1, in areas of plant efficiency and personal safety. Antecedents. Laguna Verde station is located in Alto Lucero municipality in Veracruz state, 70 kilometers north-northeast from port of Veracruz and a 290 kilometers east-northeast from Mexico city. The station consist of two units manufactured by General Electric, with a nuclear system of vapor supply also called boiling water (BWR/5), and with a system turbine-generator manufactured by Mitsubishi. Each unit has a nominal power of 1931 MWt and a level design power of 675 Mwe and a net power of 654 Electric Megawatts

  5. Analysis of internal events for the Unit 1 of the Laguna Verde Nuclear Power Station. Appendixes

    International Nuclear Information System (INIS)

    Huerta B, A.; Lopez M, R.

    1995-01-01

    This volume contains the appendices for the accident sequences analysis for those internally initiated events for Laguna Verde Unit 1, Nuclear Power Plant. The appendix A presents the comments raised by the Sandia National Laboratories technical staff as a result of the review of the Internal Event Analysis for Laguna Verde Unit 1 Nuclear Power Plant. This review was performed during a joint Sandia/CNSNS multi-day meeting by the end 1992. Also included is a brief evaluation on the applicability of these comments to the present study. The appendix B presents the fault tree models printed for each of the systems included and.analyzed in the Internal Event Analysis for LVNPP. The appendice C presents the outputs of the TEMAC code, used for the cuantification of the dominant accident sequences as well as for the final core damage evaluation. (Author)

  6. Analysis of internal events for the Unit 1 of the Laguna Verde Nuclear Power Station. Appendixes

    International Nuclear Information System (INIS)

    Huerta B, A.; Lopez M, R.

    1995-01-01

    This volume contains the appendices for the accident sequences analysis for those internally initiated events for Laguna Verde Unit 1, Nuclear Power Plant. The appendix A presents the comments raised by the Sandia National Laboratories technical staff as a result of the review of the Internal Event Analysis for Laguna Verde Unit 1 Nuclear Power Plant. This review was performed during a joint Sandia/CNSNS multi-day meeting by the end 1992. Also included is a brief evaluation on the applicability of these comments to the present study. The appendix B presents the fault tree models printed for each of the systems included and analyzed in the Internal Event Analysis for LVNPP. The appendice C presents the outputs of the TEMAC code, used for the cuantification of the dominant accident sequences as well as for the final core damage evaluation. (Author)

  7. X-chromosome STR markers data in a Cabo Verde immigrant population of Lisboa.

    Science.gov (United States)

    Afonso Costa, Heloísa; Morais, Paulo; Vieira da Silva, Cláudia; Matos, Sara; Marques Santos, Rodolfo; Espinheira, Rosa; Costa Santos, Jorge; Amorim, António

    2014-01-01

    Population genetic data of 12 X chromosomal short tandem repeats markers (DXS10074, DXS10079, DXS10101, DXS10103, DXS10134, DXS10135, DXS10146, DXS10148, DXS7132, DXS7423, DXS8378 and HPRTB) were analysed in 54 females and 95 males of an immigrant population from Cabo Verde living in Lisboa. The obtained results for forensic statistical parameters such as observed heterozigosity, polymorphism information content, power of discrimination and mean exclusion chance, based on single allele frequencies, reveal that this multiplex system is highly informative and can represent an important tool for genetic identification purposes in the immigrant population of Cabo Verde. Since the studied short tandem repeats genetic markers are distributed on four linkage groups, that can provide independent genotype information, we studied those groups as haploytes. The forensic efficiency parameters for the linked groups were all higher than 0.97, with linkage group I being the most polymorphic and linkage group III the less informative.

  8. Importancia de los ensayos de compactibilidad, resistencia en verde y humedad en mezclas de moldeo

    Directory of Open Access Journals (Sweden)

    Alain Valdés-Crúz

    2000-03-01

    Full Text Available A partir de la teoría del agua rígida y de los trabajos desarrollados por Wenninger se alcanzó una concepción más clara sobre los mecanismos de aglutinación en verde de las mezclas de moldeo. Al mismo tiempo, se presta una particular atención a los ensayos de compactibilidad, resistencia a la compresión en verde y humedad, como índices más representativos de dicho proceso de aglutinación. Se demuestra la relación que existe entre estos ensayos y las consecuencias de los trabajos de Wenninger. Se hace particular énfasis en el ensayo de compactibilidad por considerarlo de aplicación limitada.

  9. Characterization of Mesa Verde Black-on-white ceramics from southwestern Colorado using NAA

    Energy Technology Data Exchange (ETDEWEB)

    Glowacki, D M; Neff, H; Glascock, M D [Missouri Univ., Columbia, MO (United States). Research Reactor Facility

    1995-10-01

    Sixty Mesa Verde variety Black-on-white bowls from Castle Rock Pueblo (5MT 1825) and Sand Canyon Pueblo (5MT765) in southwestern Colorado were chemically characterized using neutron activation analysis. Eleven clay sources local to the sites in the McElmo Drainage area were also analyzed. The results revealed two distinct compositional groups containing relative frequencies that imply local production. The occurrence of trade between the two sites was also identified. (author). 20 refs., 5 figs., 2 tabs.

  10. Risk-based inservice testing program modifications at Palo Verde nuclear generating station

    Energy Technology Data Exchange (ETDEWEB)

    Knauf, S.; Lindenlaub, B.; Linthicum, R.

    1996-12-01

    Arizona Public Service Company (APS) is investigating changes to the Palo Verde Inservice Testing (IST) Program that are intended to result in the reduction of the required test frequency for various valves in the American Society of Mechanical Engineers (ASME) Section XI IST program. The analytical techniques employed to select candidate valves and to demonstrate that these frequency reductions are acceptable are risk based. The results of the Palo Verde probabilistic risk assessment (PRA), updated in June 1994, and the risk significant determination performed as part of the implementation efforts for 10 CFR 50.65 (the maintenance rule) were used to select candidate valves for extended test intervals. Additional component level evaluations were conducted by an `expert panel.` The decision to pursue these changes was facilitated by the ASME Risk-Based Inservice Testing Research Task Force for which Palo Verde is participating as a pilot plant. The NRC`s increasing acceptance of cost beneficial licensing actions and risk-based submittals also provided incentive to seek these changes. Arizona Public Service is pursuing the risk-based IST program modification in order to reduce the unnecessary regulatory burden of the IST program through qualitative and quantitative analysis consistent with maintaining a high level of plant safety. The objectives of this project at Palo Verde are as follows: (1) Apply risk-based technologies to IST components to determine their risk significance (i.e., high or low). (2) Apply a combination of deterministic and risk-based methods to determine appropriate testing requirements for IST components including improvement of testing methods and frequency intervals for high-risk significant components. (3) Apply risk-based technologies to high-risk significant components identified by the {open_quotes}expert panel{close_quotes} and outside of the IST program to determine whether additional testing requirements are appropriate.

  11. Patterns of genetic diversity in three plant lineages endemic to the Cape Verde Islands.

    Science.gov (United States)

    Romeiras, Maria M; Monteiro, Filipa; Duarte, M Cristina; Schaefer, Hanno; Carine, Mark

    2015-05-15

    Conservation of plant diversity on islands relies on a good knowledge of the taxonomy, distribution and genetic diversity of species. In recent decades, a combination of morphology- and DNA-based approaches has become the standard for investigating island plant lineages and this has led, in some cases, to the discovery of previously overlooked diversity, including 'cryptic species'. The flora of the Cape Verde archipelago in the North Atlantic is currently thought to comprise ∼740 vascular plant species, 92 of them endemics. Despite the fact that it is considered relatively well known, there has been a 12 % increase in the number of endemics in the last two decades. Relatively few of the Cape Verde plant lineages have been included in genetic studies so far and little is known about the patterns of diversification in the archipelago. Here we present an updated list for the endemic Cape Verde flora and analyse diversity patterns for three endemic plant lineages (Cynanchum, Globularia and Umbilicus) based on one nuclear (ITS) and four plastid DNA regions. In all three lineages, we find genetic variation. In Cynanchum, we find two distinct haplotypes with no clear geographical pattern, possibly reflecting different ploidy levels. In Globularia and Umbilicus, differentiation is evident between populations from northern and southern islands. Isolation and drift resulting from the small and fragmented distributions, coupled with the significant distances separating the northern and southern islands, could explain this pattern. Overall, our study suggests that the diversity in the endemic vascular flora of Cape Verde is higher than previously thought and further work is necessary to characterize the flora. Published by Oxford University Press on behalf of the Annals of Botany Company.

  12. Risk-based inservice testing program modifications at Palo Verde nuclear generating station

    International Nuclear Information System (INIS)

    Knauf, S.; Lindenlaub, B.; Linthicum, R.

    1996-01-01

    Arizona Public Service Company (APS) is investigating changes to the Palo Verde Inservice Testing (IST) Program that are intended to result in the reduction of the required test frequency for various valves in the American Society of Mechanical Engineers (ASME) Section XI IST program. The analytical techniques employed to select candidate valves and to demonstrate that these frequency reductions are acceptable are risk based. The results of the Palo Verde probabilistic risk assessment (PRA), updated in June 1994, and the risk significant determination performed as part of the implementation efforts for 10 CFR 50.65 (the maintenance rule) were used to select candidate valves for extended test intervals. Additional component level evaluations were conducted by an 'expert panel.' The decision to pursue these changes was facilitated by the ASME Risk-Based Inservice Testing Research Task Force for which Palo Verde is participating as a pilot plant. The NRC's increasing acceptance of cost beneficial licensing actions and risk-based submittals also provided incentive to seek these changes. Arizona Public Service is pursuing the risk-based IST program modification in order to reduce the unnecessary regulatory burden of the IST program through qualitative and quantitative analysis consistent with maintaining a high level of plant safety. The objectives of this project at Palo Verde are as follows: (1) Apply risk-based technologies to IST components to determine their risk significance (i.e., high or low). (2) Apply a combination of deterministic and risk-based methods to determine appropriate testing requirements for IST components including improvement of testing methods and frequency intervals for high-risk significant components. (3) Apply risk-based technologies to high-risk significant components identified by the open-quotes expert panelclose quotes and outside of the IST program to determine whether additional testing requirements are appropriate

  13. Fuel failure at the Laguna Verde unit 1- during Cycle 4

    International Nuclear Information System (INIS)

    Espinosa Vega, Juan Manuel

    1996-01-01

    The present work describes the event occurred at the Laguna Verde nuclear power plants Unit 1 during its fourth cycle ensembles; the first failure, by means of a test of power suppression, and the second one, during the sipping accomplished in the four refuelling of the unit. Also it describes the re-evaluation of the event accomplished by the licenser, the manufacturer and the Mexican agency

  14. Possible effects of groundwater pumping on surface water in the Verde Valley, Arizona

    Science.gov (United States)

    Leake, Stanley A.; Haney, Jeanmarie

    2010-01-01

    The U.S. Geological Survey (USGS), in cooperation with The Nature Conservancy, has applied a groundwater model to simulate effects of groundwater pumping and artificial recharge on surface water in the Verde Valley sub-basin of Arizona. Results are in two sets of maps that show effects of locations of pumping or recharge on streamflow. These maps will help managers make decisions that will meet water needs and minimize environmental impacts.

  15. Preliminary synthesis and assessment of environmental flows in the middle Verde River watershed, Arizona

    Science.gov (United States)

    Paretti, Nicholas; Brasher, Anne M. D.; Pearlstein, Susanna L.; Skow, Dena M.; Gungle, Bruce W.; Garner, Bradley D.

    2018-05-15

    A 3-year study was undertaken to evaluate the suitability of the available modeling tools for characterizing environmental flows in the middle Verde River watershed of central Arizona, describe riparian vegetation throughout the watershed, and estimate sediment mobilization in the river. Existing data on fish and macroinvertebrates were analyzed in relation to basin characteristics, flow regimes, and microhabitat, and a pilot study was conducted that sampled fish and macroinvertebrates and the microhabitats in which they were found. The sampling for the pilot study took place at five different locations in the middle Verde River watershed. This report presents the results of this 3-year study. The Northern Arizona Groundwater Flow Model (NARGFM) was found to be capable of predicting long-term changes caused by alteration of regional recharge (such as may result from climate variability) and groundwater pumping in gaining, losing, and dry reaches of the major streams in the middle Verde River watershed. Over the period 1910 to 2006, the model simulated an increase in dry reaches, a small increase in reaches losing discharge to the groundwater aquifer, and a concurrent decrease in reaches gaining discharge from groundwater. Although evaluations of the suitability of using the NARGFM and Basin Characteristic Model to characterize various streamflow intervals showed that smallerscale basin monthly runoff could be estimated adequately at locations of interest, monthly stream-flow estimates were found unsatisfactory for determining environmental flows.Orthoimagery and Moderate Resolution Imaging Spectroradiometer data were used to quantify stream and riparian vegetation properties related to biotic habitat. The relative abundance of riparian vegetation varied along the main channel of the Verde River. As would be expected, more upland plant species and fewer lowland species were found in the upper-middle section compared to the lower-middle section, and vice

  16. Insecticide susceptibility of Aedes aegypti populations from Senegal and Cape Verde Archipelago.

    Science.gov (United States)

    Dia, Ibrahima; Diagne, Cheikh Tidiane; Ba, Yamar; Diallo, Diawo; Konate, Lassana; Diallo, Mawlouth

    2012-10-22

    Two concomitant dengue 3 (DEN-3) epidemics occurred in Cape Verde Archipelago and Senegal between September and October 2009. Aedes aegypti was identified as the vector of these epidemics as several DEN-3 virus strains were isolated from this species in both countries. The susceptibility to pyrethroids, organochlorine, organophosphates and carbamate was investigated in two field strains of Aedes aegypti from both countries using WHO diagnostic bioassay kits in order to monitor their the current status of insecticide susceptibility. The two tested strains were highly resistant to DDT. The Cape Verde strain was found to be susceptible to all others tested insecticides except for propoxur 0.1%, which needs further investigation. The Dakar strain was susceptible to fenitrothion 1% and permethrin 0.75%, but displayed reduced susceptibility to deltamethrin, lambda-cyhalothrin and propoxur. As base-line results, our observations stress a careful management of insecticide use for the control of Ae. aegypti. Indeed, they indicate that DDT is no longer efficient for the control of Ae. aegypti populations in Cape Verde and Dakar and further suggest a thorough follow-up of propoxur susceptibility status in both sites and that of deltamethrin and lambda-cyhalothrin in Ae. aegypti populations in Dakar. Thus, regular monitoring of susceptibility is greatly needed as well as the knowing if this observed resistance/susceptibility is focal or not and for observed resistance, the use of biochemical methods is needed with detailed comparison of resistance levels over a large geographic area. Aedes aegypti, Insecticides, Susceptibility, Cape Verde, Senegal.

  17. The Impacts of Urban Politics on Female Street Vendors in Praia, Cape Verde

    OpenAIRE

    Pólvora, Jacqueline Britto

    2015-01-01

    Departing from transformations that are taking place on the space of the Plateau in Praia, Cape Verde, this paper discusses how these transformations are affecting the daily and working lives of the female street vendors in the city. It is an ethnographic study conducted with the ladies, also taking into account official data available from the institutional offices in Praia. It focuses on the tensions and disputes around the space, given significant changes that have been promoted by the ...

  18. Paso del Aguilo : bol hémisphérique type Rio Verde Poli

    OpenAIRE

    Michelet , Dominique

    1981-01-01

    Zone IV, site n°2. Las Colaciones, Paso del Aguila, municipio Armadillo, San Luis Potosi.Bol "hémisphérique" profond du type Rio Verde poli. Engobe brun clair. 3 pieds en bouton à peine esquissés. Hauteur totale 7 centimètres. Diamètre de l'ouverture 11,5 centimètres. Collection particulière. Paso del Aguila.

  19. Synergisms in Alpha-glucosidase Inhibition and Antioxidant Activity of Camellia sinensis L. Kuntze and Eugenia uniflora L. Ethanolic Extracts

    Science.gov (United States)

    Vinholes, Juliana; Vizzotto, Márcia

    2017-01-01

    Background: Camellia sinensis, the most consumed and popular beverages worldwide, and Eugenia uniflora, a Brazilian native species, have been already confirmed to have beneficial effects in the treatment of diabetes mellitus. However, their potential acting together against an enzyme linked to this pathology has never been exploited. Objective: The aim of this study was to evaluate the inhibitory properties of individual and combined ethanolic extracts of the leaves of C. sinensis and E. uniflora over alpha-glucosidase, a key digestive enzyme used on the Type 2 diabetes mellitus (T2DM) control. In addition, their inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl radical (DPPH•) and peroxyl radicals was also assayed. Materials and Methods: Enzyme inhibition and antioxidant potential were assessed based on in vitro assays. Total phenolic compounds, carotenoids, and chlorophylls A and B were achieved using spectrophotometric methods. Results: E. uniflora was almost 40 times more active on alpha-glucosidase than C. sinensis and combined extracts showed a significant synergistic effect with an obtained IC50 value almost 5 times lower than the theoretical value. C. sinensis extract was twice more active than E. uniflora concerning DPPH•, in contrast, E. uniflora was almost 10 times more effective than C. sinensis on inhibition of peroxyl radicals with a significant synergistic effect for combined extracts. The extracts activities may be related with their phytochemicals, mainly phenolic compounds, and chlorophylls. Conclusion: Combined C. sinensis and E. uniflora ethanolic extracts showed synergistic effect against alpha-glucosidase and lipid peroxidation. These herbal combinations can be used to control postprandial hyperglycemia and can also provide antioxidant defenses to patients with T2DM. SUMMARY Alfa-glucosidase and antioxidant Interaction between Camellia sinensis L. Kuntze and Eugenia uniflora L. ethanolic extracts was investigated.Extracts showed

  20. Identification of drought-responsive miRNAs and physiological characterization of tea plant (Camellia sinensis L.) under drought stress.

    Science.gov (United States)

    Guo, Yuqiong; Zhao, Shanshan; Zhu, Chen; Chang, Xiaojun; Yue, Chuan; Wang, Zhong; Lin, Yuling; Lai, Zhongxiong

    2017-11-21

    Drought stress is one of the major natural challenges in the main tea-producing regions of China. The tea plant (Camellia sinensis) is a traditional beverage plant whose growth status directly affects tea quality. Recent studies have revealed that microRNAs (miRNAs) play key functions in plant growth and development. Although some miRNAs have been identified in C. sinensis, little is known about their roles in the drought stress response of tea plants. Physiological characterization of Camellia sinensis 'Tieguanyin' under drought stress showed that the malondialdehyde concentration and electrical conductivity of leaves of drought-stressed plants increased when the chlorophyll concentration decreased under severe drought stress. We sequenced four small-RNA (sRNA) libraries constructed from leaves of plants subjected to four different treatments, normal water supply (CK); mild drought stress (T1); moderate drought stress (T2) and severe drought stress (T3). A total of 299 known mature miRNA sequences and 46 novel miRNAs were identified. Gene Ontology enrichment analysis revealed that most of the differentially expressed-miRNA target genes were related to regulation of transcription. Kyoto Encyclopedia of Genes and Genomes analysis revealed that the most highly enriched pathways under drought stress were D-alanine metabolism, sulfur metabolism, and mineral absorption pathways. Real-time quantitative PCR (qPCR) was used to validate the expression patterns of 21 miRNAs (2 up-regulated and 19 down-regulated under drought stress). The observed co-regulation of the miR166 family and their targets ATHB-14-like and ATHB-15-like indicate the presence of negative feedback regulation in miRNA pathways. Analyses of drought-responsive miRNAs in tea plants showed that most of differentially expressed-miRNA target genes were related to regulation of transcription. The results of study revealed that the expressions of phase-specific miRNAs vary with morphological, physiological, and

  1. Synergisms in Alpha-glucosidase Inhibition and Antioxidant Activity of Camellia sinensis L. Kuntze and Eugenia uniflora L. Ethanolic Extracts.

    Science.gov (United States)

    Vinholes, Juliana; Vizzotto, Márcia

    2017-01-01

    Camellia sinensis , the most consumed and popular beverages worldwide, and Eugenia uniflora , a Brazilian native species, have been already confirmed to have beneficial effects in the treatment of diabetes mellitus. However, their potential acting together against an enzyme linked to this pathology has never been exploited. The aim of this study was to evaluate the inhibitory properties of individual and combined ethanolic extracts of the leaves of C. sinensis and E. uniflora over alpha-glucosidase, a key digestive enzyme used on the Type 2 diabetes mellitus (T2DM) control. In addition, their inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl radical (DPPH • ) and peroxyl radicals was also assayed. Enzyme inhibition and antioxidant potential were assessed based on in vitro assays. Total phenolic compounds, carotenoids, and chlorophylls A and B were achieved using spectrophotometric methods. E. uniflora was almost 40 times more active on alpha-glucosidase than C. sinensis and combined extracts showed a significant synergistic effect with an obtained IC 50 value almost 5 times lower than the theoretical value. C. sinensis extract was twice more active than E. uniflora concerning DPPH • , in contrast, E. uniflora was almost 10 times more effective than C. sinensis on inhibition of peroxyl radicals with a significant synergistic effect for combined extracts. The extracts activities may be related with their phytochemicals, mainly phenolic compounds, and chlorophylls. Combined C. sinensis and E. uniflora ethanolic extracts showed synergistic effect against alpha-glucosidase and lipid peroxidation. These herbal combinations can be used to control postprandial hyperglycemia and can also provide antioxidant defenses to patients with T2DM. Alfa-glucosidase and antioxidant Interaction between Camellia sinensis L. Kuntze and Eugenia uniflora L. ethanolic extracts was investigated.Extracts showed synergistic effect over alpha-glucosidase and peroxyl radicals

  2. Effect of green tea (Camellia sinensis) extract and pre-freezing equilibration time on the post-thawing quality of ram semen cryopreserved in a soybean lecithin-based extender.

    Science.gov (United States)

    Mehdipour, Mahdieh; Daghigh Kia, Hossein; Najafi, Abouzar; Vaseghi Dodaran, Hossein; García-Álvarez, Olga

    2016-12-01

    The aim of this study was to determine the effect of Camellia sinensis extract as antioxidant supplement and pre-freezing equilibration times in a soybean lecithin extender for freezing ram semen. In this study, a total of 20 ejaculates were collected from four Ghezel rams and diluted with extenders (1.5% soybean lecithin, 7% glycerol) containing no supplements (control) and Camellia sinensis extract (5, 10, and 15 mg/L) and cryopreserved, immediately after thermal equilibrium was reached at 5 °C (0 h), or 4 h after equilibration. Sperm motility characteristics, membrane integrity, abnormal morphology, mitochondria activity, apoptotic status, MDA and antioxidant activities (GPx, SOD and total antioxidant capacity (TAC)) were evaluated following freeze-thawing. Camellia sinensis extract at level 10 mg/L led to the highest total and progressive motilities percentages, in comparison to other treatments (P extract at level of 5 and 10 mg/L led to higher plasma membrane integrity, mitochondria activity and Total antioxidant capacity (TAC) in comparison to the level of 15 mg/L and control group (P extract at 10 mg/L level produced the highest percentage of live spermatozoa and the lowest apoptotic spermatozoa in comparison to all treatments (P concentration, 10 mg/L, compared to all treatments (P  0.05) were observed between equilibration times (0 h vs. 4 h) for sperm samples incubated with or without different concentrations of Camellia sinensis extract. In conclusion, addition of Camellia sinensis extract at level of 10 mg/L can improve post-thawing quality of ram semen cryopreserved in a soybean lecithin extender. However, further research is needed to standardize the process of Camellia sinensis extraction and specially for identifying which compounds are responsible of its beneficial effect on ram sperm cryopreservation. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Proposal for implementation of alternative source term in the nuclear power plant of Laguna Verde

    International Nuclear Information System (INIS)

    Bazan L, A.; Lopez L, M.; Vargas A, A.; Cardenas J, J. B.

    2009-10-01

    In 2010 the nuclear power plant of Laguna Verde will implement the extended power upbeat in both units of the plant. Agree with methodology of NEDC-33004P-A, (constant pressure power up rate), and the source term of core, for accidents evaluations, were increased in proportion to the ratio of power level. This means that for the case of a design basis accident of loss of coolant an increase of power of 15% originated an increase of 15% in dose to main control room. Using the method of NEDC-33004P-A to extended power upbeat conditions was determined that the dose value to main control room is very near to regulatory limit established by SRP 6.4. By the above and in order to recover the margin, the nuclear power plant of Laguna Verde will calculate an alternative source term following the criteria established in RG 1.183 (alternative radiological source term for evaluating DBA at nuclear power reactor). This approach also have a more realistic dose value using the criterion of 10-CFR-50.67, in addition is predicted to get the benefit of additional operational flexibilities. This paper present the proposal of implementing the alternative source term in Laguna Verde. (Author)

  4. O chá verde e suas ações como quimioprotetor

    Directory of Open Access Journals (Sweden)

    Wanderlei Schmitz

    2005-12-01

    Full Text Available O chá preto é responsável por 75% do chá consumido no mundo e o chá verde, por apenas 22%. O chá que era consumido como medicamento, passou a ser do gosto popular devido as suas característica organolépticas. Seus componentes flavonóides e catequinas apresentam uma série de atividades biológicas, antioxidante, quimioprotetora, antiinflamatória e anticarcinogênica. Vários estudos vêm sendo desenvolvidos por pesquisadores em varias regiões do mundo para comprovar estas atividades terapêuticas, objetivando compreender os mecanismos de ação do chá verde. Diante do acima citado, esta revisão tem por finalidade apresentar as varias linhas de pesquisa em andamento e os resultados já obtidos sobre o efeito quimioprotetor/antioxidante do chá verde.

  5. Marketing verde e práticas socioambientais nas indústrias do Paraná

    Directory of Open Access Journals (Sweden)

    Valéria Neder Lopes

    2014-03-01

    Full Text Available A preocupação das empresas com o meio ambiente e com todas as questões sociais envolvidas em seu processo tem se tornado uma constante nos últimos tempos. Devido a isso, estão surgindo novas formas de administrar os recursos disponíveis. Nesse contexto, enquadra-se o marketing verde que deve estar pautado em práticas ambientalmente corretas, com o intuito de gerar produtos e serviços mais sustentáveis, fortalecendo a imagem das empresas e diferenciando suas marcas no mercado. O intuito neste trabalho foi verificar se as grandes indústrias do Paraná estão se utilizando das práticas de marketing verde e se mantêm projetos de gestão socioambiental. Para atender a tais objetivos, elaborou-se uma pesquisa descritiva e quantitativa com 48 grandes empresas cadastradas na Federação das Indústrias do Paraná. Os resultados obtidos indicam que a maior parte das empresas possui departamento de marketing formalizado, mantém sistemas de gestão ambiental e utiliza moderadamente práticas de marketing verde.

  6. Confort térmico en espacios verdes urbanos de ambientes áridos.

    Directory of Open Access Journals (Sweden)

    Alejandra Kurbán

    2017-06-01

    Full Text Available En la planificación bioclimática de las ciudades y particularmente las ubicadas en  ambientes áridos, los espacios verdes representan un potencial  higrotérmico desaprovechado como mitigadores del clima urbano. El trabajo cuantifica el confort térmico de espacios verdes urbanos (EVU de una ciudad del centro-oeste de Argentina localizada en la Diagonal Árida Sudamericana, a partir del Índice UTCI.  Este índice se calcula a partir de mediciones climáticas en 19 EVU, realizadas en el verano del año 2014. El valor de dicho índice en cada EVU se referencia con el calculado para su entorno urbano. El porcentaje de diferencia entre ellos permite agrupar el desempeño bioclimático de los EVU en cinco categorías en función de su divergencia con las condiciones climáticas generales de la ciudad. Los resultados permiten individualizar los parámetros arbóreos mínimos que deben poseer los EVU, como objetivo de una planificación bioclimática del verde urbano en ciudades de ambientes áridos.

  7. Improving Access to Pediatric Cardiology in Cape Verde via a Collaborative International Telemedicine Service.

    Science.gov (United States)

    Lapão, Luís Velez; Correia, Artur

    2015-01-01

    This paper addresses the role of international telemedicine services in supporting the evacuation procedures from Cape Verde to Portugal, enabling better quality and cost reductions in the management of the global health system. The Cape Verde, as other African countries, health system lacks many medical specialists, like pediatric cardiologists, neurosurgery, etc. In this study, tele-cardiology shows good results as diagnostic support to the evacuation decision. Telemedicine services show benefits while monitoring patients in post-evacuation, helping to address the lack of responsive care in some specialties whose actual use will help save resources both in provision and in management of the evacuation procedures. Additionally, with tele-cardiology collaborative service many evacuations can be avoided whereas many cases will be treated and followed locally in Cape Verde with remote technical support from Portugal. This international telemedicine service enabled more efficient evacuations, by reducing expenses in travel and housing, and therefore contributed to the health system's improvement. This study provides some evidence of how important telemedicine really is to cope with both the geography and the shortage of physicians.

  8. Impact of Sahara dust transport on Cape Verde atmospheric element particles.

    Science.gov (United States)

    Almeida-Silva, M; Almeida, S M; Freitas, M C; Pio, C A; Nunes, T; Cardoso, J

    2013-01-01

    The objectives of this study were to (1) conduct an elemental characterization of airborne particles sampled in Cape Verde and (2) assess the influence of Sahara desert on local suspended particles. Particulate matter (PM(10)) was collected in Praia city (14°94'N; 23°49'W) with a low-volume sampler in order to characterize its chemical composition by k0-INAA. The filter samples were first weighed and subsequently irradiated at the Portuguese Research Reactor. Results showed that PM(10) concentrations in Cape Verde markedly exceeded the health-based air quality standards defined by the European Union (EU), World Health Organization (WHO), and U.S. Environmental Protection Agency (EPA), in part due to the influence of Sahara dust transport. The PM(10) composition was characterized essentially by high concentrations of elements originating from the soil (K, Sm, Co, Fe, Sc, Rb, Cr, Ce, and Ba) and sea (Na), and low concentrations of anthropogenic elements (As, Zn, and Sb). In addition, the high concentrations of PM measured in Cape Verde suggest that health of the population may be less affected compared with other sites where PM(10) concentrations are lower but more enriched with toxic elements.

  9. Assessment of vibration anomalies of main steam lines at Palo Verde-3

    International Nuclear Information System (INIS)

    Amr, A.; Landstrom, C.; Maxwell, H.; Miller, J.S.; Lynch, J.J.

    1996-01-01

    Historically, flow induced vibration in piping systems that transport liquid has presented problems for plant designers. When evaluating a vibration problem, it is always important to determine the forcing frequencies from different phenomena and the natural frequencies of the system as an integral part of establishing the root cause of the problem. Since in most cases of large vibration and noise levels, the natural frequency of the system and the frequency of the flow induced vibration are very close, determining the natural frequency of the system is important. Palo Verde Unit-3 exhibited a vibration problem where identification of the root cause was difficult. A Palo Verde team was created which consisted of engineers from different on-site departments and support from consultants. The process used to determine the root cause for the vibration/noise problem on Main Steam Supply System (MSSS) steam line 2 at Palo Verde Unit 3 is discussed in this paper. Since the root cause was not readily apparent, a finite element model was constructed to determine the natural frequency of the piping system. The finite element model consisted of a portion of the main steam lines, including a sample line which traverses the main steam line

  10. BENEFÍCIOS DA BIOMASSA DE BANANA VERDE Á SAÚDE HUMANA

    Directory of Open Access Journals (Sweden)

    Vânia Thais Silva Gomes

    2017-03-01

    Full Text Available Este estudo tem por objetivo contextualizar os benefícios da biomassa de banana verde na saúde humana. A pergunta norteadora para a construção desta revisão integrativa foi: qual os benefícios da biomassa de banana verde para a saúde humana? Para a seleção dos estudos, utilizou-se as seguintes bases de dados eletrônicas: SCIELO (Scientific Eletronic Library Online, IBECS (Indice Bibliográfico Español de Ciencias de la Salud, LILACS (Literatura LatinoAmericana e do Caribe em Ciências da Saúde e MEDLINE (Medical Literature Analysis and Retrieval System Online. Concluiu-se que a biomassa da banana verde apresenta uma boa quantidade de nutrientes, vitaminas, fibras, o preparo é rápido e fácil, e o custo é acessível. É considerado um alimento funcional, pois apresenta prebióticos, amido resistente em sua composição, portanto considerada uma ótima fonte de nutrientes.

  11. Psychosocial concomitants of loneliness among students of Cape Verde and Portugal.

    Science.gov (United States)

    Neto, F; Barros, J

    2000-09-01

    This research is an examination of the relationship between loneliness and a number of psychosocial variables (e.g., affective state, cultural issues, gender, age) among adolescents and young adults from Cape Verde and Portugal. Two studies are presented. The participants in the first study were 285 adolescents from Cape Verde and 202 from Portugal, and in the second study there were 134 college students from Cape Verde and 112 from Portugal. The following instruments were administered to all the participants in both studies: The Revised UCLA Loneliness Scale (D. Russell, L. Peplau, & C. Cutrona, 1980), the Neuroticism Scale (J. Barros, 1999), the Optimism Scale (J. Barros, 1998), the Social Anxiety subscale (A. Fenigstein, M. Scheier, & A. Buss, 1975), and the Satisfaction With Life Scale (E. Diener, R. Emmons, R. Larsen, & S. Griffin, 1985). No ethnic or gender differences were found for loneliness between the two groups. For both groups, the most prominent predictors of loneliness were neuroticism and dissatisfaction with life. However, as expected, the adolescent group recorded higher scores for loneliness than did the college students.

  12. Spitzer IRS Spectroscopy of the 10 Myr-Old EF Cha Debris Disk: Evidence for Phyllosilicate-Rich Dust in the Terrestrial Zone

    Science.gov (United States)

    Currie, Thayne; Lisse, Carey M.; Sicillia-Aguilar, Aurora; Rieke, George H.; Su, Kate Y. L.

    2011-01-01

    We describe Spitzer IRS spectroscopic observations of the approx. 10 Myr-old star, EF Chao Compositional modeling of the spectra from 5 micron to 35 micron confirms that it is surrounded by a luminous debris disk with L(sub D)/L(sub *) approx. 10(exp -3), containing dust with temperatures between 225 K and 430 K characteristic of the terrestrial zone. The EF Cha spectrum shows evidence for many solid-state features, unlike most cold, low-luminosity debris disks but like some other 10-20 Myr-old luminous, warm debris disks (e.g. HD 113766A). The EF Cha debris disk is unusually rich in a species or combination of species whose emissivities resemble that of finely-powdered, laboratory-measured phyllosilicate species (talc, saponite, and smectite), which are likely produced by aqueous alteration of primordial anhydrous rocky materials. The dust and, by inference, the parent bodies of the debris also contain abundant amorphous silicates and metal sulfides, and possibly water ice. The dust's total olivine to pyroxene ratio of approx. 2 also provides evidence of aqueous alteration. The large mass volume of grains with sizes comparable to or below the radiation blow-out limit implies that planetesimals may be colliding at a rate high enough to yield the emitting dust but not so high as to devolatize the planetesimals via impact processing. Because phyllosilicates are produced by the interactions between anhydrous rock and warm, reactive water, EF Cha's disk is a likely signpost for water delivery to the terrestrial zone of a young planetary system.

  13. Recurrent Stroke: The Value of the CHA2DS2VASc Score and the Essen Stroke Risk Score in a Nationwide Stroke Cohort.

    Science.gov (United States)

    Andersen, Søren Due; Gorst-Rasmussen, Anders; Lip, Gregory Y H; Bach, Flemming W; Larsen, Torben Bjerregaard

    2015-09-01

    The CHA2DS2VASc score and the Essen Stroke Risk Score are respectively used for risk stratification in patients with atrial fibrillation and in patients with cerebrovascular incidents. We aimed to test the ability of the 2 scores to predict stroke recurrence, death, and cardiovascular events (stroke, transient ischemic attack, myocardial infarction, or arterial thromboembolism) in a nationwide Danish cohort study, among patients with incident ischemic stroke and no atrial fibrillation. We conducted a registry-based study in patients with incident ischemic stroke and no atrial fibrillation. Patients were stratified according to the CHA2DS2VASc score and the Essen Stroke Risk Score and were followed up until stroke recurrence or death. We estimated stratified incidence rates and hazard ratios and calculated the cumulative risks. 42 182 patients with incident ischemic stroke with median age 70.1 years were included. The overall 1-year incidence rates of recurrent stroke, death, and cardiovascular events were 3.6%, 10.5%, and 6.7%, respectively. The incidence rates, the hazard ratios, and the cumulative risk of all outcomes increased with increasing risk scores. C-statistics for both risk scores were around 0.55 for 1-year stroke recurrence and cardiovascular events and correspondingly for death around 0.67 for both scores. In this cohort of non-atrial fibrillation patients with incident ischemic stroke, increasing CHA2DS2VASc score and Essen Stroke Risk Score was associated with increasing risk of recurrent stroke, death, and cardiovascular events. Their discriminatory performance was modest and further refinements are required for clinical application. © 2015 American Heart Association, Inc.

  14. EL IMAGINARIO "VERDE" Y EL VERDE URBANO COMO INSTRUMENTO DE CONSUMO INMOBILIARIO: CONFIGURANDO LAS CONDICIONES AMBIENTALES DEL ÁREA METROPOLITANA DE SANTIAGO

    Directory of Open Access Journals (Sweden)

    Felipe Irarrázaval Irarrázaval

    2012-01-01

    Full Text Available La mercantilización e instrumentalización de diversos elementos y procesos naturales ha condicionado perfectas plataformas para la acumulación de riquezas. Esto ha sido posible en la medida que existen las condiciones políticas, sociales y económicas para que suceda. Además, en el caso de las condiciones ambientales urbanas, se suma un "imaginario verde" en un amplio espectro de la población, la cual presenta un gran interés por vivir en espacios dotados de naturaleza. Estas condiciones han determinado que en las ciudades se desarrolle una desigual distribución de las condiciones ambientales, dado que cuando la gestión urbana queda en manos del sector privado, sólo las elites con poder adquisitivo pueden acceder a áreas verdes y al arbolado urbano. La presente investigación busca reconocer a la naturaleza urbana como un "instrumento de consumo" inmobiliario, así como sus implicancias en la distribución de las condiciones ambientales en Santiago de Chile. Para esto se reconoce el espacio urbano en ciudades capitalistas como un eslabón dentro de las plataformas de acumulación de capital. A su vez, se integra la perspectiva de los imaginarios ofertados/empleados por el sector inmobiliario como un tema central para concretar la plataforma de acumulación.

  15. Simulation of the electric systems of the Laguna Verde nuclear power station; Simulacion de los sistemas electricos de la Central Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Lozano, Saul; Ruiz Ponce, Gerardo E [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1992-03-01

    In this article, the electric system models of the Laguna Verde Nuclear Power Station (CNLV) simulator, are presented. These models permit the functioning simulation, in the different operation modes of the main generator (Ruiz and Rodriguez 1991a), of the auxiliaries system and of the substation (Ruiz and Rodriguez 1991b), and of the emergency diesel generators system (Ruiz and Rodriguez 1991c). The general characteristics of such systems, considered as the basis to obtain the representative models, which were developed as modules in an independent way to be integrated in the simulator, are also described. [Espanol] En este articulo, se presenta los modelos de los sistemas electricos del simulador de la Central Laguna Verde (CLV). Estos modelos permiten simular el funcionamiento, en los diferentes modos de operacion del generador principal (Ruiz y Rodriguez, 1991a), del sistema de auxiliares y de la subestacion (Ruiz y Rodriguez, 1991b) y del sistema de generadores diesel de emergencia (Ruiz y Rodriguez, 1991c). Asimismo, se describen las caracteristicas generales de tales sistemas, consideradas como la base para obtener los modelos representativos, los cuales fueron desarrollados como modulos en forma independiente para integrarse al simulador.

  16. The continuous improvement system of nuclear power plant of Laguna Verde; El sistema de mejora continua de la central nucleoelectrica Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Rivera C, A. [Comision Federal de Electricidad, Central Nucleoelectrica Laguna Verde, Km. 42.5 Cardel-Nautla, Veracruz (Mexico)], e-mail: arr99999@cfe.gob.mx

    2009-10-15

    This paper describes the continuous improvement system of nuclear power plant of Laguna Verde and the achievements in implementing the same and additionally two study cases are presents. In February 2009 is noteworthy because the World Association of Nuclear Operators we identified as a learning organization, qualification which shows that the continuous improvement system has matured, and this system will expose as I get to learn to capitalize on our own experiences and external experiences diffused by the nuclear industry. In 2007 the management of nuclear power plants integrates its improvement systems and calls it continuous improvement system and is presented in the same extensive report that won the National Quality Award. This system is made up of 5 subsystems operating individually and are also related 1) human performance; 2) referential comparison or benchmarking; 3) self-assessment; 4) corrective action and 5) external operating experience. Five subsystems that plan, generate, capture, manage, communicate and protect the knowledge generated during the processes execution of nuclear power plant of Laguna Verde, as well as from external sources. The target set in 2007 was to increase the intellectual capital to always give response to meeting the security requirements, but creating a higher value to quality, customer, environment protection and society. In brief each of them, highlighting the objective, expectations management, implementation and some benefits. At the end they will describe two study cases selected to illustrate these cases as the organization learns by their continuous improvement system. (Author)

  17. Simulation of land use evolution by discrete events method: Application to “la chaîne des puys” from XV to XVIII Century

    OpenAIRE

    Y. Michelin; C. Poix

    1998-01-01

    By using a discrete event method, simulation of land use evolution has been applied to a landscape model of “la ChaÎne des Puys” (French Massif Central) during along period (XV–XVIII centuries). The indications concerning the evolution of land use are in conformity with the observation of actual situations but the dynamic changes are faster than in actual facts. In spite of limitations due to necessary simplifications, it is now established that the discrete event method is efficient to simu...

  18. Determinantes sociales de salud y calidad de vida en una localidad con deterioro ambiental, Chañaral, región de Atacama, Chile

    OpenAIRE

    Klarian Vergara, José

    2017-01-01

    El presente trabajo estudia la localidad de Chañaral, ubicada en la Región de Atacama en el norte de Chile, dado que ella reviste especial importancia debido a los problemas ambientales que impactan la salud de sus habitantes. Se buscó, a través de una actividad Focus Group, identificar aquellas variables que, a juicio de representantes clave, tienen alta importancia desde la perspectiva de la calidad de vida de la comunidad. Entre 14 áreas temáticas, se i...

  19. Petrology and geochemistry of primary magmas trapped in melt inclusions in scoria of Beaunit Maar (Chaîne des Puys, Massif Central, France)

    Science.gov (United States)

    Jannot, S.; Schiano, P.; Boivin, P.; Clocchiatti, R.; Chazot, G.

    2003-04-01

    The Massif Central area, characterized by a typical intraplate alkaline serie, is the largest magmatic province of the West-European Rift system. Although it has been the subject of several studies, the nature of Massif Central sources is still a matter of debate and many hypotheses are proposed, including deep-rooted continental hotspot, metasomatised spinel lherzolites and an asthenospheric flow linked to the lithospheric root of the Alpine chain. The Chaîne des Puys is the last magmatic province of the French Massif Central and is composed of hundred young well-preserved volcanoes. The present work aims to supply information on the nature and the origin of the source chemistry of alkaline serie from the Chaîne des Puys, by characterizing the trace and major element composition of minute melts preserved as quenched glass inclusions inside olivines phenocrysts in scoria from the Beaunit Maar. Heating stage experiments performed at ambient pressure on partially crystallised primary melt inclusions suggest CO_2 oversaturation of the trapped melt, and an entrapment temperature around 1200^oC±10^oC. Daughter minerals analyses point to a Ti-and Ca-rich basaltic paragenesis, in good agreement with that of erupted basalts from the Chaîne des Puys. Major element compositions show that melts trapped in inclusions evolve by limited fractional crystallization. Inclusions trapped in the more primitive olivine phenocrysts (Fo85) have alkali-basalt compositions that fall on the primitive end of the compositional trend define by the lavas of the Chaîne des Puys. Their major element chemistry rules out the hypothesis of a mantle source in the spinel stability field and requires a garnet-bearing mantle source. Analyzed for trace-element composition by LA-ICP-MS, they display homogeneous, enriched patterns, similar to those characterizing oceanic island and continental basalts. They have high concentration of LILE and LREE/HREE ratios. Such trace-element feature are typical of

  20. CHADS2 score has a better predictive value than CHA2DS2-VASc score in elderly patients with atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Xing YL

    2016-07-01

    Full Text Available Yunli Xing, Qing Ma, Xiaoying Ma, Cuiying Wang, Dai Zhang, Ying Sun Department of Geriatrics and Gerontology, Beijing Friendship Hospital, Capital Medical University, Beijing, People’s Republic of China Aim: The study aims to compare the ability of CHA2DS2-VASc (defined as congestive heart failure, hypertension, age ≥75 years [two scores], type 2 diabetes mellitus, previous stroke, transient ischemic attack, or thromboembolism [TE] [doubled], vascular disease, age 65–74 years, and sex category and CHADS2 (defined as congestive heart failure, hypertension, age ≥75 years, type 2 diabetes mellitus, previous stroke [doubled] scores to predict the risk of ischemic stroke (IS or TE among patients with nonvalvular atrial fibrillation (NVAF.Methods: A total of 413 patients with NVAF aged ≥65 years, and not on oral anticoagulants for the previous 6 months, were enrolled in the study. The predictive value of the CHA2DS2-VASc and CHADS2 scores for IS/TE events was evaluated by the Kaplan–Meier method.Results: During a follow-up period of 1.99±1.29 years, 104 (25.2% patients died and 59 (14.3% patients developed IS/TE. The CHADS2 score performed better than the CHA2DS2-VASc score in predicting IS/TE as assessed by c-indexes (0.647 vs 0.615, respectively; P<0.05. Non-CHADS2 risk factors, such as vascular disease and female sex, were not found to be predictive of IS/TE (hazard ratio 1.518, 95% CI: 0.832–2.771; hazard ratio 1.067, 95% CI: 0.599–1.899, respectively. No differences in event rates were found in patients with the CHADS2 scores of 1 and 2 (7.1% vs 7.8%. It was observed that patients with a CHADS2 score of ≥3 were most in need of anticoagulation therapy.Conclusion: In patients with NVAF aged ≥65 years, the CHADS2 score was found to be significantly better in predicting IS/TE events when compared to the CHA2DS2-VASc score. Patients with a CHADS2 score of ≥3 were associated with high risk of IS/TE events. Keywords: NVAF

  1. Enhancing the 'real world' prediction of cardiovascular events and major bleeding with the CHA2DS2-VASc and HAS-BLED scores using multiple biomarkers.

    Science.gov (United States)

    Roldán, Vanessa; Rivera-Caravaca, José Miguel; Shantsila, Alena; García-Fernández, Amaya; Esteve-Pastor, María Asunción; Vilchez, Juan Antonio; Romera, Marta; Valdés, Mariano; Vicente, Vicente; Marín, Francisco; Lip, Gregory Y H

    2018-02-01

    Atrial fibrillation (AF)-European guidelines suggest the use of biomarkers to stratify patients for stroke and bleeding risks. We investigated if a multibiomarker strategy improved the predictive performance of CHA 2 DS 2 -VASc and HAS-BLED in anticoagulated AF patients. We included consecutive patients stabilized for six months on vitamin K antagonists (INRs 2.0-3.0). High sensitivity troponin T, NT-proBNP, interleukin-6, von Willebrand factor concentrations and glomerular filtration rate (eGFR; using MDRD-4 formula) were quantified at baseline. Time in therapeutic range (TTR) was recorded at six months after inclusion. Patients were follow-up during a median of 2375 (IQR 1564-2887) days and all adverse events were recorded. In 1361 patients, adding four blood biomarkers, TTR and MDRD-eGFR, the predictive value of CHA 2 DS 2 -VASc increased significantly by c-index (0.63 vs. 0.65; p = .030) and IDI (0.85%; p originals scores. Addition of biomarkers enhanced the predictive value of CHA 2 DS 2 -VASc and HAS-BLED, although the overall improvement was modest and the added predictive advantage over original scores was marginal. Key Messages Recent atrial fibrillation (AF)-European guidelines for the first time suggest the use of biomarkers to stratify patients for stroke and bleeding risks, but their usefulness in real world for risk stratification is still questionable. In this cohort study involving 1361 AF patients optimally anticoagulated with vitamin K antagonists, adding high sensitivity troponin T, N-terminal pro-B-type natriuretic peptide, interleukin 6, von Willebrand factor, glomerular filtration rate (by the MDRD-4 formula) and time in therapeutic range, increased the predictive value of CHA 2 DS 2 -VASc for cardiovascular events, but not the predictive value of HAS-BLED for major bleeding. Reclassification analyses did not show improvement adding multiple biomarkers. Despite the improvement observed, the added predictive advantage is marginal and

  2. Origin and Population Dynamics of a Novel HIV-1 Subtype G Clade Circulating in Cape Verde and Portugal.

    Science.gov (United States)

    de Pina-Araujo, Isabel Inês M; Delatorre, Edson; Guimarães, Monick L; Morgado, Mariza G; Bello, Gonzalo

    2015-01-01

    The human immunodeficiency virus type 1 (HIV-1) subtype G is the most prevalent and second most prevalent HIV-1 clade in Cape Verde and Portugal, respectively; but there is no information about the origin and spatiotemporal dispersal pattern of this HIV-1 clade circulating in those countries. To this end, we used Maximum Likelihood and Bayesian coalescent-based methods to analyze a collection of 578 HIV-1 subtype G pol sequences sampled throughout Portugal, Cape Verde and 11 other countries from West and Central Africa over a period of 22 years (1992 to 2013). Our analyses indicate that most subtype G sequences from Cape Verde (80%) and Portugal (95%) branched together in a distinct monophyletic cluster (here called G(CV-PT)). The G(CV-PT) clade probably emerged after a single migration of the virus out of Central Africa into Cape Verde between the late 1970s and the middle 1980s, followed by a rapid dissemination to Portugal a couple of years later. Reconstruction of the demographic history of the G(CV-PT) clade circulating in Cape Verde and Portugal indicates that this viral clade displayed an initial phase of exponential growth during the 1980s and 1990s, followed by a decline in growth rate since the early 2000s. Our data also indicate that during the exponential growth phase the G(CV-PT) clade recombined with a preexisting subtype B viral strain circulating in Portugal, originating the CRF14_BG clade that was later disseminated to Spain and Cape Verde. Historical and recent human population movements between Angola, Cape Verde and Portugal probably played a key role in the origin and dispersal of the G(CV-PT )and CRF14_BG clades.

  3. Coordinated Hard Sphere Mixture (CHaSM): A fast approximate model for oxide and silicate melts at extreme conditions

    Science.gov (United States)

    Wolf, A. S.; Asimow, P. D.; Stevenson, D. J.

    2015-12-01

    Recent first-principles calculations (e.g. Stixrude, 2009; de Koker, 2013), shock-wave experiments (Mosenfelder, 2009), and diamond-anvil cell investigations (Sanloup, 2013) indicate that silicate melts undergo complex structural evolution at high pressure. The observed increase in cation-coordination (e.g. Karki, 2006; 2007) induces higher compressibilities and lower adiabatic thermal gradients in melts as compared with their solid counterparts. These properties are crucial for understanding the evolution of impact-generated magma oceans, which are dominated by the poorly understood behavior of silicates at mantle pressures and temperatures (e.g. Stixrude et al. 2009). Probing these conditions is difficult for both theory and experiment, especially given the large compositional space (MgO-SiO2-FeO-Al2O3-etc). We develop a new model to understand and predict the behavior of oxide and silicate melts at extreme P-T conditions (Wolf et al., 2015). The Coordinated Hard Sphere Mixture (CHaSM) extends the Hard Sphere mixture model, accounting for the range of coordination states for each cation in the liquid. Using approximate analytic expressions for the hard sphere model, this fast statistical method compliments classical and first-principles methods, providing accurate thermodynamic and structural property predictions for melts. This framework is applied to the MgO system, where model parameters are trained on a collection of crystal polymorphs, producing realistic predictions of coordination evolution and the equation of state of MgO melt over a wide P-T range. Typical Mg-coordination numbers are predicted to evolve continuously from 5.25 (0 GPa) to 8.5 (250 GPa), comparing favorably with first-principles Molecular Dynamics (MD) simulations. We begin extending the model to a simplified mantle chemistry using empirical potentials (generally accurate over moderate pressure ranges, consuming classical MD calculations. This approach also sheds light on the universality

  4. TECHOS VERDES COMO SOLUCIÓN AL PROBLEMA DE INUNDACIONES EN MEDIOS URBANOS

    Directory of Open Access Journals (Sweden)

    López, N.

    2015-12-01

    Full Text Available El presente trabajo de investigación se realizó empleando modelos matemáticos, con la finalidad de comparar la escorrentía producida en un urbanismo con condiciones actuales de techos de tejas criollas, contra otro donde se usan estructuras o dispositivos de almacenamiento y retención de agua en casas, patios, parcelas, calles y contra urbanismos en general. Se seleccionó una zona de estudio en el Estado Lara (Venezuela, en el municipio Palavecino, en las inmediaciones de la Quebrada Tabure, considerando los techos verdes desde el punto de vista de reductores de escorrentía. Se elaboró una aplicación llamada “TechosVerdes.py” en el programa de licencia libre Python, con aproximadamente 4600 líneas de código para calcular los hidrogramas de los techos, patios, calles y áreas verdes, basándose en un mosaico creado con imágenes tipo raster en el programa Quantum Gis. La investigación se basó en la comparación directa de trece escenarios hipotéticos, donde se utilizó techos verdes y adicionalmente, tanques de almacenamiento y brocales, con un escenario original en condiciones actuales, sin alteraciones. Se obtuvo como resultado en los hidrogramas calculados para los escenarios hipotéticos, que el caudal pico disminuye, achatándose el hidrograma. This research was carried out using mathematical models in order to compare the runoff from an urban planning with handmade tiles roofs in actual conditions, with one where structures or storage devices and water retention in houses, yards are used, parcels, streets and housing complexes in general. A study area in the state of Lara, Venezuela, in Palavecino municipality, near Quebrada Tabure, was selected and green roofs are considered from the point of view of reducing runoff. An application called "TechosVerdes.py" was made under the license free Python program with approximately 4600 code lines was developed to calculate hydrographs from roofs, patios, streets and green areas

  5. Phylogenetic relationships of cone snails endemic to Cabo Verde based on mitochondrial genomes.

    Science.gov (United States)

    Abalde, Samuel; Tenorio, Manuel J; Afonso, Carlos M L; Uribe, Juan E; Echeverry, Ana M; Zardoya, Rafael

    2017-11-25

    Due to their great species and ecological diversity as well as their capacity to produce hundreds of different toxins, cone snails are of interest to evolutionary biologists, pharmacologists and amateur naturalists alike. Taxonomic identification of cone snails still relies mostly on the shape, color, and banding patterns of the shell. However, these phenotypic traits are prone to homoplasy. Therefore, the consistent use of genetic data for species delimitation and phylogenetic inference in this apparently hyperdiverse group is largely wanting. Here, we reconstruct the phylogeny of the cones endemic to Cabo Verde archipelago, a well-known radiation of the group, using mitochondrial (mt) genomes. The reconstructed phylogeny grouped the analyzed species into two main clades, one including Kalloconus from West Africa sister to Trovaoconus from Cabo Verde and the other with a paraphyletic Lautoconus due to the sister group relationship of Africonus from Cabo Verde and Lautoconus ventricosus from Mediterranean Sea and neighboring Atlantic Ocean to the exclusion of Lautoconus endemic to Senegal (plus Lautoconus guanche from Mauritania, Morocco, and Canary Islands). Within Trovaoconus, up to three main lineages could be distinguished. The clade of Africonus included four main lineages (named I to IV), each further subdivided into two monophyletic groups. The reconstructed phylogeny allowed inferring the evolution of the radula in the studied lineages as well as biogeographic patterns. The number of cone species endemic to Cabo Verde was revised under the light of sequence divergence data and the inferred phylogenetic relationships. The sequence divergence between continental members of the genus Kalloconus and island endemics ascribed to the genus Trovaoconus is low, prompting for synonymization of the latter. The genus Lautoconus is paraphyletic. Lautoconus ventricosus is the closest living sister group of genus Africonus. Diversification of Africonus was in allopatry

  6. CsMYB5a and CsMYB5e from Camellia sinensis differentially regulate anthocyanin and proanthocyanidin biosynthesis.

    Science.gov (United States)

    Jiang, Xiaolan; Huang, Keyi; Zheng, Guangshun; Hou, Hua; Wang, Peiqiang; Jiang, Han; Zhao, Xuecheng; Li, Mingzhuo; Zhang, Shuxiang; Liu, Yajun; Gao, Liping; Zhao, Lei; Xia, Tao

    2018-05-01

    Tea is one of the most widely consumed nonalcoholic beverages worldwide. Polyphenols are nutritional compounds present in the leaves of tea plants. Although numerous genes are functionally characterized to encode enzymes that catalyze the formation of diverse polyphenolic metabolites, transcriptional regulation of those different pathways such as late steps of the proanthcoyanidin (PA) pathway remains unclear. In this study, using different tea transcriptome databases, we screened at least 140 R2R3-MYB transcription factors (TFs) and grouped them according to the basic function domains of the R2R3 MYB TF superfamily. Among 140 R2R3 TFs, CsMYB5a and CsMYB5e were chosen for analysis because they may be involved in PA biosynthesis regulation. CsMYB5a-overexpressing tobacco plants exhibited downregulated anthocyanin accumulation but a high polymeric PA content in the flowers. Overexpression of CsMYB5e in tobacco plants did not change the anthocyanin content but increased the dimethylaminocinnamaldehyde-stained PA content. RNA-seq and qRT-PCR analyses revealed that genes related to PA and anthocyanin biosynthesis pathways were markedly upregulated in both CsMYB5a- and CsMYB5e-overexpressing flowers. Three UGTs and four GSTs were identified as involved in PA and anthocyanin glycosylation and transportation in transgenic plants. These results provide new insights into the regulation of PA and anthocyanin biosynthesis in Camellia sinensis. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. Effect of Medium Supplements on Agrobacterium rhizogenes Mediated Hairy Root Induction from the Callus Tissues of Camellia sinensis var. sinensis.

    Science.gov (United States)

    Rana, Mohammad M; Han, Zhuo-Xiao; Song, Da-Peng; Liu, Guo-Feng; Li, Da-Xiang; Wan, Xiao-Chun; Karthikeyan, Alagarsamy; Wei, Shu

    2016-07-15

    Tea (Camellia sinensis L.) is recalcitrant to Agrobacterium-mediated genetic transformation largely due to the bactericidal effects of tea polyphenols and phenolics oxidation induced by necrosis of explant tissue over the process of transformation. In this study, different antioxidants/adsorbents were added as supplements to the co-cultivation and post co-cultivation media to overcome these problems for the transformation improvement. Tea-cotyledon-derived calli were used as explants and Agrobacterium rhizognes strain ATCC 15834 was used as a mediator. Results showed that Agrobacterium growth, virulence (vir) gene expression and browning of explant tissue were greatly influenced by different supplements. Murashige and Skoog (MS) basal salts medium supplemented with 30 g·L(-1) sucrose, 0.1 g·L(-1) l-glutamine and 5 g·L(-1) polyvinylpolypyrrolidone (PVPP) as co-cultivation and post co-cultivation media could maintain these parameters better that ultimately led to significant improvement of hairy root generation efficiency compared to that in the control (MS + 30 g·L(-1) sucrose). Additionally, the reporter genes β-glucuronidase (gusA) and cyan fluorescent protein (cfp) were also stably expressed in the transgenic hairy roots. Our study would be helpful in establishing a feasible approach for tea biological studies and genetic improvement of tea varieties.

  8. Microwave assisted synthesis of camellia oleifera shell-derived porous carbon with rich oxygen functionalities and superior supercapacitor performance

    Science.gov (United States)

    Liang, Jiyuan; Qu, Tingting; Kun, Xiang; Zhang, Yu; Chen, Shanyong; Cao, Yuan-Cheng; Xie, Mingjiang; Guo, Xuefeng

    2018-04-01

    Biomass-derived carbon (BDCs) materials are receiving extensive attention as electrode materials for energy storage because of the considerable economic value offering possibility for practical applications, but the electrochemical capacitance of BDCs are usually relatively low resulted from limited electric double layer capacitance. Herein, an oxygen-rich porous carbon (KMAC) was fabricated through a rapid and convenient microwave assisted carbonization and KOH activation of camellia oleifera shell. The obtained KMAC possesses three-dimensional porous architecture, large surface area (1229 m2/g) and rich oxygen functionalities (C/O ratio of 1.66). As the electrode materials for supercapacitor, KMAC exhibits superior supercapacitive performances as compared to the activated carbon (KAC) derived from direct carbonization/KOH activation method in 2.0 M H2SO4 (315 F/g vs. 202 F/g) and 6.0 M KOH (251 F/g vs. 214 F/g) electrolyte due to the rich oxygen-containing functional groups on the surface of porous carbon resulted from the developed microwave-assisted carbonization/activation approach.

  9. Influence of exogenously applied abscisic acid on carotenoid content and water uptake in flowers of the tea plant (Camellia sinensis).

    Science.gov (United States)

    Baldermann, Susanne; Yang, Ziyin; Sakai, Miwa; Fleischmann, Peter; Morita, Akio; Todoroki, Yasushi; Watanabe, Naoharu

    2013-05-01

    Carotenoids are a major class of plant pigments and fulfill many functions in different organisms that either produce or consume them. Although the color of the stamina of tea (Camellia sinensis) flowers is clearly due to the presence of carotenoids, the carotenoid profile and content remain to be discovered. We investigated the carotenoid profile of tea flowers and determined changes in concentrations over the floral development. The flowers contained oxygenated xanthophylls such as neoxanthin, lutein and zeaxanthin, as well as the hydrocarbons β-carotene and α-carotene. Flowers of the tea plant contain to vegetables comparable amounts of carotenoids. The content of 9'-cis-epoxycarotenoids, which serve as abscisic acid precursors, as well as changes in concentration of abscisic acid were studied. The concentrations of carotenoids decreased whereas the abscisic acid content increased over the floral development. Exogenously applied S-abscisic acid affected water uptake, flower opening and carotenoid accumulation. In summary, this paper reports, for the first time, the carotenoid profile and content of tea flowers. The study revealed that carotenoids in tea flowers are an interesting target in respect of possible applications of tea flower extracts as well as biological functions of abscisic acid during floral development. © 2012 Society of Chemical Industry.

  10. Effect of Medium Supplements on Agrobacterium rhizogenes Mediated Hairy Root Induction from the Callus Tissues of Camellia sinensis var. sinensis

    Directory of Open Access Journals (Sweden)

    Mohammad M. Rana

    2016-07-01

    Full Text Available Tea (Camellia sinensis L. is recalcitrant to Agrobacterium-mediated genetic transformation largely due to the bactericidal effects of tea polyphenols and phenolics oxidation induced by necrosis of explant tissue over the process of transformation. In this study, different antioxidants/adsorbents were added as supplements to the co-cultivation and post co-cultivation media to overcome these problems for the transformation improvement. Tea-cotyledon-derived calli were used as explants and Agrobacterium rhizognes strain ATCC 15834 was used as a mediator. Results showed that Agrobacterium growth, virulence (vir gene expression and browning of explant tissue were greatly influenced by different supplements. Murashige and Skoog (MS basal salts medium supplemented with 30 g·L−1 sucrose, 0.1 g·L−1 l-glutamine and 5 g·L−1 polyvinylpolypyrrolidone (PVPP as co-cultivation and post co-cultivation media could maintain these parameters better that ultimately led to significant improvement of hairy root generation efficiency compared to that in the control (MS + 30 g·L−1 sucrose. Additionally, the reporter genes β-glucuronidase (gusA and cyan fluorescent protein (cfp were also stably expressed in the transgenic hairy roots. Our study would be helpful in establishing a feasible approach for tea biological studies and genetic improvement of tea varieties.

  11. Evaluation of in vitro antimicrobial potential and GC–MS analysis of Camellia sinensis and Terminalia arjuna

    Directory of Open Access Journals (Sweden)

    Divya Gupta

    2017-03-01

    Full Text Available Traditionally, Camellia sinensis and Terminalia arjuna are being used widely to cure various diseases like cardiovascular diseases, cancer etc. In the present study, extracts of these plants were evaluated for their antimicrobial activities against some human pathogenic bacteria viz. E. coli, P. aeruginosa, S. aureus and fungus C. albicans. In-vitro inhibition of these pathogenic microorganisms produced inhibition zone ranging from 9 to 18 mm. MIC values of these plant extracts ranged from 6.25 to 12.5 mg/ml. MBC of C. sinensis for E. coli, P. aeruginosa and S. aureus was found to be 50 and 12.5 mg/ml, respectively. In case of T. arjuna, the MBC of all the tested microorganisms was found to be 25 mg/ml. The MFC of C. sinensis and T. arjuna against C. albicans was observed to be 50 and 25 mg/ml, respectively. GC–MS analysis of C. sinensis and T. arjuna extract identified 13 and 21 compounds, respectively.

  12. Transcriptome-Based Analysis of Dof Family Transcription Factors and Their Responses to Abiotic Stress in Tea Plant (Camellia sinensis

    Directory of Open Access Journals (Sweden)

    Hui Li

    2016-01-01

    Full Text Available Tea plant (Camellia sinensis (L. O. Kuntze is affected by abiotic stress during its growth and development. DNA-binding with one finger (Dof transcription factors (TFs play important roles in abiotic stress tolerance of plants. In this study, a total of 29 putative Dof TFs were identified based on transcriptome of tea plant, and the conserved domains and common motifs of these CsDof TFs were predicted and analyzed. The 29 CsDof proteins were divided into 7 groups (A, B1, B2, C1, C2.1, C2.2, and D2, and the interaction networks of Dof proteins in C. sinensis were established according to the data in Arabidopsis. Gene expression was analyzed in “Yingshuang” and “Huangjinya” under four experimental stresses by qRT-PCR. CsDof genes were expressed differentially and related to different abiotic stress conditions. In total, our results might suggest that there is a potential relationship between CsDof factors and tea plant stress resistance.

  13. Optimisation of saponin extraction conditions with Camellia sinensis var. assamica seed and its application for a natural detergent.

    Science.gov (United States)

    Gong, Wanying; Huang, Yewei; Ji, Aibing; Peng, Wenshu; Liu, Cong; Zeng, Yin; Yang, Ruijuan; Yan, Liang; Wang, Xuanjun; Sheng, Jun

    2018-04-01

    Camellia sinensis var. assamica seed cake (a by-product of tea-seed oil) is an abundant resource with poor utilisation. C. sinensis var. assamica seed saponin (CSS) is one kind of non-ionic surfactant. In this study, the CSS extraction conditions were optimised by response surface methodology (RSM) and then the CSS detergent was developed. Additionally, the safety and decontamination ability of the developed detergent were evaluated. The optimised extraction conditions were including the extracting temperature of 40.04 °C, extraction time of 4.97 h, ethanol concentration of 64.11% and liquid-solid ratio of 14.57:1 mL g -1 . The formula of the CSS detergent was as follows: 20% crude CSS, 0.3% oxidised tea polyphenols (OTPs), 0.2% nisin, 0.3% sodium dehydroacetate, 0.7% sodium alginate and 0.5% sodium polyacrylate. The LD 50 of the CSS detergent exceeds 14 g kg -1 in mice, indicating the detergent was non-toxic. Both of the emulsifying and the pesticide residues removal abilities of the CSS detergent were significantly stronger than the commercial detergent. A natural tea seed saponin detergent with good safety and decontamination ability was successfully developed. This can make better use of the tea seed cake, thereby creating added value in the tea seed oil industry. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  14. Camellia sinensis Prevents Perinatal Nicotine-Induced Neurobehavioral Alterations, Tissue Injury, and Oxidative Stress in Male and Female Mice Newborns

    Science.gov (United States)

    Ajarem, Jamaan S.; Al-Basher, Gadh; Allam, Ahmed A.

    2017-01-01

    Nicotine exposure during pregnancy induces oxidative stress and leads to behavioral alterations in early childhood and young adulthood. The current study aimed to investigate the possible protective effects of green tea (Camellia sinensis) against perinatal nicotine-induced behavioral alterations and oxidative stress in mice newborns. Pregnant mice received 50 mg/kg C. sinensis on gestational day 1 (PD1) to postnatal day 15 (D15) and were subcutaneously injected with 0.25 mg/kg nicotine from PD12 to D15. Nicotine-exposed newborns showed significant delay in eye opening and hair appearance and declined body weight at birth and at D21. Nicotine induced neuromotor alterations in both male and female newborns evidenced by the suppressed righting, rotating, and cliff avoidance reflexes. Nicotine-exposed newborns exhibited declined memory, learning, and equilibrium capabilities, as well as marked anxiety behavior. C. sinensis significantly improved the physical development, neuromotor maturation, and behavioral performance in nicotine-exposed male and female newborns. In addition, C. sinensis prevented nicotine-induced tissue injury and lipid peroxidation and enhanced antioxidant defenses in the cerebellum and medulla oblongata of male and female newborns. In conclusion, this study shows that C. sinensis confers protective effects against perinatal nicotine-induced neurobehavioral alterations, tissue injury, and oxidative stress in mice newborns. PMID:28588748

  15. Occurrence of Functional Molecules in the Flowers of Tea (Camellia sinensis Plants: Evidence for a Second Resource

    Directory of Open Access Journals (Sweden)

    Yiyong Chen

    2018-03-01

    Full Text Available Tea (Camellia sinensis is an important crop, and its leaves are used to make the most widely consumed beverage, aside from water. People have been using leaves from tea plants to make teas for a long time. However, less attention has been paid to the flowers of tea plants, which is a waste of an abundant resource. In the past 15 years, researchers have attempted to discover, identify, and evaluate functional molecules from tea flowers, and have made insightful and useful discoveries. Here, we summarize the recent investigations into these functional molecules in tea flowers, including functional molecules similar to those in tea leaves, as well as the preponderant functional molecules in tea flowers. Tea flowers contain representative metabolites similar to those of tea leaves, such as catechins, flavonols, caffeine, and amino acids. The preponderant functional molecules in tea flowers include saponins, polysaccharides, aromatic compounds, spermidine derivatives, and functional proteins. We also review the safety and biological functions of tea flowers. Tea flower extracts are proposed to be of no toxicological concern based on evidence from the evaluation of mutagenicity, and acute and subchronic toxicity in rats. The presence of many functional metabolites in tea flowers indicates that tea flowers possess diverse biological functions, which are mostly related to catechins, polysaccharides, and saponins. Finally, we discuss the potential for, and challenges facing, future applications of tea flowers as a second resource from tea plants.

  16. Studies on cytotoxic and clot lysis activity of probiotically fermented cocktail juice prepared using Camellia sinensis and Punica grantum

    Science.gov (United States)

    Biswas, Ananya; Deori, Meenakshi; Nivetha, A.; Mohansrinivasan, V.

    2017-11-01

    In the current research the effect of probiotic microorganisms viz; Lactococcus lactis and Lactobacillus plantarum on fermentation of Camellia sinensis and Punica grantum was studied. In vitro test were done to analyze the anticancer, antioxidant and atherosclerosis (clot lysis) properties of fermented juice. The juice was fermented for 48 and 96h, during which concentration of phenolic content, total acid content and free radical scavenging activity of the sample was analyzed by DPPH assay (α, α-diphenyl-β-picrylhydrazyl). Dropping of pH was observed after 48 h of fermentation. The clot lysis activity was found to be 80 % in 100μl concentration of fermented cocktail juice. The 96 h fermented sample has shown around 70% inhibition against colon cancer cell lines. Analytical study of HPLC proves the organic acid production such as ascorbic acid in superior amount for 96h of fermented sample, Based on the retention time, the corresponding peaks were detected at 4.919 and 4.831 min.

  17. Daily consumption of white tea (Camellia sinensis (L.)) improves the cerebral cortex metabolic and oxidative profile in prediabetic Wistar rats.

    Science.gov (United States)

    Nunes, Ana R; Alves, Marco G; Tomás, Gonçalo D; Conde, Vanessa R; Cristóvão, Ana C; Moreira, Paula I; Oliveira, Pedro F; Silva, Branca M

    2015-03-14

    Diabetes mellitus (DM) is a major public health problem and its incidence is rising dramatically. The brain, particularly the cerebral cortex, is very susceptible to glucose fluctuations and hyperglycaemia-induced oxidative stress. Tea (Camellia sinensis (L.)) is widely consumed; however, the antidiabetic properties of white tea remain largely unexplored. In the present study, we investigated the effects of daily consumption of white tea on the cerebral cortex of prediabetic rats. The cerebral cortex metabolic profile was evaluated, and the expression levels of GLUT, phosphofructokinase-1, lactate dehydrogenase (LDH) and monocarboxylate transporter 4 were assessed. LDH activity was also determined. The cerebral cortex oxidative profile was determined by evaluating its antioxidant power, lipid peroxidation and protein oxidation levels. Catalase, glutathione, glutamate, N-acetylaspartate, aspartate, choline, γ-aminobutyric acid, taurine and valine contents were determined. Daily consumption of white tea ameliorated glucose tolerance and insulin sensitivity. Moreover, white tea altered the cortex glycolytic profile, modulating GLUT expression and lactate and alanine contents. Finally, white tea consumption restored protein oxidation and lipid peroxidation levels and catalase expression, and improved antioxidant capacity. In conclusion, daily consumption of white tea improved the cerebral cortex metabolic and oxidative profile in prediabetic rats, suggesting it as a good, safe and inexpensive strategy to prevent DM-related effects in the cerebral cortex.

  18. Fatty Acid Composition and Antioxidant Activity of Tea (Camellia sinensis L.) Seed Oil Extracted by Optimized Supercritical Carbon Dioxide

    Science.gov (United States)

    Wang, Yuefei; Sun, Da; Chen, Hao; Qian, Lisheng; Xu, Ping

    2011-01-01

    Seeds are another product in addition to leaves (raw materials for teas) of tea (Camellia sinensis L.) plant. The great increase of tea consumption in recent years raises the challenge of finding commercial applications for tea seeds. In the present study, supercritical carbon dioxide (SC-CO2) extraction edible oil from tea seed was carried out, response surface methodology (RSM) was used to optimize processing parameters including time (20–90 min), temperature (35–45 °C) and pressure (50–90 MPa). The fatty acid composition and antioxidant activity of the extracted oil was also investigated. The highest yield of oil (29.2 ± 0.6%) was obtained under optimal SC-CO2 extraction conditions (45 °C, 89.7 min and 32 MPa, respectively), which was significantly higher (p Soxhlet extraction. Meanwhile, tea seed oil extracted by SC-CO2 contained approximately 80% unsaturated fatty acids and showed a much stronger scavenging ability on the DPPH radical than that extracted by Soxhlet. SC-CO2 is a promising alternative for efficient extraction of edible oil from tea seed. Moreover, tea seed oil extracted by SC-CO2 is highly edible and has good antioxidant activity, and therefore may play a potential role as a health-promoting food resource in human diets. PMID:22174626

  19. Variation in physiological and chemical characteristics at developmental stage in different disease-resistant varieties of camellia oleifera

    International Nuclear Information System (INIS)

    Cao, Z.; Dong, C.; Zhang, X.

    2014-01-01

    Camellia oleifera Abel. is an important edible oil tree species from Southern China. Anthracnose, caused by Colletotrichum gloeosporioides (Penz.), is responsible for more than 50% of C. oleifera production loss, and C. oleifera varieties differ in their resistance to anthracnose. The aim of this study was to assess resistance mechanisms by monitoring physiological and biochemical parameters of differentially resistant cultivars during the development of C. oleifera. C. oleifera fruit coats were analyzed between May and September for tannins, anthocyanins, soluble sugar content, pH, buffer capacity, activity of three enzyme (Phenylalanine ammonia lyase; polyphenol oxidase; peroxidase) and free radical scavenging capacity. Anthocyanins, soluble contents and free radical scavenging capacity were related to anthracnose resistance, with anthocyanins and soluble sugar contents of the resistant varieties nearly twofold higher than those of susceptible varieties. The results of free radical scavenging capacity showed that extracts from highly resistant varieties of C. oleifera fruit coats performed more efficiently in the scavenging of free radicals than those from susceptible varieties. The three enzyme activities of highly resistant varieties rose rapidly and continuously, while those of medium resistant and highly susceptible varieties increased initially and then decreased. Tannins, pH and buffer capacity showed no significant differences between different cultivars. This study broadens the understanding of disease resistance mechanisms in C. oleifera. (author)

  20. Chitosan-induced immunity in Camellia sinensis (L.) O. Kuntze against blister blight disease is mediated by nitric-oxide.

    Science.gov (United States)

    Chandra, Swarnendu; Chakraborty, Nilanjan; Panda, Koustubh; Acharya, Krishnendu

    2017-06-01

    Blister blight disease, caused by an obligate biotrophic fungal pathogen, Exobasidium vexans Massee is posing a serious threat for tea cultivation in Asia. As the use of chemical pesticides on tea leaves substantially increases the toxic risks of tea consumption, serious attempts are being made to control such pathogens by boosting the intrinsic natural defense responses against invading pathogens in tea plants. In this study, the nature and durability of resistance offered by chitosan and the possible mechanism of chitosan-induced defense induction in Camellia sinensis (L.) O. Kuntze plants against blister blight disease were investigated. Foliar application of 0.01% chitosan solution at 15 days interval not only reduced the blister blight incidence for two seasons, but also maintained the induced expressions of different defense related enzymes and total phenol content compared to the control. Defense responses induced by chitosan were found to be down regulated under nitric oxide (NO) deficient conditions in vivo, indicating that the observed chitosan-induced resistance is probably activated via NO signaling. Such role of NO in host defense response was further established by application of the NO donor, sodium nitroprusside (SNP), which produced similar defense responses accomplished through chitosan treatment. Taken together, our results suggest that increased production of NO in chitosan-treated tea plants may play a critical role in triggering the innate defense responses effective against plant pathogens, including that causing the blister blight disease. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  1. Cost-effective Isolation of Bioactive Compounds from a Discarded Bioresource – Defatted Seeds of Camellia oleifera

    Directory of Open Access Journals (Sweden)

    Yong Ye

    2014-12-01

    Full Text Available The Camellia oleifera oil industry is the economic mainstay in many high-poverty mountain regions of China, but the defatted seeds are currently discarded, leading to a waste of bioresources. In this work, a cost-effective technique was designed to isolate the flavonoid, saponins, and polysaccharides by ultrasonic-assisted acid-base alternative extraction. The activities of these compounds were evaluated by their DPPH and ABTS radical scavenging abilities in vitro and inflammatory inhibition in mice, and the economic efficiency was assessed. The optimal extraction conditions by response surface design were 1.6% HCl, water/seed ratio 16, extraction time 89 min, and ultrasonic power 310 W. The yields of the flavonoid, saponin, and polysaccharide were, respectively, 1.4 ± 0.2%, 6.7 ± 0.8%, and 22.5 ± 1.7%. The extracts could eliminate DPPH and ABTS radicals and alleviate inflammation with concentration dependence, and showed excellent capacity in the order of flavonoid ≥ saponin > polysaccharides. The residue after extraction was cellulose, with a yield of 63.0 ± 2.4%. The defatted seeds could produce a value of $11.35 per kilogram after production of the four valuable extracts, which would greatly increase the income in these high-poverty areas. This integrated extraction technique provides valuable recycling utilization of a typically discarded bioresource.

  2. Cymbopogon citratus and Camellia sinensis extracts selectively induce apoptosis in cancer cells and reduce growth of lymphoma xenografts in vivo

    Science.gov (United States)

    Philion, Cory; Ma, Dennis; Ruvinov, Ivan; Mansour, Fadi; Pignanelli, Christopher; Noel, Megan; Saleem, Ammar; Arnason, John; Rodrigues, Mark; Singh, Inderpal; Ropat, Jesse; Pandey, Siyaram

    2017-01-01

    Cancer cells are reported to have elevated levels of reactive oxygen species (ROS) and are highly dependent on cellular defense mechanisms against oxidative stress. Numerous nutraceuticals and natural polyphenolic compounds have a wide range of abilities to alter cellular redox states with potential implications in various diseases. Furthermore, therapeutic options for cancers are mostly nonselective treatments including genotoxic or tubulin-targeting compounds. Some of the natural extracts, containing multiple bioactive compounds, could target multiple pathways in cancer cells to selectively induce cell death. Cymbopogon citratus (lemongrass) and Camellia sinensis (white tea) extracts have been shown to have medicinal properties, however, their activity against lymphoma and leukemia, as well as mechanistic details, have not been fully characterized. Herein, we report potent anti-cancer properties in dose and time-dependent manners of ethanolic lemongrass and hot water white tea extracts in lymphoma and leukemia models. Both extracts were able to effectively induce apoptosis selectively in these human cancer cell types. Interestingly, ethanolic lemongrass extract induces apoptosis primarily by the extrinsic pathway and was found to be dependent on the generation of ROS. Conversely, apoptotic induction by hot water white tea extract was independent of ROS. Furthermore, both of these extracts caused mitochondrial depolarization and decreased rates of oxygen consumption in lymphoma and leukemia cells, leading to cell death. Most importantly, both these extracts were effective in reducing tumor growth in human lymphoma xenograft models when administered orally. Thus, these natural extracts could have potential for being nontoxic alternatives for the treatment of cancer. PMID:29340014

  3. New Sample Preparation Method for Quantification of Phenolic Compounds of Tea (Camellia sinensis L. Kuntze: A Polyphenol Rich Plant

    Directory of Open Access Journals (Sweden)

    P. A. Nimal Punyasiri

    2015-01-01

    Full Text Available Chemical analysis of the Sri Lankan tea (Camellia sinensis, L. germplasm would immensely contribute to the success of the tea breeding programme. However, the polyphenols, particularly catechins (flavan-3-ols, are readily prone to oxidation in the conventional method of sample preparation. Therefore, optimization of the present sample preparation methodology for the profiling of metabolites is much important. Two sample preparation methodologies were compared, fresh leaves (as in the conventional procedures and freeze-dried leaves (a new procedure, for quantification of major metabolites by employing two cultivars, one is known to be high quality black tea and the other low quality black tea. The amounts of major metabolites such as catechins, caffeine, gallic acid, and theobromine, recorded in the new sampling procedure via freeze-dried leaves, were significantly higher than those recorded in the conventional sample preparation procedure. Additionally new method required less amount of leaf sample for analysis of major metabolites and facilitates storage of samples until analysis. The freeze-dried method would be useful for high throughput analysis of large number of samples in shorter period without chemical deterioration starting from the point of harvest until usage. Hence, this method is more suitable for metabolite profiling of tea as well as other phenol rich plants.

  4. Fatty acid composition and antioxidant activity of tea (Camellia sinensis L.) seed oil extracted by optimized supercritical carbon dioxide.

    Science.gov (United States)

    Wang, Yuefei; Sun, Da; Chen, Hao; Qian, Lisheng; Xu, Ping

    2011-01-01

    Seeds are another product in addition to leaves (raw materials for teas) of tea (Camellia sinensis L.) plant. The great increase of tea consumption in recent years raises the challenge of finding commercial applications for tea seeds. In the present study, supercritical carbon dioxide (SC-CO(2)) extraction edible oil from tea seed was carried out, response surface methodology (RSM) was used to optimize processing parameters including time (20-90 min), temperature (35-45 °C) and pressure (50-90 MPa). The fatty acid composition and antioxidant activity of the extracted oil was also investigated. The highest yield of oil (29.2 ± 0.6%) was obtained under optimal SC-CO(2) extraction conditions (45 °C, 89.7 min and 32 MPa, respectively), which was significantly higher (p < 0.05) than that (25.3 ± 1.0%) given by Soxhlet extraction. Meanwhile, tea seed oil extracted by SC-CO(2) contained approximately 80% unsaturated fatty acids and showed a much stronger scavenging ability on the DPPH radical than that extracted by Soxhlet. SC-CO(2) is a promising alternative for efficient extraction of edible oil from tea seed. Moreover, tea seed oil extracted by SC-CO(2) is highly edible and has good antioxidant activity, and therefore may play a potential role as a health-promoting food resource in human diets.

  5. Mass transfer and kinetic modelling of supercritical CO 2 extraction of fresh tea leaves (Camellia sinensis L.

    Directory of Open Access Journals (Sweden)

    Pravin Vasantrao Gadkari

    Full Text Available Abstract Supercritical carbon dioxide extraction was employed to extract solids from fresh tea leaves (Camellia sinensis L. at various pressures(15 to 35 MPa and temperatures (313 to 333K with addition of ethanol as a polarity modifier. The diffusion model and Langmuir model fit well to experimental data and the correlation coefficients were greater than 0.94. Caffeine solubility was determined in supercritical CO2 and the Gordillo model was employed to correlate the experimental solubility values. The Gordillo model fit well to the experimental values with a correlation coefficient 0.91 and 8.91% average absolute relative deviation. Total phenol content of spent materials varied from 57 to 85.2 mg of gallic acid equivalent per g spent material, total flavonoid content varied from 50.4 to 58.2 mg of rutin equivalent per g spent material and the IC50 value (antioxidant content varied from 27.20 to 38.11 µg of extract per mL. There was significant reduction in polyphenol, flavonoid and antioxidant content in the extract when supercritical CO2 extraction was carried out at a higher pressure of 35 MPa.

  6. Oleiferoside W from the roots of Camellia oleifera C. Abel, inducing cell cycle arrest and apoptosis in A549 cells.

    Science.gov (United States)

    Wu, Jiang-Ping; Kang, Nai-Xin; Zhang, Mi-Ya; Gao, Hong-Wei; Li, Xiao-Ran; Liu, Yan-Li; Xu, Qiong-Ming; Yang, Shi-Lin

    2017-07-06

    Camellia oleifera C. Abel has been widely cultivated in China, and a group of bioactive constituents such as triterpeniod saponin have been isolated from C. oleifera C. Abel. In the current study, a new triterpeniod saponin was isolated from the EtOH extract of the roots of C. oleifera C. Abel, named as oleiferoside W, and the cytotoxic properties of oleiferoside W were evaluated in non-small cell lung cancer A549 cells. At the same time the inducing apoptosis, the depolarization of mitochondrial membrane potential (Δψ), the up-regulation of related pro-apoptotic proteins, such as cleaved-PARP, cleaved-caspase-3, and the down-regulation of anti-apoptotic marker Bcl-2/Bax were measured on oleiferoside W. Furthermore, the function, inducing the generation of reactive oxygen species (ROS) and apoptosis, of oleiferoside W could be reversed by N-acetylcysteine (NAC). In conclusion, our findings showed that oleiferoside W induced apoptosis involving mitochondrial pathway and increasing intracellular ROS production in the A549 cells, suggesting that oleiferoside W may have the possibility to be a useful anticancer agent for therapy in lung cancer.

  7. Formation of (E)-nerolidol in tea (Camellia sinensis) leaves exposed to multiple stresses during tea manufacturing.

    Science.gov (United States)

    Zhou, Ying; Zeng, Lanting; Liu, Xiaoyu; Gui, Jiadong; Mei, Xin; Fu, Xiumin; Dong, Fang; Tang, Jingchi; Zhang, Lingyun; Yang, Ziyin

    2017-09-15

    (E)-Nerolidol is a volatile sesquiterpene that contributes to the floral aroma of teas (Camellia sinensis). The unique manufacturing process for oolong tea involves multiple stresses, resulting in a high content of (E)-nerolidol, which is not known to form in tea leaves. This study aimed to determine the formation mechanism of (E)-nerolidol in tea exposed to multiple stresses during tea manufacture. C. sinensis (E)-nerolidol synthase (CsNES) recombinant protein, found in the cytosol, was found to transform farnesyl diphosphate into (E)-nerolidol. CsNES was highly expressed during the oolong tea turn over process, resulting in (E)-nerolidol accumulation. Continuous mechanical damage, simulating the turn over process, significantly enhanced CsNES expression level and (E)-nerolidol content. The combination of low temperature stress and mechanical damage had a synergistic effect on (E)-nerolidol formation. This is the first evidence of (E)-nerolidol formation mechanism in tea leaves and a characteristic example of plant volatile formation in response to dual stresses. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Genome-Wide Identification of Genes Probably Relevant to the Uniqueness of Tea Plant (Camellia sinensis and Its Cultivars

    Directory of Open Access Journals (Sweden)

    Yan Wei

    2015-01-01

    Full Text Available Tea (Camellia sinensis is a popular beverage all over the world and a number of studies have focused on the genetic uniqueness of tea and its cultivars. However, molecular mechanisms underlying these phenomena are largely undefined. In this report, based on expression data available from public databases, we performed a series of analyses to identify genes probably relevant to the uniqueness of C. sinensis and two of its cultivars (LJ43 and ZH2. Evolutionary analyses showed that the evolutionary rates of genes involved in the pathways were not significantly different among C. sinensis, C. oleifera, and C. azalea. Interestingly, a number of gene families, including genes involved in the pathways synthesizing iconic secondary metabolites of tea plant, were significantly upregulated, expressed in C. sinensis (LJ43 when compared to C. azalea, and this may partially explain its higher content of flavonoid, theanine, and caffeine. Further investigation showed that nonsynonymous mutations may partially contribute to the differences between the two cultivars of C. sinensis, such as the chlorina and higher contents of amino acids in ZH2. Genes identified as candidates are probably relevant to the uniqueness of C. sinensis and its cultivars should be good candidates for subsequent functional analyses and marker-assisted breeding.

  9. Fatty Acid Composition and Antioxidant Activity of Tea (Camellia sinensis L. Seed Oil Extracted by Optimized Supercritical Carbon Dioxide

    Directory of Open Access Journals (Sweden)

    Ping Xu

    2011-11-01

    Full Text Available Seeds are another product in addition to leaves (raw materials for teas of tea (Camellia sinensis L. plant. The great increase of tea consumption in recent years raises the challenge of finding commercial applications for tea seeds. In the present study, supercritical carbon dioxide (SC-CO2 extraction edible oil from tea seed was carried out, response surface methodology (RSM was used to optimize processing parameters including time (20–90 min, temperature (35–45 °C and pressure (50–90 MPa. The fatty acid composition and antioxidant activity of the extracted oil was also investigated. The highest yield of oil (29.2 ± 0.6% was obtained under optimal SC-CO2 extraction conditions (45 °C, 89.7 min and 32 MPa, respectively, which was significantly higher (p < 0.05 than that (25.3 ± 1.0% given by Soxhlet extraction. Meanwhile, tea seed oil extracted by SC-CO2 contained approximately 80% unsaturated fatty acids and showed a much stronger scavenging ability on the DPPH radical than that extracted by Soxhlet. SC-CO2 is a promising alternative for efficient extraction of edible oil from tea seed. Moreover, tea seed oil extracted by SC-CO2 is highly edible and has good antioxidant activity, and therefore may play a potential role as a health-promoting food resource in human diets.

  10. Kioo cha Lugha

    African Journals Online (AJOL)

    for Researchers · for Journals · for Authors · for Policy Makers · about Open Access · Journal Quality. 521 African Journals. Browse By Category · Browse Alphabetically · Browse By Country · List All Titles · Free To Read Titles This Journal is Open Access. Featuring journals from 32 Countries: Algeria (5); Benin (2); Botswana ...

  11. Kioo cha Lugha: Submissions

    African Journals Online (AJOL)

    AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING AJOL ... Submissions should be made in soft or hard copy, by either sending two hard copies to IKS mailing address or sending soft copy to iks@udsm.ac.tz or ...

  12. Antimicrobial activity of Calendula officinalis, Camellia sinensis and chlorhexidine against the adherence of microorganisms to sutures after extraction of unerupted third molars

    Directory of Open Access Journals (Sweden)

    Raquel Lourdes Faria

    2011-10-01

    Full Text Available OBJECTIVE: The objective of this study was to compare the antimicrobial effect of mouthwashes containing Calendula officinalis L., Camellia sinensis (L. Kuntze and 0.12% chlorhexidine digluconate on the adherence of microorganisms to suture materials after extraction of unerupted third molars. MATERIAL AND METHODS: Eighteen patients with unerupted maxillary third molars indicated for extraction were selected (n=6 per mouthwash. First, the patients were subjected to extraction of the left tooth and instructed not to use any type of antiseptic solution at the site of surgery (control group. After 15 days, the right tooth was extracted and the patients were instructed to use the Calendula officinalis, Camellia sinensis or chlorhexidine mouthwash during 1 week (experimental group. For each surgery, the sutures were removed on postoperative day 7 and placed in sterile phosphate-buffered saline. Next, serial dilutions were prepared and seeded onto different culture media for the growth of the following microorganisms: blood agar for total microorganism growth; Mitis Salivarius bacitracin sucrose agar for mutans group streptococci; mannitol agar for Staphylococcus spp.; MacConkey agar for enterobacteria and Pseudomonas spp., and Sabouraud dextrose agar containing chloramphenicol for Candida spp. The plates were incubated during 24-48 h at 37ºC for microorganism count (CFU/mL. RESULTS: The three mouthwashes tested reduced the number of microorganisms adhered to the sutures compared to the control group. However, significant differences between the control and experimental groups were only observed for the mouthwash containing 0.12% chlorhexidine digluconate. CONCLUSIONS: Calendula officinalis L. and Camellia sinensis (L. Kuntze presented antimicrobial activity against the adherence of microorganisms to sutures but were not as efficient as chlorhexidine digluconate.

  13. Identification of epigallocatechin-3-O-(3-O-methyl)-gallate (EGCG3''Me) and amino acid profiles in various tea (Camellia sinensis L.) cultivars.

    Science.gov (United States)

    Ji, Hyang-Gi; Lee, Yeong-Ran; Lee, Min-Seuk; Hwang, Kyeng Hwan; Kim, Eun-Hee; Park, Jun Seong; Hong, Young-Shick

    2017-10-01

    This article includes experimental data on the identification of epigallocatechin-3-O-(3-O-methyl)-gallate (EGCG3''Me) by 2-dimensional (2D) proton ( 1 H) NMR analysis and on the information of amino acid and catechin compound profiles by HPLC analysis in leaf extracts of various tea cultivars. These data are related to the research article " Metabolic phenotyping of various tea (Camellia sinensis L.) cultivars and understanding of their intrinsic metabolism " (Ji et al., 2017) [1]. The assignment for EGCG3x''Me by 1 H NMR analysis was also confirmed with spiking experiment of its pure chemical.

  14. Camellianols A-G, Barrigenol-like Triterpenoids with PTP1B Inhibitory Effects from the Endangered Ornamental Plant Camellia crapnelliana.

    Science.gov (United States)

    Xiong, Juan; Wan, Jiang; Ding, Jie; Wang, Pei-Pei; Ma, Guang-Lei; Li, Jia; Hu, Jin-Feng

    2017-11-22

    Seven new naturally occurring barrigenol-like compounds, camellianols A-G (1-7), and 10 known triterpenoids were isolated from the twigs and leaves of the cultivated endangered ornamental plant Camellia crapnelliana. According to the ECD octant rule for saturated cyclohexanones, the absolute configurations of camellianols D (4) and E (5) were defined. The backbones of the remaining new isolates are assumed to have the same absolute configuration as compounds 4, 5, and harpullone (12). Compounds 2, 3, 9, 10, 13, and 16 exhibited inhibitory effects on the protein tyrosine phosphatase 1B (PTP1B) enzyme, with IC 50 values less than 10 μM.

  15. Verde plant bug, Creontiades signatus (Hemiptera: Miridae) effects of insect density and bloom period of infestation on cotton damage and yield

    Science.gov (United States)

    The verde plant bug, Creontiades signatus Distant (Hemiptera: Miridae), has emerged as a threat to cotton in South Texas, causing boll damage similar to boll-feeding stink bugs (Hemiptera: Pentatomidae). Verde plant bugs were released into caged cotton for a one-week period to characterize the effec...

  16. Do riparian plant community characteristics differ between Tamarix (L.) invaded and non-invaded sites on the upper Verde River, Arizona?

    Science.gov (United States)

    Tyler D. Johnson; Thomas E. Kolb; Alvin L. Medina

    2009-01-01

    Invasion by Tamarix (L.) can severely alter riparian areas of the western U.S., which are globally rare ecosystems. The upper Verde River, Arizona, is a relatively free-flowing river and has abundant native riparian vegetation. Tamarix is present on the upper Verde but is a minor component of the vegetation (8% of stems). This...

  17. Popular conceptions of schizophrenia in Cape Verde, Africa Concepções populares da esquizofrenia em Cabo Verde, África

    Directory of Open Access Journals (Sweden)

    Mário Dinis Mateus

    2005-06-01

    Full Text Available INTRODUCTION: It has been well documented that schizophrenia presents a better clinical course in developing countries. Although there are many epidemiological studies showing this association, little research has been conducted to investigate the local representation systems for schizophrenia in these countries. OBJECTIVES: This study focuses on cultural factors of schizophrenia, namely the local representation systems for the disease, as well as what is locally understood as deviant behavior and its acceptability, and mechanisms of social-cultural insertion or exclusion of patients with schizophrenia in Cape Verde, Africa. METHODS: Randomized open interviews were carried out with the relatives of patients under treatment at the mental health out patient service of the Batista de Sousa Hospital (São Vicente Island between the years 1994 and 1995. Interviews dealt with patients' life histories and disease related to problems, strategies employed by the family to cope with such problems, and comments on the social and family burden. RESULTS: 20 interviews with close relatives of 10 patients were analyzed. The study focused on three main categories explaining schizophrenia: "tired head" (cabeça cansada, "nervous" (nervoso, and supernatural categories (like "sorcery" or "witchcraft". The interviewees expressed their opinions, either explicitly or not, on whether their relatives truly had a disease. CONCLUSION: Characteristics of local categories for schizophrenia found in Cape Verde can be regarded as a less stigmatized way of dealing with the disease. It is reasonable to suppose that the understanding of such cultural factors could lead to better outcomes in the treatment for schizophrenia in this country, and also in others, where similar conditions can be identified.INTRODUÇÃO: Tem sido bem documentado que a esquizofrenia apresenta um melhor curso clínico em países em desenvolvimento. Ainda que haja muitos estudos epidemiol

  18. Cabo Verde, «Pousada» nos Caminhos do Atlântico. Interinfluências culturais num arquipélago miscigenado / Cape Verde, the «Pousada» of the Atlantico routes - cultural interinfluences in an interbred archipelago

    Directory of Open Access Journals (Sweden)

    José Silva Évora

    2014-12-01

    Full Text Available Descoberto entre 1460 e 1462, o Arquipélago de Cabo Verde, situado no Oceano Atlântico, constituiu ao longo de vários séculos, escala obrigatória dos navios que faziam as ligações atlânticas entre os portos das Américas, da Europa e da África Graças a sua situação privilegiada, o espaço cabo-verdiano não foi um mero ponto de reabastecimento, mas também um importante ponto de cruzamento de culturas e de raças. Pretende-se, neste texto, abordar o papel que Cabo Verde teve no Atlântico incidindo, particularmente, na dimensão cultural resultante do contacto entre povos e culturas provenientes de diferentes paragens que se fixaram no arquipélago ou que por aqui passaram. Procurar-se-á evidenciar não só a importância que Cabo Verde teve enquanto ponto de passagem obrigatória mas, sobretudo, as contribuições que mais marcadamente se denunciaram, isto é, os apports culturais que mais se acentuaram em Cabo Verde, como processos recebidos dos estrangeiros que por estas ilhas se cruzaram.The Archipelago of Cape Verde, discovered between 1460 and 1462, and situated in the Atlantic Ocean, had been considered for centuries one of the mandatory harbours of the ships that sailed across the Atlantic to the ports of America, Europe and Africa. Because of its strategic location, Cape Verdean anchorage was considered not only the supplying point, but also an important melting pot of races and cultures. It is intended to highlight the role of Cape Verde in the Atlantic focusing particularly on the cultural aspect, as a result of the influence of cultures and origins of people who had settled in or had passed by the archipelago. It is also aimed to underline the importance of Cape Verde as a mandatory gateway but, above all, to underline the remarkable contributions, such as the cultural “apports” by which Cape Verde were gripped, like processes brought by the foreigners who crossed these islands.

  19. Negative sequence relay applied to generator 1 of the Laguna Verde nuclear power plant; Aplicacion de un relevador de secuencia negativa en el generador 1 de la central de Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Diaz de la Serna P, Enrique [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1988-12-31

    The rotor of a synchronous generator can be dangerously heated in a short time by stator current unbalance, therefore it must be protected with a specific relay. This article discusses the protection and the adjustments selected for Unit 1 of the Comision Federal de Electricidad Laguna Verde Nuclear Nuclear Power Station. [Espanol] El rotor de un generador sincrono puede calentarse peligrosamente en un tiempo corto debido a desbalance de corrientes en el estator, por lo que debe protegerse con un relevador especifico. En este articulo se describen la proteccion y los ajustes seleccionados para la unidad 1, de la central nucleoelectrica Laguna Verde de la Comision Federal de Electricidad.

  20. Groundwater resources of Ribeira Paúl basin, island of Santo Antão, Cape Verde, West Africa

    Science.gov (United States)

    Heilweil, Victor M.; Gingerich, Stephen B.; Verstraeten, Ingrid M.

    2010-01-01

    Groundwater resources in Cape Verde provide water for agriculture, industry, and human consumption. These resources are limited and susceptible to contamination. Additional groundwater resources are needed for continued agricultural development, particularly during times of drought, but increased use and (or) climatic change may have adverse effects on the quantity and quality of freshwater available. In volcanic island aquifers such as those of Cape Verde, a lens of fresh groundwater typically ?floats? upon a layer of brackish water at the freshwater/saltwater boundary, and increased pumping may cause salt water intrusion or other contamination. A recent U.S. Geological Survey study assessed baseline groundwater conditions in watersheds on three islands of Cape Verde to provide the scientific basis for sustainably developing water resources and minimizing future groundwater depletion and contamination.

  1. Groundwater resources of Ribeira Fajã basin, island of São Nicolau, Cape Verde, West Africa

    Science.gov (United States)

    Heilweil, Victor M.; Gingerich, Stephen B.; Plummer, Niel; Verstraeten, Ingrid M.

    2010-01-01

    Groundwater resources in Cape Verde provide water for agriculture, industry, and human consumption. These resources are limited and susceptible to contamination. Additional groundwater resources are needed for continued agricultural development, particularly during times of drought, but increased use and (or) climatic change may have adverse effects on the quantity and quality of freshwater available. In volcanic island aquifers such as those of Cape Verde, a lens of fresh groundwater typically ?floats? upon a layer of brackish water at the freshwater/saltwater boundary, and increased pumping may cause salt water intrusion or other contamination. A recent U.S. Geological Survey study assessed baseline groundwater conditions in watersheds on three islands of Cape Verde to provide the scientific basis for sustainably developing water resources and minimizing future groundwater depletion and contamination.

  2. Electrical Systems at Laguna Verde Nuclear Power Plant (LVNPP) after the Fukushima accident

    International Nuclear Information System (INIS)

    Lopez Jimenez, Jose Francisco

    2015-01-01

    During the accident occurred in Fukushima Daiichi Nuclear Power Station in Japan, the onsite and offsite electrical systems were affected and lost for a long time with irreversible consequences, therefore, the Mexican Regulatory Body known as the National Commission for Nuclear Safety and Safeguards (CNSNS: for its acronym in Spanish) has taken several actions to review the current capacity of the electrical systems installed at Laguna Verde NPP to cope with an event beyond of the design basis. The first action was to require to Laguna Verde NPP the compliance with Information Notice 2011-05 'Tohoku-Taiheiyou-Oki earthquake effects on Japanese Nuclear Power Plants' and with 10 CFR 50.54 'Conditions of licenses' section 'hh', both documents were issued by the United States Nuclear Regulatory Commission (USNRC). Additionally, CNSNS has taken into account the response actions emitted by other countries after the Fukushima accident. This involved the review of documents generated by Germany, Canada, United Arab Emirates, Finland, France, the United Kingdom and the Western European Nuclear Regulator's Association (WENRA). CNSNS made special inspections to verify the current capacity of the electrical systems of AC and DC. As a result of these inspections, CNSNS issued requirements that must be addressed by Laguna Verde NPP to demonstrate that it has the capacity to cope with events beyond the design basis. Parallel to the above, Mexico has participated in the Ibero-american Forum to address matters related to the 'Resistance Tests', the evaluations of the Forum have reached similar conclusions to those required by European Nuclear Safety Regulators Group (ENSREG), under the format proposed by WENRA. The actions carried out here are closely linked to the requirements established by the USNRC. It is also important to mention that: 1) the Extended Power Up-rate project was implemented in both Units of the Laguna Verde NPP before

  3. 30 years in the Veracruz state coast landscape: Laguna Verde nuclear power station. 1. ed.; 30 anos de paisaje costero veracruzano: Central Nucleoelectrica Laguan Verde

    Energy Technology Data Exchange (ETDEWEB)

    Guevara, S; Moreno Casasola, P; Castillo Campos, G; Dorantes, C; Gonzalez Garcia, F; Halffter, G; Isunza, E; Lot H, A; Mendoza, R; Paradowska, K; Priego, A; Sanchez Vigil, C; Vazquez, G [Comision Federal de Electricidad and Instituto Nacional de Ecologia A.C. (Mexico)

    2008-07-01

    36 years ago one of the most important power projects of Mexico was born; the design and construction of the Nuclear power station Laguna Verde. This project became reality thanks to the commitment of a group of Mexican professionals that gave the best of them for its accomplishment. At that time, there was not in Mexico a legislation that contemplated the environmental protection; nevertheless, the Mexican Constitution anticipates that when in the country there is not legislation for the development of a project, this must adopt the legislation of the country that is selling it. In the specific case of Laguna Verde, the legislation of the United States of America was adopted and in the environmental part it had to issue the first Manifest of Environmental impact, that was called Informe Ambiental para la Contruccion de Laguna Verde en el Estado de Veracruz. This study was performed by several national as well as foreign institutions. Among the most outstanding are the Universidad Nacional Autonoma de Mexico, the Intituto Politecnico Nacional, the Universidad Veracruzana, the Intituto National para la Investigacion de Recursos Biologicos, the Instituto de Ecologia, A.C. With this report, the engineers undertook the task of designing and constructing, the biologists and ecologists to realize the studies to mitigate the effects caused to the environment during the construction and later, during the operation of the Nuclear power station. After 18 years of commercial operation of the power station the present book is completed, in which the results obtained in 1972, when the studies of the environmental report began are compared against the ones obtained throughout this period. It is important to see in the results of the different studies and indicators presented/displayed in this book, that the important changes on the environment are due, to the change of the ground use and the over-exploitation of the natural resources as it happens in almost all the country. The

  4. IDEOLOGIA VERDE E O COMPORTAMENTO DO CONSUMIDOR TECNOLÓGICO: PREFERÊNCIA DE USO E JUSTIFICAÇÃO

    Directory of Open Access Journals (Sweden)

    Marina Lemos Barboza

    2014-04-01

    Full Text Available O presente artigo objetiva analisar o comportamento de consumo tecnológico, dado a justificação do valor verde integrado em dispositivos eletrônicos, do tipo smartphones e tablets. Com isto, foi realizado um estudo baseado na literatura de comportamento do consumidor, produtos verdes, ideologia verde, convergência tecnológica e preferência de uso por produtos tecnológicos, utilizando de pesquisa netnográfica como opção metodológica, a qual consiste da extração de informações de blogs/fóruns de discussões, realizando uma análise de conteúdo para as discussões coletadas, de forma a codificar e categorizar os grupos participantes deste argumento. Para complementar questionamentos que ficaram em abertos após a netnografia, foram feitas entrevistas com nove consumidores específicos por suas características de consumo, de forma a melhor compreender como fatores de marketing influenciam nestas decisões. Neste contexto, este estudo teve como resultado cinco categorias de consumidores identificados, com subcategorias implícitas. Este estudo observa e interpreta o ponto de vista do consumidor tecnológico, avaliando se a difusão dos produtos verdes (consumo sustentável ou com valores/atributos ecológicos, inseriu-se no contexto da sociedade atual, e se a discussão desta realidade mercadológica, apresenta consigo a inovação da consciência ecológica (verde, além da percepção de inovação tecnológica com a inserção do verde.

  5. Fibra da casca do coco verde como substrato agrícola

    Directory of Open Access Journals (Sweden)

    Carrijo Osmar Alves

    2002-01-01

    Full Text Available A produção comercial de mudas e o cultivo sem solo de hortaliças estão se tornando práticas comuns entre os olericultores. Vários materiais orgânicos como as turfas, resíduos de madeira, casca de pinus e de arroz parcialmente carbonizada ou não, ou materiais inorgânicos como areia, rochas vulcânicas, perlita, lã de rocha e a espuma fenólica já são utilizados como substratos, isoladamente ou em composição. A casca de coco verde que em muitas regiões causa transtorno ao serviço de limpeza pública pelo volume e pela dificuldade de decomposição produz uma fibra que pode ser utilizada como substrato. Para a produção da fibra, a casca de coco verde é picada, desfibrada, triturada, lavada e secada. Para o uso como substrato na produção de mudas, a fibra deve passar por um processo de compostagem. Este processo não é necessário para o uso como substrato em cultivo sem solo, mas no entanto, o substrato necessitará ser enriquecido com nutrientes em pré-plantio ou em fertirrigação. O uso do substrato da fibra de coco verde na produção de tomate em casa de vegetação, alcançou, em termos absolutos, 13,2 kg m-2 de frutos comerciais (média de 3 anos cerca de 7,3% mais que o segundo melhor substrato, o pó de serra com 12,3 kg m-2.

  6. MARKETING VERDE COMO PROPENSA VANTAGEM COMPETITIVA SUSTENTÁVEL DE UMA ORGANIZAÇÃO

    Directory of Open Access Journals (Sweden)

    Cleber Vasconcelos Moreira

    2016-01-01

    Full Text Available O crescimento da preocupação com as consequências ambientais diante do consumo desenfreado tem levantado à questão da necessidade de um consumo consciente. Diante disso, um novo segmento de mercado tem sido encontrado, sendo denominados consumidores ecologicamente conscientes ou consumidores Verdes. Neste novo cenário valoriza-se a flexibilidade, a velocidade nos processos de mudanças e inovação, as competências em utilizar recursos escassos, além da sensibilidade de perceber novas tendências de mercado à frente dos concorrentes e a capacidade de elaborar e fomentar ofertas em função das antecipações dos desejos e necessidades dos clientes. A dificuldade de previsão tornou-se ponto chave. É neste momento que se observa a relevância na valorização das preocupações de caráter ambiental como recursos na obtenção de vantagem competitiva. Essas duas nuancem Vantagem Competitiva e Marketing Verde levaram a este estudo. Deste modo, foi realizado um estudo multicaso com duas empresas do setor industrial localizadas no Espirito Santo. Os resultados comprovaram que as empresas, mesmo a que investe em meio ambiente, não o faz de forma estratégica. Ainda não há uma ampla utilização do tema como fonte recurso para ser um diferencial frente ao concorrente. Ou seja, as empresas analisadas ainda não entendem o Marketing Verde como vantagem competitiva.

  7. Internal event analysis for Laguna Verde Unit 1 Nuclear Power Plant. Accident sequence quantification and results

    International Nuclear Information System (INIS)

    Huerta B, A.; Aguilar T, O.; Nunez C, A.; Lopez M, R.

    1994-01-01

    The Level 1 results of Laguna Verde Nuclear Power Plant PRA are presented in the I nternal Event Analysis for Laguna Verde Unit 1 Nuclear Power Plant, CNSNS-TR 004, in five volumes. The reports are organized as follows: CNSNS-TR 004 Volume 1: Introduction and Methodology. CNSNS-TR4 Volume 2: Initiating Event and Accident Sequences. CNSNS-TR 004 Volume 3: System Analysis. CNSNS-TR 004 Volume 4: Accident Sequence Quantification and Results. CNSNS-TR 005 Volume 5: Appendices A, B and C. This volume presents the development of the dependent failure analysis, the treatment of the support system dependencies, the identification of the shared-components dependencies, and the treatment of the common cause failure. It is also presented the identification of the main human actions considered along with the possible recovery actions included. The development of the data base and the assumptions and limitations in the data base are also described in this volume. The accident sequences quantification process and the resolution of the core vulnerable sequences are presented. In this volume, the source and treatment of uncertainties associated with failure rates, component unavailabilities, initiating event frequencies, and human error probabilities are also presented. Finally, the main results and conclusions for the Internal Event Analysis for Laguna Verde Nuclear Power Plant are presented. The total core damage frequency calculated is 9.03x 10-5 per year for internal events. The most dominant accident sequences found are the transients involving the loss of offsite power, the station blackout accidents, and the anticipated transients without SCRAM (ATWS). (Author)

  8. Legitimacy and Innovation in Mining: the case of the Oro Verde Program

    Directory of Open Access Journals (Sweden)

    Mariana Sarmiento

    2013-11-01

    Full Text Available The paper describes how the Oro Verde Program emerged, and how it has gained recognition as an innovative program that has successfully promoted improved social and environmental practices for small scale miners. The paper describes the local and regional context where the miners from Oro Verde are from, and attempts to explain how it waspossible for two afro-colombian communities, two NGOs and a government agency to find alternative arrangements to overcome the challenges that result from the complexities of the Choco region in Colombia. The paper argues that one factor of success is the interaction among participants to create a Non-State Market Driven Governance System. In the case of the Oro Verde Program, the norms created by the international system surrounding sustainable development were necessary for allowing the NGOs to bring financial resources into the project as well as opening the doors to isolated communities in Choco to an international market that valued sustainably produced products. Similarly, the national policies surrounding Green Markets and the existence of a government research institution, made the certification process possible and legitimate. Finally, having a law that recognized land rights to afro-Colombian communities and the community councils as local authorities, as well as customary laws about natural resource use and access within these territories was key for the viability of the project. All of these organizations, working as a nested governance system, that respected and embraced different but interdependent norms and interests, were key for the consolidation of a NSMD that has resonated throughout the world and that has become an element of some afro-Colombians’ struggle to protect their rights for self-determination.

  9. Participation of the ININ in the external radiological emergency plan of the Laguna Verde power plant

    International Nuclear Information System (INIS)

    Martinez S, R.; Cervini L, A.

    1991-01-01

    The planning of performances in radiological emergencies, with the object of reducing the consequences as much as possible on the population to accidental liberations of radioactive material coming from Nuclear power plant, it has been of main interest in the nuclear community in the world. In Mexico it has not been the exception, since with the setting in march of the Laguna Verde nuclear power plant exists an executive program of planning for emergencies that it outlines the activities to follow trending to mitigate the consequences that are derived of this emergency. As integral part of this program this the External Plan of Radiological Emergency (PERE) that covers the emergencies that could leave the frontiers of the Laguna Verde power plant. In the PERE it settles down the planning, address and control of the preparation activities, response and recovery in emergencies, as well as the organization and coordination of the institutions that participate. The National Institute of Nuclear Research (ININ), like integral part of these institutions in the PERE, has an infrastructure that it allows to participate in the plan in a direct way in the activities of 'Control of the radiological exhibition the response personnel and control of water and foods' and of support way and consultant ship in the activities of 'Monitoring, Classification and decontamination of having evaluated' and 'Specialized medical radiological attention'. At the moment the ININ has a radiological mobile unit and this conditioning a second mobile unit to carry out part of the activities before mentioned; also accounts with 48 properly qualified people that directly intervene in the plan. In order to guarantee an adequate response in the PERE an organization it has been structured like that of the annex as for the personnel, transport, team, procedures and communication system, with the objective always of guaranteeing the security and the population's health in emergency situations in the

  10. Palos Verdes Shelf oceanographic study; data report for observations December 2007–April 2008

    Science.gov (United States)

    Rosenberger, Kurt J.; Noble, Marlene A.; Sherwood, Christopher R.; Martini, Marinna M.; Ferreira, Joanne T.; Montgomery, Ellyn T.

    2011-01-01

    Beginning in 1997, the Environmental Protection Agency (EPA) defined a contaminated section of the Palos Verdes Shelf region in southern California as a Superfund Site, initiating a continuing investigation of this area. The investigation involved the EPA, the U.S. Geological Survey (USGS), Science Applications International Corporation (SAIC), Los Angeles County Sanitation Districts (LACSD) data, and other allied agencies. In mid-2007, the Palos Verdes Shelf project team identified the need for additional data on the sediment properties and oceanographic conditions at the Palos Verdes Superfund Site and deployed seven bottom platforms, three subsurface moorings, and three surface moorings on the shelf. This additional data was needed to support ongoing modeling and feasibility studies and to improve our ability to model the fate of the effluent-affected deposit over time. It provided more detail on the spatial variability and magnitude of resuspension of the deposit during multiple storms that are expected to transit the region during a winter season. The operation began in early December 2007 and ended in early April 2008. The goal was to measure the sediment response (threshold of resuspension, suspended-sediment concentrations, and suspended-sediment transport rates) to bed stresses associated with waves and currents. Other objectives included determining the structure of the bottom boundary layer (BBL) relating nearbed currents with those measured at 10 m above bottom (mab) and comparing those with the long-term data from the LACSD Acoustic Doppler Current Profiler (ADCP) deployments for nearbed current speed and direction. Low-profile tripods with high-frequency ADCPs co-located with two of the large tripods were selected for this goal. This report describes the data obtained during the field program, the instruments and data-processing procedures used, and the archive that contains the data sets that have passed our quality-assurance procedures.

  11. O chá verde e suas ações como quimioprotetor

    OpenAIRE

    Wanderlei Schmitz; Alexandre Yukio Saito; Dirceu Estevão; Halha Ostrensky Saridakis

    2005-01-01

    O chá preto é responsável por 75% do chá consumido no mundo e o chá verde, por apenas 22%. O chá que era consumido como medicamento, passou a ser do gosto popular devido as suas característica organolépticas. Seus componentes flavonóides e catequinas apresentam uma série de atividades biológicas, antioxidante, quimioprotetora, antiinflamatória e anticarcinogênica. Vários estudos vêm sendo desenvolvidos por pesquisadores em varias regiões do mundo para comprovar estas atividades terapêuticas, ...

  12. Quality assurance evolution at Laguna Verde Nuclear Power Plant Unit 1 and 2, regulatory aspects

    International Nuclear Information System (INIS)

    Leon Martinez, Cenobia

    1996-01-01

    Quality Assurance (QA) in Mexico started with the construction of the Laguna Verde Nuclear Power Plant. The Nuclear Regulatory Body, based in the adopted regulation, required the use of Quality Assurance in the design, construction and operation of the Plant. This paper describes the evolution of QA from its beginnings, through its developing phase up to this time, and shows the role of the Regulatory Body, which has participated actively in the implantation of QA in a properly manner, enforcing the utility in avoiding deviations and non-compliancies with the established regulation. (author)

  13. ENOTURISMO Y DESARROLLO ECONÓMICO. UN ESTUDIO DE CASO EN CABO VERDE (ÁFRICA)

    OpenAIRE

    Ana Mª Castillo Canalejo; Tomás López Guzmán

    2011-01-01

    El turismo del vino se está desarrollando significativamente en algunas regiones vitivinícolas del mundo satisfaciendo una demanda de viajeros que buscan unos destinos que supongan la experimentación de nuevas sensaciones que tengan que ver con la cultura local. En esta línea, el objetivo de este artículo es explorar las posibilidades del enoturismo en la isla de Fogo (Cabo Verde). Para alcanzar dicho objetivo se analizan los principales recursos turísticos de esta zona para fomentar este tip...

  14. Macroinvertebrados bentónicos del humedal de Palo Verde, Costa Rica

    Directory of Open Access Journals (Sweden)

    F.A Trama

    2009-11-01

    Full Text Available El humedal de Palo Verde es uno de los más importantes de Centro America para aves acuáticas. Durante el período 2002 y 2005, se llevaron a cabo actividades de manejo para controlar la invasión de Typha domingensis. Con el fin de establecer una línea base para monitoreos futuros, en el 2003 se realizó una evaluación de macroinvertebrados acuáticos. Se efectuó un muestreo mensual durante un año, usando el método de sustratos artificiales. Se identificaron 116 táxones pertenecientes a 47 familias y a 18 órdenes. La mayor abundancia se encontró en la clase Conchostraca y la familia Chironomidae que juntas representaron casi la mitad de todos los individuos colectados. En contraste, el 97% de los táxones tuvieron, cada uno, menos del 1% del total de la abundancia. La diversidad de táxones, así como la abundancia de individuos y el número de especies, fueron mayores en la época seca que en la lluviosa. La curva acumulada de especies indicó que se hubiera registrado una mayor cantidad de táxones si los muestreos se hubieran extendido por más tiempo. Con este trabajo damos a conocer la primera lista de macroinvertebrados para el humedal de Palo Verde.Benthic macroinvertebrates of the Palo Verde wetland, Costa Rica. Palo Verde, Costa Rica, is one of the most important wetlands in the region now recovering from some invasive plants, especially Typha domingensis, and monitoring programs were started, including studies on the aquatic macoinvertebrate fauna. We sampled benthic macroinvertebrates monthly for more than a year with artificial substrates, and identified 116 taxa from 57 families and 18 orders, with 90 morfospecies of insects. The highest abundances were in the class Conchostraca (typical in seasonal wetlands and in the family Chironomidae (Diptera, Insecta, which together represent almost half of all individuals collected. In contrast, 97 taxa were less than 1% of total abundance each. Number of individuals and number of

  15. Homogalactanas sulfatadas da macroalga verde Codium isthmocladum: aspectos estruturais e farmacológicos

    OpenAIRE

    Farias, Eduardo Henrique Cunha de [UNIFESP

    2011-01-01

    Galactanas e o termo utilizado para designar polissacarideos que contem galactose. Homogalactanas sulfatadas, SG 1 e SG 2, foram extraidas de macroalga marinha verde Codium isthmocladum apos proteolise, fracionamento por acetona a frio e cromatografia de troca-ionica. A massa molecular foi determinada por cromatografia de gel-filtracao em HPLC e deteccao por indice de refracao e UV, sendo que SG 1 apresenta massa molecular media ao redor de 12 kDa e SG 2 de 15,0 kDa. Analises estruturais empr...

  16. Current situation of spent fuel management in the Laguna Verde Nuclear Power Plant, Veracruz, Mexico

    International Nuclear Information System (INIS)

    Moreno, C.V.

    1994-01-01

    The Comision Federal de Electricidad (CFE), owner and operator of the Laguna Verde nuclear power plant (2 x 654 MWe BWR), has twice decided to increase the storage capacity of the spent fuel pools of the reactors. The Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS), the national nuclear regulatory authority, approved the increase by a factor of 2.66 in the storage capacity proposal by CFE in 1989. Each reactor spent fuel pool can now hold 614 t HM. The reracking was done at a cost of about US $13 per kg U, which will add only 0.042 mills per kWh to the fuel cycle cost. (author)

  17. Remote handling and robotic inspections of Palo Verde reactor vessel internals

    International Nuclear Information System (INIS)

    Ryder, W.

    1998-01-01

    Remote visual examinations and handling evolutions in high radiation field environments have required the use of radiation tolerant video systems. These systems involve significant expense and potentially require large envelope deployment structures. Recent events at Palo Verde including Upper Guide Structure damage and Reactor Vessel In-Service Inspections have provided opportunities for research, design and utilization of alternative approaches. Most significant of these, utilization of CCD modules with high magnification capabilities, have produced higher quality viewing, reduced maintenance expenditures, and rapid deployment intervals. (orig.) [de

  18. Propuesta de mejoramiento tecnológico de techos verdes para el clima tropical andino

    Directory of Open Access Journals (Sweden)

    Alejandro Gómez Cubillos

    2018-01-01

    Full Text Available La gestión de riesgos por el aumento de la escorrentía superficial en zonas urbanas requiere intervención desde múltiples enfoques, ambientales, sanitarios, sociales y económicas. La infraestructura verde aporta soluciones de creciente interés por sus beneficios ambientales y potencial aprovechamiento económico. Este artículo propone un mejoramiento tecnológi-co para la adaptación de los techos verdes al clima tropical andino, en términos de su com-portamiento hidrológico, para lo cual se desarrolló un montaje experimental con seis módu-los de techos verdes extensivos y un módulo testigo (solo cubierta. El montaje experimental permitió la obtención de datos de 21 eventos de precipitación, modificando la configuración de dos factores experimentales, tipo de planta con seis variaciones y altura de sustrato con tres variaciones y tres eventos más para verificar el efecto de la variación de la pendiente de la cubierta, como tercer factor. Los datos obtenidos se procesaron para el cálculo de las va-riables hidrológicas de interés (precipitación, escorrentía, duración del evento, tiempo ante-rior seco, que expresan las características del evento y los indicadores del comportamiento hidrológico (coeficientes de escorrentía basado en volumen Cv y en el caudal pico Cp y tiem-po de retraso K y su análisis estadístico permitió identificar cuáles factores experimentales tienen o no influencia significativa en dichos indicadores. Finalmente, se desarrollaron herramientas para la simulación de variables e indicadores hidrológicos a partir de series de precipitación externas y su implementación en una herramienta de diseño que seleccione las configuraciones de techos verdes que presenten el mejor comportamiento hidrológico.

  19. Participation of the research institutes in the safety aspects of the Laguna Verde nuclear power plant

    International Nuclear Information System (INIS)

    Sanchez G, J.

    1991-01-01

    The main activities undertaken by two research institutes of Mexico, the Instituto de Investigaciones Electricas and the Instituto Nacional de Investigaciones Nucleares, related to the safety of the Laguna Verde Nuclear Power Plant, are described. Among these activities, the development of a system for data acquisition and analysis during pre-operational tests, the design and construction of a full-scope simulator, the in-core fuel management and the establishment of an equipment qualification laboratory, stand out. It is considered that there exists a large potential for further participation. (author)

  20. Produção e estado nutricional do milho em cultivo intercalar com adubos verdes

    Directory of Open Access Journals (Sweden)

    R. Heinrichs

    2002-03-01

    Full Text Available A utilização da adubação verde para estabelecer a diversidade e o equilíbrio do sistema de produção é um dos paradigmas da agricultura moderna. Com o objetivo de avaliar a produção e o estado nutricional da cultura de milho sob cultivo intercalar com adubos verdes, foi realizado, entre 1995 e 1997, um experimento em campo, em Piracicaba (SP, em um Litossolo Vermelho eutrófico. O milho foi semeado no espaçamento de 0,90m nas entrelinhas, perfazendo aproximadamente 50.000plantas por hectare. Os tratamentos constaram de uma testemunha, sem cultivo intercalar, e quatro espécies de adubos verdes: mucuna anã (Mucuna deeringiana (Bort. Merr, guandu anão (Cajanus cajan (L. Millsp, crotalária (Crotalaria spectabilis Roth e feijão-de-porco (Canavalia ensiformis (L. DC., semeados sem adubação, no meio da entrelinha, distante 45cm da linha do milho, em duas épocas: simultânea à semeadura do milho e 30dias após. O solo, no primeiro ano, foi preparado sob sistema convencional e, no segundo, cultivaram-se as culturas sob semeadura direta. O delineamento experimental foi de blocos ao acaso com parcelas subdivididas e quatro repetições. O estado nutricional e a produção de grãos do milho apresentaram melhores resultados no cultivo consorciado com feijão-de-porco. Os efeitos positivos desta espécie na produtividade de grãos de milho foram mais acentuados no segundo ano de adoção do cultivo consorciado, quando o sistema de manejo do solo foi semeadura direta. A semeadura dos adubos verdes simultânea ao milho foi o manejo mais recomendável, por não prejudicar o desenvolvimento do milho e reduzir a operação pós-plantio.