WorldWideScience

Sample records for cfe para cogeneracion

  1. Feasibility of the operation CFE`s conventional power plants for industrial cogeneration; Factibilidad de operar las centrales termoelectricas convencionales de la CFE para cogeneracion industrial

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, Eduardo H.; Acosta Torres, Rosa Aracely [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    An analysis is made on how cogeneration could help to maximize the power plant performance since thanks to cogeneration this type of power plants could utilize a part of the waste energy to be supplied to other processes. Also mention is made of the utilization of computer programs to help the design and the realization of functioning tests of this type of power plants. An economic evaluation is presented on the feasibility of operating this type of power plants as cogeneration units and it is concluded that the operation of fossil power plants in the cogeneration mode is not affected by the site where the power plant is located [Espanol] Se analiza como la cogeneracion podria ayudar a maximizar el rendimiento de las centrales termoelectricas ya que gracias a la cogeneracion este tipo de centrales podrian utilizar una parte de la energia desechada para suministrarla a otros procesos. Tambien se menciona la utilizacion de programas de computo para auxiliar en el diseno o realizacion de pruebas de funcionamiento sobre este tipo de plantas. Se presenta una evaluacion economica sobre la factibilidad de operar este tipo de plantas como unidades de cogeneracion y se concluye en que la operacion de centrales termoelectricas en modo de cogeneracion no se ve afectado por el sitio donde se encuentra la central

  2. Co-generation project for the Combined Cycle Power Plant President Juarez Rosarito and a reverse osmosis desalting plant; Proyecto de cogeneracion para la planta de ciclo combinado Presidente Juarez Rosarito y una planta desaladora de osmosis inversa

    Energy Technology Data Exchange (ETDEWEB)

    Beltran Mora, Hector; Espindola Hernandez, Salvador [Universidad NAcional Autonoma de Mexico (UNAM), Mexico, D.F. (Mexico)

    2006-11-15

    cogeneracion: produccion de electricidad y agua. El programa de operacion de la central desaladora estara determinado por la demanda de energia de la central de ciclo combinado; la propuesta es que la planta desaladora opere en las horas de baja carga de la central y pare cuando sean las hora pico de demanda de energia electrica. Para que este estudio sea representativo se han tomado las curvas de demanda de energia de las unidades de ciclo combinado de la Central Presidente Juarez Rosarito de la Comision Federal de Electricidad (CFE) y datos actualizados de las plantas desaladoras de osmosis inversa que estan disponibles actualmente en el mercado. Como base del estudio se determinaran los costos nivelados tanto de la energia electrica generada por la central de ciclo combinado operando dentro y fuera de un esquema de cogeneracion y los costos nivelados para el agua producida por la planta de osmosis inversa bajo dos supuestos: el primero es comprando la energia electrica a CFE y el segundo considerando que la CFE es duena de la planta desaladora y por tanto el costo de energia electrica para desalar es cero. Este trabajo muestra los impactos economicos en los costos de la generacion de energia electrica y en los del agua desalada en un esquema de cogeneracion. Los resultados mostrados en este estudio pueden considerarse para la futura planeacion en la construccion de plantas desaladoras para abastecer de agua en las zona noroeste del pais donde se tienen serios problemas de desabasto.

  3. Economic and environmental impact of the utilization of the industrial potential of viable cogeneration for period 1998 - 2007; Impacto economico y ambiental de aprovechamiento del potencial industrial de cogeneracion viable para el periodo 1998 - 2007

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, Gabriel; Mendoza Gonzslez, Lourdes [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2001-07-01

    The utilization of the industrial potential of cogeneration offers a significant contribution to the construction of the electrical infrastructure that the growth of the country will require for the period 1998 - 2007. The conditions of growth of the co-generation potential and their levels of utilization are related to a on isolated growth of the other inter actors of the processes of power supply; As levels of economic viability, economic savings to industry, requirements of additional electrical capacity, growth of the industrial activity, costs, use of fuels, environmental impact. Rates of average growth for period 1998 - 2007 are considered and what levels of economic and environmental benefit offers this development to the industry, to the electrical company and to the country. And to what proportion can contribute the utilization of the industrial potential of electrical cogeneration to the requirements of additional electrical capacity that will require the development of the country during this period. With the rates of viable growth of the co-generation the equivalent reduction of fuel consumption is estimated for the industrial sector, given by the improvement in the generation efficiency and with the change in the proportion of fuels used in Comision Federal de Electricidad (CFE) for this period. Evaluating the emissions of the main fuels avoided with this growth and its repercussion at national level via the CFE, and showing the possible international implications of this reduction. [Spanish] El aprovechamiento del potencial industrial de cogeneracion ofrece una significativa aportacion a la construccion de la infraestructura electrica que el crecimiento del pais requerira para el periodo 1998 -2007. Las condiciones de crecimiento del potencial de cogeneracion y sus niveles de aprovechamiento estan relacionados con un crecimiento o aislado de los demas inter actores de los procesos de abasto energetico; Como niveles de viabilidad economica, ahorros

  4. Cogeneration Systems; Sistemas de Cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez M, Manuel F; Huante P, Liborio; Romo M, Cesar A [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2006-07-01

    The present article deals on relevant aspects on the subject of cogeneration within the Mexican territorial limits. In the first place it is presented the role of Mexico in terms of its cogeneration potential, the type of service that has obtained from this predominant modality of cogeneration for self-supplying, the most propitious sectors to develop it, its legislations on the matter, the projects made for the implementation of cogeneration plants, as well as the existing cogeneration schemes for its respective optimization proposals. Without leaving out the analysis on the different types of evaluation on the efficiency of cogeneration systems and the aspects to consider for the election of a generation cycle. [Spanish] El presente articulo trata sobre aspectos relevantes en materia de cogeneracion dentro de los limites territoriales de la nacion mexicana. Se muestra en primer lugar el papel de Mexico en terminos de su potencial de cogeneracion, el tipo de servicio que ha obtenido de esta predominantemente (modalidad de cogeneracion para autoabastecimiento), los sectores mas propicios para desarrollarla, sus legislaciones al respecto, los proyectos realizados para la implementacion de plantas de cogeneracion, asi como los esquemas de cogeneracion existentes con sus respectivas propuestas de optimizacion. Sin dejar de lado el analisis sobre los distintos tipos de evaluacion de la eficiencia de sistemas de cogeneracion y los aspectos a considerar para la eleccion de un ciclo de generacion.

  5. System Aprend-e for the management of learning objects of support to the CFE operation; Sistema Aprend-e para la gestion de objetos de aprendizaje de apoyo a la operacion de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Argotte Ramos, Liliana Paz; Rodriguez Ortiz; Guillermo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Paredes Rivera, Jaime Israel [Comision Federal de Electricidad (CFE) (Mexico)

    2009-07-01

    In this article the system Aprend-e is described as an application of the technology of Learning Objects (LO) integrated to the qualification of the Comision Federal de Electricidad (CFE) personnel, company of the electrical sector in Mexico, as well as to promote the self-training based on LO. An introduction to standard SCORM and the proposed additions by the CFE to the goal-data is included. [Spanish] En este articulo se describe el sistema Aprend-e, como una aplicacion de la tecnologia de Objetos de Aprendizaje (OA) integrada a la capacitacion del personal de la Comision Federal de Electricidad (CFE), empresa del sector electrico en Mexico, asi como para promover el autoaprendizaje basado en OA. Se incluye una introduccion al estandar SCORM y las adiciones propuestas por la CFE a los metadatos.

  6. Boehringer Ingelheim Promeco contemplates the benefits of cogeneration in its new plant; Boehringer Ingelheim Promeco contempla beneficios de la cogeneracion para su nueva planta

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Esparza, R. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Khouri Solis, A. [Boehringer Ingelheim Promeco, Mexico, D. F. (Mexico)

    1997-12-31

    This paper presents the results of the feasibility study performed in BOEHRINGER INGELHEIM PROMECO to determine the benefits that a cogeneration system could render in satisfying the energy demand of its plant currently being expanded. The results showed that in accordance with the operation mode of the already expanded plant, the highest benefits could be obtained of a cogeneration system with a capacity of 1,600 Kw that would partially satisfy the thermal and electrical demands of BOEHRINGER INGELHEIM PROMECO. [Espanol] El presente articulo presenta los resultados de factibilidad que se realizo en Boehringer Ingelheim Promeco para determinar los beneficios que podria rendir un sistema de cogeneracion al satisfacer las demandas energeticas de su planta actualmente en ampliacion. Los resultados mostraron que de acuerdo al modo de operacion de la planta ya ampliada, los beneficios mas altos se obtendrian de un sistema de cogeneracion con capacidad de 1,600 kW que satisfaria parcialmente las demandas termicas y electricas de Boehringer Ingelheim Promeco.

  7. Distribution electric system simulator to support decision-making for CFE (Federal Electric Commission) Distribution Control Centers; Simulador del Sistema Electrico de Distribucion para apoyo en la toma de decisiones en Centros de Control de Distribucion de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa Reza, Alfredo; Quintero Reyes, Agustin; Garcia Mendoza, Raul; Calleros Torres, Tito Manuel [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Borjas Diaz, Jesus Fidel; Sierra Rodriguez, Benjamin; Torres Abrego, Rafael [Comision Federal de Electricidad (Mexico)

    2011-07-01

    This article presents the physical, logical and functional architecture designed to integrate the Electric Distribution System (EDS) simulator developed for the CFE and the electric energy Distribution Control Centers in Mexico. The objective of the EDS simulator is to integrate engineering distribution functions (power flow, short circuit, optimal reconfiguration and reliability, among others) and an expert system (Case-based Reasoning) to aid the process of information analysis, decision-making and the capacity-building of the CFE's Regional and Zonal Distribution Control Centers. The EDS simulator has been installed, updated and is operational in the Tampico Zone and the Gulf Division Distribution Center, as an established product that continually evolves along with the actual operating dynamics. [Spanish] Se presenta la arquitectura fisica, logica y funcional disenada para integrar el simulador del Sistema Electrico de Distribucion (SED) desarrollado para la Comision Federal de Electricidad (CFE) y los Centros de Control de Distribucion de energia electrica en Mexico. El objetivo del simulador del SED es integrar funciones de ingenieria de distribucion (flujo de potencia, corto circuito, reconfiguracion optima, confiabilidad, entre otras) y un sistema experto (Razonamiento Basado en Casos) para apoyar el proceso de analisis de informacion, la toma de decisiones y la capacitacion en los Centros de Control de Distribucion Zonales y Regionales de CFE. El Simulador del SED se encuentra instalado, actualizado y en operacion en la Zona Tampico y en la Division de Distribucion Golfo Centro como un producto consolidado y en constante evolucion a la par de la dinamica operativa real.

  8. Application of the Pinch analysis for the design of a cogeneration system in a paper mill; Aplicacion del analisis Pinch para el diseno de un sistema de cogeneracion en una industria papelera

    Energy Technology Data Exchange (ETDEWEB)

    Mani Gonzalez, A. G.; Arriola Medellin, A. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    The Pinch Analysis is a set of principles, tools and rules for the design that allow the engineer find the best way to configure the elements of a process. In the last ten years it has been utilized for the design of new processes as well as in the energy optimization of existing processes. In this paper the tools utilized for the integration of a cogeneration system in a process for the production of paper is presented. It is also presented how the combined treatment of the Pinch Analysis and the exergy concept allows to define, before the detailed design, the cogeneration potential, the fuel consumption and the amount of pollutant emissions for different cogeneration schemes. [Espanol] El analisis Pinch es un conjunto de principios, herramientas y reglas de diseno que permiten al ingeniero encontrar la mejor manera de configurar los elementos de un proceso. En los ultimos diez anos se ha utilizado para el diseno de procesos nuevos asi como en la optimacion energetica de procesos existentes. En el presente articulo se presentan las herramientas utilizadas para la integracion de un sistema de cogeneracion en un proceso de produccion de papel. Se muestra tambien como el tratamiento combinado del analisis Pinch y el concepto de energia permite definir, antes del diseno detallado, el potencial de cogeneracion, el consumo de combustible y la cantidad de emisiones contaminantes para diferentes esquemas de cogeneracion.

  9. Cogeneration in large processing power stations; Cogeneracion en grandes centrales de proceso

    Energy Technology Data Exchange (ETDEWEB)

    Munoz, Jose Manuel [Observatorio Ciudadano de la Energia A. C., (Mexico)

    2004-06-15

    , cervecerias, papeleras y plantas de celulosa, entre otras, con necesidades de vapor para sus procesos, tienen las condiciones tecnicas y economicas para cogenerar o sea, producir simultaneamente vapor y electricidad. De hecho, muchas de tales instalaciones que existen actualmente en cualquier pais, cuentan con equipos de cogeneracion que les permiten obtener su electricidad a un costo muy bajo, aprovechando la existencia de generadores de vapor que de cualquier forma son indispensables para satisfacer su demanda. En Mexico, dado el marco legal existente, tanto el servicio publico de electricidad como la industria petrolera son actividades de caracter obligatorio para el estado por estas razones, el tema debiera ser parte de la agenda de planeacion de dicho sector energetico. Las oportunidades a las que nos referimos, son validas para las industrias pequenas, pero desde el punto de vista del interes nacional, son mas importantes para las instalaciones de gran tamano y en ese rango, las mas numerosas estan precisamente en PEMEX, mientras que los grandes excedentes de energia y capacidad que resultarian de cogeneraciones en refinerias y petroquimicas serian de un alto valor, precisamente para el servicio publico de electricidad, o sea para la Comision Federal de Electricidad (CFE).

  10. Procedure to determine the convenience of installing a co-generation system; Procedimiento para determinar la conveniencia de instalar un sistema de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Colin Castellanos, Carlos; Acosta Torres, Aracely [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1992-12-31

    In this article a methodology for the selection of the co-generation system better adapted to the energy needs of an industry is presented, covering the following schemes: a) Satisfy the thermal demand and deliver to the net the excess electricity generated. b) Reduce the functioning level of the machine and produce electricity in accordance with the internal demand. The thermal demand will be satisfied, for instance, integrating a boiler in the cycle. c) Satisfy the electric demand and utilize only in part the available heat. d) Or else, reduce the operation level of the machine and produce only the necessary thermal energy, taking from the net the electric energy needed to cover the total demand. [Espanol] En este articulo se presenta una metodologia para la seleccion del sistema de cogeneracion que mejor se adapte a las necesidades energeticas de una industria, cubriendo los siguientes esquemas: a) Satisfacer la demanda termica y ceder a la red el exceso de energia electrica generada. b) Reducir el nivel de funcionamiento de la maquina y producir electricidad de acuerdo a la demanda interna. La demanda termica se cubrira, por ejemplo, integrando una caldera al ciclo. c) Satisfacer la demanda electrica y, utilizar solo en parte el calor disponible. d) O bien, reducir el nivel de operacion de la maquina y solo producir la energia termica necesaria, tomando de la red la energia electrica para cubrir la demanda total.

  11. Multimedia tutorial system to aid the technical training in energy cogeneration; Sistema tutorial multimedio para apoyar la capacitacion tecnica en cogeneracion de energia

    Energy Technology Data Exchange (ETDEWEB)

    Kemper Valverde, Nicolas; Lara Rosano, Felipe; Guerrero Briseno, Pedro [Laboratorio de Inteligencia Artificial, Instituto de Ingenieria UNAM, Mexico, D. F. (Mexico); Monedero De La Vega, Arturo F. [Seccion Ingenieria Energetica, DEPFI UNAM, Mexico, D. F. (Mexico)

    1994-12-31

    The incorporation of computer aided teaching technologies increases the efficiency in the transmission and acquisition of knowledge, allowing the handling of large information volumes, the knowledge homogenization among the students, the availability, the massive teaching and the permanent updating of the same. On the other hand, considering that all energy saving policy must be supported in a training and dissemination program of the respective energy technologies an immediate option is the use of computerized systems of teaching-learning. Precisely, in this paper, are presented the fundamental technical aspects for the development of a tutorial expert system, to aid the training in energy cogeneration, trying to integrate in the application, the usage of multimedia tools with the intelligent handling of the teaching-learning process through the inference machine of an expert system. [Espanol] La incorporacion de metodologias de ensenanza auxiliada por computadora incrementa la eficiencia en la transmision y adquisicion del conocimiento, permitiendo la manipulacion de grandes volumenes de informacion, la homogeneizacion del conocimiento en los educandos, la disponibilidad, masificacion y la permanente actualizacion del mismo. Por otro lado, considerando que toda politica de ahorro de energia debe estar soportada en un programa de capacitacion y de divulgacion de las tecnologias energeticas respectivas, una alternativa inmediata es el empleo de sistemas computarizados de ensenanza-aprendizaje. Precisamente, en este trabajo, se presenta los aspectos tecnicos fundamentales del desarrollo de un sistema experto tutorial para apoyar la capacitacion en cogeneracion de energia, tratando de integrar en la aplicacion, el empleo de las herramientas multimedios con el manejo inteligente del proceso de ensenanza-aprendizaje a traves de la maquina de inferencia de un sistema experto.

  12. First multivendor scheme in CFE to protection of 400 kV transmission line, using optical TC's, digital relays and bus IEC 61850-9-2; Primer esquema multivendedor en CFE para proteccion de linea de transmision de 400 kV, utilizando TC's opticos, relevadores digitales y bus IEC 61850-9-2

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Colon, V.R; Rasgado, J.P [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Lara C, H; Melendez, C; Juarez, N [Subdireccion de Transmision, Comision Federal de Electricidad (Mexico)

    2013-03-15

    This paper presents the details of design, installation and putting into service in the Comision Federal de Electricidad (CFE), of the first multi-vendor scheme that exists in the world, for the protection of a 400kV transmission line, which uses optical current transformers and digital relays IEC 61850-9-2. This system arises as a pilot project of the Subdireccion de Transmision of the CFE with the Instituto de Investigaciones Electricas (IIE). To ensure success in the implementation of the protection scheme, CFE joined a team coordinated by the Instituto de Investigaciones Electricas (IIE)involving nine international companies and a university. Pilot protection scheme is in operation under continuous monitoring, in one of the transmission lines of CFE that interconnect Manuel Moreno Torres with El Juile substations. The construction features, the challenges that were overcome and the first results obtained in operation are presented below. [Spanish] Este articulo presenta los detalles del diseno, instalacion y puesta en servicio en la Comision Federal de Electricidad (CFE) del primer esquema multivendedor que existe en el mundo, para la proteccion de una linea de transmision de 400kV, que utiliza transformadores de corriente opticos y relevadores digitales IEC 61850-9-2. Este sistema surge como un proyecto piloto de la Subdireccion de Transmision de la CFE con el Instituto de Investigaciones Electricas (IIE). Para asegurar el exito en la implementacion del esquema de proteccion, la CFE integro un equipo de trabajo coordinado por el Instituto de Investigaciones Electricas (IIE) en el que participaron 9 empresas internacionales y una universidad. El esquema de proteccion piloto, se encuentra en operacion bajo monitoreo continuo, en una de las lineas de transmision de la CFE que interconecta las subestaciones de Manuel Moreno Torres y El Juile. Las caracteristicas de construccion, los retos que fueron vencidos y los primeros resultados obtenidos en su operacion se

  13. Economic and environmental advantages for the use of the industrial potential of cogeneration in Mexico City; Ventajas economicas y ambientales para el aprovechamiento del potencial industrial de cogeneracion en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, G. [Division de Estudios de Posgrado, Facultad de Ingenieria, UNAM, Mexico, D.F. (Mexico)

    2003-03-01

    Mexico has an industrial cogeneration potential very important, not evaluated or projected within its historical growth. The objective of the present work consist of studying the industrial cogeneration potential that exists in Mexico, as well as the economic and environmental savings that it would be achieved if one took advantage of this potential. As a result of the present work we can conclude that the cogeneration in Mexico offers a theoretical potential middle of 28,000 MWe to the 2007. It is estimated an economic saving potential in the construction of generation infrastructure electrical, for the high stage of its utilization of almost 7000 million of dollars and a stage of emissions reduction of 2007- 21.37% instead of 2007- 0.35% for the industrial sector of the country. These prognoses can be obtained, as long as the government changes vision to handle this subject as a measure of energy saving, and substitute it by the policy of complement the development of the national electrical sector. [Spanish] Mexico tiene un importante potencial de cogeneracion industrial que no ha sido evaluado ni proyectado dentro de su crecimiento historico, por ello, el objetivo de este trabajo consiste en estudiar y conocer los ahorros economicos y ambientales que se podrian lograr si se aprovechara dicho potencial. Como resultado, se muestra que la cogeneracion en Mexico ofrece un potencial teorico medio de 28,000 MWe al ano 2007. Se estima tambien un ahorro economico en la construccion de infraestructura de generacion electrica para el escenario alto de su aprovechamiento de casi 7 000 mdd, y un escenario de reduccion de emisiones para el sector industrial del pais de un 0.35% a un 21.4% para el ano 2007. Estos pronosticos se pueden lograr, siempre y cuando el gobierno cambie la vision de manejar este tema como una medida de ahorro de energia, y la sustituya por la politica de complemento al desarrollo del sector electrico nacional.

  14. Economic and environmental advantages for the utilization of the industrial potential of cogeneration in Mexico; Ventajas economicas y ambientales para el aprovechamiento del potencial industrial de cogeneracion en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, G [Division de Estudios Posgrado, Facultad de ingenieria, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2003-01-15

    Mexico has an industrial cogeneration potential very important, not evaluated or projected within its historical growth. The objective of the present work consist of studying the industrial cogeneration potential that exists in Mexico, as well as the economic and environmental savings that it would be achieved if one took advantage of this potential. As a result of the present work we can conclude that the cogeneration in Mexico offers a theoretical potential middle of 28,000 MWe to the 2007. It is estimated an economic saving potential in the construction of generation infrastructure electrical, for the high stage of its utilization of almost 7000 million dollars and a stage of emissions reduction of 2007- 21.4%, instead of 2007- 0.35%, for the industrial sector of the country. Provided that change the vision of the government of seeing to the cogeneration as a measure of energy saving and substitute it by that of political of complement to the development of the national electrical sector. [Spanish] Mexico tiene un importante potencial de cogeneracion industrial que no ha sido evaluado ni proyectado dentro de su crecimiento historico, por ello, el objetito de este trabajo consiste en estudiar y conocer los ahorros economicos y ambientales que se podrian lograr si se aprovechara dicho potencial. Como resultado, se muestra que la cogeneracion en Mexico ofrece un potencial teorico medio de 28,000 MW e al ano 2007. Se estima tambien un ahorro economico en la construccion de infraestructura de generacion electrica para el escenario alto de su aprovechamiento de casi 7000 mdd, y un escenario de reduccion de emisiones para el sector industrial del pais de un 0.35% a un 21.47% para el ano 2007. Estos pronosticos se pueden lograr, siempre y cunado el gobierno cambie la vision de manejar este tema como una medida de ahorro de energia, y la sustituya por la politica de complemento al desarrollo del sector electrico nacional.

  15. Basic semantic architecture of interoperability for the intelligent distribution in the CFE electrical system; Arquitectura base de interoperabilidad semantica para el sistema electrico de distribucion inteligente en la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa Reza, Alfredo; Garcia Mendoza, Raul; Borja Diaz, Jesus Fidel; Sierra Rodriguez, Benjamin [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2010-07-01

    The physical and logical architecture of the interoperability platform defined for the distribution management systems (DMS), of the Distribution Subdivision of Comision Federal de Electricidad (CFE) in Mexico is presented. The adopted architecture includes the definition of a technological platform to manage the exchange of information between systems and applications, sustained in the Model of Common Information (CIM), established in norms IEC61968 and IEC 61970. The architecture based on SSOA (Semantic Services Oriented Architecture), on EIB (Enterprise Integration Bus) and on GID (Generic Interface Definition) is presented, as well as the sequence to obtain the interoperability of systems related to the Distribution Management of the of electrical energy in Mexico. Of equal way it is described the process to establish a Semantic Model of the Electrical System of Distribution (SED) and the creation of instances CIM/XML, oriented to the interoperability of the information systems in the DMS scope, by means of the interchange of messages conformed and validated according to the structure obtained and agreed to the rules established by Model CIM. In this way, the messages and the information interchanged among systems, assure the compatibility and correct interpretation in an independent way to the developer, mark or manufacturer of the system source and destiny. The primary target is to establish the infrastructure semantic base of interoperability, cradle in standards that sustain the strategic definition of an Electrical System of Intelligent Distribution (SEDI) in Mexico. [Spanish] Se presenta la arquitectura fisica y logica de la plataforma de interoperabilidad definida para los sistemas de gestion de la distribucion (DMS por sus siglas en ingles), de la Subdireccion de Distribucion de la Comision Federal de Electricidad (CFE) en Mexico. La arquitectura adoptada incluye la definicion de una plataforma tecnologica para gestionar el intercambio de informacion

  16. Higher physics for CFE

    CERN Document Server

    Chmabers, Paul; Moore, Ian

    2013-01-01

    Higher Physics for CfE provides complete coverage of the latest SQA syllabus for the Revised Higher (for examination 2012 onwards), and is also tailored specifically to the extended requirements, teaching approaches and syllabus outlines detailed in the Higher revisions for Curriculum for Excellence. It will therefore be appropriate for all new Higher Physics syllabus requirements from 2012 onwards. Each section of the book matches a unit of the CfE syllabus; each chapter corresponds to a content area. The text is composed of three units: Our Dynamic Universe, Particles and Waves, and Electric

  17. Higher English for CFE

    CERN Document Server

    Cunningham, Carolyn

    2015-01-01

    A comprehensive working guide to the the Critical Reading section of Higher English for CfE - worth 40% of available marks in the exam!. Critical Reading (Scottish text questions and critical essay) is a very significant element of the new Higher English qualification. This book provides you with the support and advice you will need to succeed in this vital area, with a top expert guiding you through the course and suggesting approaches to the exam, so that you achieve the best grades you can. By focusing on specific examples of Scottish texts, this book enables you to increase your knowledge

  18. Co-generation and reality Potential in Mexico; Potencial de cogeneracion y realidad en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Comision Nacional para el Ahorro de Energia (CONAE) (Mexico)

    2005-07-01

    This document deals with the Mexican use of co-generation -the efficient use of the energy- through the support offered by the Comision Nacional para el Ahorro de Energia (CONAE), since this is the agency in charge of fomenting the efficient use of energy by means of actions coordinated with diverse dependencies and organizations of the Administracion Publica Federal and with the governments of the federal entities as well as municipalities, social and private sectors. Among the subjects to be dealt are quality of the electrical and thermal energy, types of fuels that can be used in the co-generation project, the present situation of the co-generation in Mexico and the conditions for their development. [Spanish] Este documento analiza el uso de la cogeneracion en Mexico es decir, el uso eficiente de la energia a traves del apoyo que brinda la Comision Nacional para el Ahorro de Energia (CONAE) ya que es el organo encargado de fomentar la eficiencia en el uso de la energia mediante acciones coordinadas con las diversas dependencias y entidades de la Administracion Publica Federal y con los gobiernos de las entidades federativas y los municipios y, a traves de acciones concertadas, con los sectores social y privado. Se trataran temas como calidad de la energia electrica y termica, los tipos de combustibles que pueden utilizarse en el proyecto de cogeneracion, la situacion actual de la cogeneracion en Mexico y las ccondiciones para su desarrollo.

  19. Cogeneration projects in PEMEX refining; Proyectos de cogeneracion en PEMEX Refinacion

    Energy Technology Data Exchange (ETDEWEB)

    Becerra O' Leary, Jose [Petroleos Mexicanos (Mexico)

    2006-10-15

    Mexican Petroleum proposes the electric power cogeneration, the energy consumption and rationalization as well as the operative performance improvement. This is the reason Pemex refining considers the cogeneration projects development possibility related with the Refining National System to supply the six refineries with steam and electric power. And also the energy auto-supply to other Pemex refining, using the liquid and solid residuals as fuels for petroleum refining. [Spanish] Petroleos Mexicanos propone la Cogeneracion de energia electrica, el aprovechamiento y la racionalizacion del consumo de energia, asi como el mejoramiento del desempeno operativo, por lo cual Pemex Refinacion plantea la posibilidad del desarrollo de proyectos de Cogeneracion asociados a las refinerias del Sistema Nacional de Refinacion, para abastecer de vapor y energia electrica a cada una de las seis refinerias, asi como el autoabastecimiento de energia a otras instalaciones de Pemex Refinacion, utilizando como combustibles los residuales liquidos y solidos de la refinacion del petroleo.

  20. Dicty_cDB: CFE262 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE262 (Link to dictyBase) - - - Contig-U16368-1 CFE262P (Link... to Original site) CFE262F 652 CFE262Z 401 CFE262P 1053 - - Show CFE262 Library CF (Link to library) Clone ID CFE262 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...HRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIINGHPTCIRGDGYL...VNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIING

  1. Experiences of energy saving and co-generation projects; Experiencias de proyectos de ahorro de energia y cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez Barajas, Alberto [Heat and Power Systems, S.A. de C.V., Mexico D.F. (Mexico)

    2005-07-01

    In this document are presented the successful projects of energy saving and co-generation that Heat and Power Systems, S.A. de C.V. has made in diverse industries. The investment recovery periods have been smaller to 18 months. The projects have been made for different companies within Mexican Republic. [Spanish] Se presentan los casos exitosos de proyectos de ahorro de energia y cogeneracion que Heat and Power Systems, S.A. de C.V. ha realizado en diversas industrias cuyo periodo de recuperacion de la inversion han sido menores a 18 meses. Los proyectos han sido realizados para distintas empresas dentro de la Republica Mexicana.

  2. Higher physics for CFE with answers

    CERN Document Server

    Chambers, Paul; Moore, Ian

    2013-01-01

    The only new textbook appropriate for all new Higher Physics syllabus requirements from 2012 onwards Higher Physics for CfE provides complete coverage of the latest SQA syllabus for the Revised Higher (for examination 2012 onwards), and is also tailored specifically to the extended requirements, teaching approaches and syllabus outlines detailed in the Higher revisions for Curriculum for Excellence. Each section of the book matches a unit of the CfE syllabus; each chapter corresponds to a content area. The text is composed of three units: Our Dynamic Universe, Particles and Waves, and Electric

  3. How to pass higher French for CFE

    CERN Document Server

    Angus, Douglas

    2015-01-01

    Get your best grade with this guide to Higher French for CfE. We are working with SQA to gain endorsement for this title. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes - Prepare for the exam with top tips and hints on revision techniques - Get your best grade with advice on how to gain those vital extra marks

  4. How to pass higher maths for CFE

    CERN Document Server

    Logan, Brian; Mitchell, John

    2015-01-01

    Get your best grade with this guide to Higher Maths for CfE. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) Maths exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes - Prepare for the exam with top tips and hints on revision techniques - Get your best grade with advice on how to gain those vital extra marks

  5. Cogeneration and Carbon bonds: clean development; Cogeneracion y bonos de carbono: desarrollo limpio

    Energy Technology Data Exchange (ETDEWEB)

    Navarro Perez, Nidia [Facultad de Contaduria y Administracion, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2004-06-15

    The growing preoccupation for the environment in our country and its interest to ratify the Kyoto Protocol with respect to the contamination of the atmosphere, offers great opportunities for the cogeneration so that it fortifies the scientific and technological research and gives a good international image about the sustainable development and care of the environment, so that companies that invest in clean technology will be able to assign a monetary value to their environmental patrimony, this through the so called Green Bonds or Carbon Bonds, this opens a new dimension to finance projects by means of these bonds that can be negotiated at an international level; by means of the Clean of Energy Production the investment can be stimulated and revenues for projects that contribute to the sustainable development of the country and the power efficiency. At the moment the country has at least 13 projects in different analysis stages to enter the carbon bond market, which are presented as co-generation projects of energy, in addition to the formation of the Mexican Committee for Projects of Reduction and Capture of Gas Discharges of Greenhouse Effect. [Spanish] La creciente preocupacion por el medio ambiente en nuestro pais y su interes por ratificar el Protocolo de Kyoto en lo referente a la contaminacion de la atmosfera, ofrece grandes oportunidades para la cogeneracion de manera que fortalezca la investigacion cientifica y tecnologica y dar una buena imagen internacional en torno a temas de desarrollo sustentable y cuidado del medio ambiente, de manera que empresas que invierten en tecnologia limpia podran asignar un valor monetario a su patrimonio ambiental, esto a traves de los llamados Bonos Verdes o Bonos de Carbono, esto abre una dimension nueva para financiar proyectos por medio de estos bonos que pueden negociarse a nivel internacional; por medio de la Produccion Limpia de energia se puede estimular inversion y ganancias para proyectos que contribuyan al

  6. Higher English language skills for CFE

    CERN Document Server

    Firth, Mary M; Mitchell, John

    2015-01-01

    A brand new edition of a bestselling title, updated for the newest Higher English (for CfE) syllabus. We are working with SQA to secure endorsement for this title. This book provides you with the support and advice you will need to succeed in Higher English. By studying literary techniques and with top experts guiding you through and explaining how to use these skills, you will be helped to understand why questions are framed in a particular way and how to answer them in a manner that ensures the highest possible grade. - Become more secure in your knowledge of the English language. - Learn ho

  7. Analysis and use of OLAP tools in the corporative information system of CFE; Analisis y empleo de herramientas OLAP en el sistema de informacion corporativa de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Jacome G, Norma E; Argotte R, Liliana P; Mejia L, Manuel [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2003-07-01

    The commercial tools Oracle Express and Oracle the Discoverer are presented, applied and compared. Both of them were applied in the context of the Data Storage that Comision Federal de Electricidad (CFE) develops, denominated Corporative Information System (SICORP) that involves the handling of large volumes of historical and present information. By the importance and the relevance that at the moment the subject of data storage has, the experiences that are described in the article are very useful for future developments. [Spanish] Se presentan, aplican y comparan las herramientas comerciales Oracle Express y Oracle Discoverer. Ambas fueron aplicadas en el contexto del Almacen de Datos que la Comision Federal de Electricidad (CFE) desarrolla, denominado Sistema de Informacion Corporativa (Sicorp), que involucra el manejo de grandes volumenes de informacion historica y actual. Por la importancia y el auge que actualmente tiene el tema de almacenes de datos, las experiencias que se describen en el articulo son de gran utilidad para futuros desarrollos.

  8. System of lower cogeneration in the cement industry; Sistema de cogeneracion inferior en la industria del cemento

    Energy Technology Data Exchange (ETDEWEB)

    Romero Paredes, H.; Vazquez, A; Ambriz, J. J.; Fosado, A.; Cedillo, D.; Sanchez, R. [Universidad Autonoma Metropolitana-Iztapalapa (Mexico)

    1999-07-01

    energeticos en la industria cementera representan entre el 30 y 60% de los costos de produccion, por lo que cualquier disminucion en su consumo, repercutira considerablemente en la productividad de la empresa. Para determinar la capacidad disponible de energia de desecho y establecer la dimension del sistema de cogeneracion se procedio primeramente a realizar los balances de materia y energia de un tren de produccion de cemento. Para la evaluacion y simulacion numerica se tomo un caso de estudio de una planta nacional. El analisis toma unicamente en cuenta el horno rotatorio, el precalcinador, el enfriador de gases o acondicionador, el enfriador del clinker y los separadores o recuperadores de polvo. En este estudio no se han considerado los molinos ni los sistemas electricos que operan en toda la planta. Los resultados muestran que existe en general un elevado potencial de cogeneracion pues en algunos casos las perdidas de calor pueden alcanzar hasta un 50% de la energia calorifica de entrada. La capacidad de generacion electrica mediante turbina de vapor al aprovechar una fraccion (del orden del 60%) del calor residual, puede ser entre 200 y 300 wats por kg. de clinker producido. En conclusion, al recuperar mediante intercambiadores de calor apropiados para cada uno de los equipos que se mencionaron la energia desperdiciada y una red de intercambio de calor optimizada mediante tecnicas modernas se puede generar una parte importante de la energia electrica que usa una planta cementera. El metodo empleado ha resultado muy atractivo y con la posibilidad de aplicarlo a cualquier planta cementera y asi evaluar los potenciales de cogeneracion de energia.

  9. Cogeneration in a plywood factory; Sistema de cogeneracion en una planta maderera

    Energy Technology Data Exchange (ETDEWEB)

    Castelazo Hernandez, Arturo; Mendoza Arcaraz, Alfonso [Ultra Energia, S. A. de C. V. Naucalpan (Mexico)

    1996-12-31

    back-pressure steam turbine. The back-pressure steam turbine exhaust will be used to heat up the thermal oil through a steam-thermal oil heat exchanger. [Espanol] La Cogeneracion, que es la produccion conjunta de dos manifestaciones de energia a partir de una misma fuente energetica, se presenta como una de las alternativas mas viables para lograr el aprovechamiento optimo de los recursos energeticos finitos. En las ultimas decadas en que el crecimiento economico de Mexico ha estado ligado a la generacion y suministro de energia electrica, el Estado ha fungido como organizador y director del sistema nacional de generacion electrica, sin embargo la intervencion de los particulares ha sido determinante. Debemos tomar en cuenta que para cubrir las necesidades futuras de electricidad del desarrollo nacional, se requeriran aproximadamente 17 mil MW adicionales, para lo cual la iniciativa privada, entre las que podemos destacar a la pequena y mediana industria, tendra despejado el camino para producirlos, aprovechando los cambios en la Ley y el Reglamento del Servicio Publico de Energia Electrica, publicados en el Diario Oficial de la Federacion los dias 23 de diciembre de 1992 y 31 de mayo de 1993 respectivamente. Al contar con un sistema de cogeneracion optimizado, el importe economico anual de la empresa maderera por concepto de energia (electricidad y combustible) se reducira sustancialmente. La empresa maderera requiere la instalacion de un sistema de cogeneracion que suministre 4.75 MWe y 1,861 KWt (1.6 Gcal/hr). La energia electrica se utilizara en la fabricacion de TABLONES DE NOVOPAN y la energia termica para calentar aceite que se utiliza en la presa de madera y en la preparacion de la emulsion utilizada en el proceso. Para satisfacer los requerimientos energeticos se han analizado 2 alternativas: 1. Generacion de energia electrica con un motor de combustion interna que utilice combustoleo como combustible, aprovechandose los gases de escape del motor para pre

  10. Cogeneration in a plywood factory; Sistema de cogeneracion en una planta maderera

    Energy Technology Data Exchange (ETDEWEB)

    Castelazo Hernandez, Arturo; Mendoza Arcaraz, Alfonso [Ultra Energia, S. A. de C. V. Naucalpan (Mexico)

    1996-12-31

    back-pressure steam turbine. The back-pressure steam turbine exhaust will be used to heat up the thermal oil through a steam-thermal oil heat exchanger. [Espanol] La Cogeneracion, que es la produccion conjunta de dos manifestaciones de energia a partir de una misma fuente energetica, se presenta como una de las alternativas mas viables para lograr el aprovechamiento optimo de los recursos energeticos finitos. En las ultimas decadas en que el crecimiento economico de Mexico ha estado ligado a la generacion y suministro de energia electrica, el Estado ha fungido como organizador y director del sistema nacional de generacion electrica, sin embargo la intervencion de los particulares ha sido determinante. Debemos tomar en cuenta que para cubrir las necesidades futuras de electricidad del desarrollo nacional, se requeriran aproximadamente 17 mil MW adicionales, para lo cual la iniciativa privada, entre las que podemos destacar a la pequena y mediana industria, tendra despejado el camino para producirlos, aprovechando los cambios en la Ley y el Reglamento del Servicio Publico de Energia Electrica, publicados en el Diario Oficial de la Federacion los dias 23 de diciembre de 1992 y 31 de mayo de 1993 respectivamente. Al contar con un sistema de cogeneracion optimizado, el importe economico anual de la empresa maderera por concepto de energia (electricidad y combustible) se reducira sustancialmente. La empresa maderera requiere la instalacion de un sistema de cogeneracion que suministre 4.75 MWe y 1,861 KWt (1.6 Gcal/hr). La energia electrica se utilizara en la fabricacion de TABLONES DE NOVOPAN y la energia termica para calentar aceite que se utiliza en la presa de madera y en la preparacion de la emulsion utilizada en el proceso. Para satisfacer los requerimientos energeticos se han analizado 2 alternativas: 1. Generacion de energia electrica con un motor de combustion interna que utilice combustoleo como combustible, aprovechandose los gases de escape del motor para pre

  11. Evaluation of the national cogeneration potential as an option for the expansion of the national electric system; Evaluacion del potencial nacional de cogeneracion como opcion en la expansion del sistema electrico nacional

    Energy Technology Data Exchange (ETDEWEB)

    Nieva Gomez, Rolando; Hernandez Galicia, Julio Alberto [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Portes Mascorro, Enrique; Alvarez Chavez, Jose Maria [Comision Nacional para el Ahorro de Energia (CONAE), Mexico, D. F. (Mexico)

    1997-12-31

    The Comision Nacional para el Ahorro de Energia (CONAE) carried out a study to determine the amount of electric energy available by cogeneration in the industrial sector of our country. This study is based in a survey among the enterprises with the largest fuel consumption belonging to the industrial and commercial sectors and to the petrochemical branch of Petroleos Mexicanos (PEMEX). The results of the study are presented, which show the location of the cogeneration potential by the following estimates: a) The scenario under a potential of 5770 MW to generate annually 4.55 x 107 MWh of electric energy. b) The scenario with a potential of 10819 MW to generate annually 9.47 x 107 Mwh of electric energy [Espanol] La Comision Nacional para el Ahorro de Energia (CONAE) llevo acabo un estudio para determinar la cantidad de energia electrica disponible por cogeneracion en el sector industrial de nuestro pais. El estudio se fundamenta en una encuesta entre las empresas con mayor consumo de combustibles pertenecientes a los sectores industrial y comercial y al ramo petroquimico de Petroleos Mexicanos (PEMEX). Se presentan los resultados del estudio, el cual muestra la ubicacion del potencial de cogeneracion por los siguientes estimados: a) El escenario bajo con un potencial de 5770 MW para producir anualmente 4.55 x 107 Mwh de energia electrica. b) El escenario alto con un potencial de 10819 MW para producir anualmente 9.47 x 107 MWh de energia electrica

  12. How to pass higher physics for CfE

    CERN Document Server

    Chambers, Paul; Mitchell, John

    2014-01-01

    Get your best grade with this guide to Higher Physics for CfE. We are working with SQA to gain endorsement for this title. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes. - Prepare for the exam with top tips and hints on revision techniques. - Get your best grade with advice on how to gain those vital extra marks

  13. Evaluation of avoided carbon dioxide emissions in cogeneration projects; Evaluacion de las emisiones evitadas de bioxido de carbono en proyectos de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Flores Zamudio, Jesus Antonio; Fernandez Montiel, Manuel Francisco; Alcaraz Calderon, Agustin Moises [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: jesus.flores@iie.org.mx; mffm@iie.org.mx; malcaraz@iie.org.mx

    2010-11-15

    In this paper, presents a methodology of how to calculate the emissions of CO{sub 2} (Carbon Dioxide) in cogeneration of plants for evaluate future cases with the type of fuel and fuel flow used in the plant. The methodology was in spreadsheets developed a series of stoichiometric balances. The methodology was done for three types of fossil fuels: solid, liquid and gas. The analysis is made only to the percentages of the items contained in the fuel flow automatically used and results in the combustion products in tons per hour. This method was compared with the results obtained in the software Thermoflow Inc. (Used in Gerencia de Procesos Termicos of Instituto de Investigaciones Electricas for evaluate various process systems that produce energy power) using different cogeneration systems, that is to say about the technology used emissions compared according to the amount of excess air for each type of technology and at one point before the gas cleaning systems. The results can be evaluated for emissions avoided through the fuel type used and developing a cogeneration plant compared to a conventional plant. [Spanish] En este articulo, se presenta una metodologia de como calcular las emisiones de CO{sub 2} (Bioxido de carbono) en plantas de cogeneracion, para evaluar casos a futuro por medio del tipo de combustible y flujo de combustible a utilizar en la planta. La metodologia se realizo en hojas de calculo, donde se desarrollaron una serie de balances estequiometricos. La metodologia se hizo para tres tipos de combustibles fosiles: solido, liquido y gas. El analisis se realiza con solo dar los porcentajes de los elementos que contiene el combustible y el flujo a utilizarse y automaticamente da como resultado los productos de la combustion en toneladas por hora. Esta metodologia se comparo con los resultados obtenidos en el software Thermoflow Inc. (Empleado en la Gerencia de Procesos Termicos del Instituto de Investigaciones Electricas para evaluar diversos

  14. CFE: Anatomy of a hierarchical SCADA/EMS

    Energy Technology Data Exchange (ETDEWEB)

    Fesmire, R.

    2004-07-01

    Implementation of a supervisory control and data acquisition system in Mexico that could accommodate the country's ever-expanding demand for electricity while, at the same time, deliver a very high level of availability and ease of use, is described. The system installed by ABB, dubbed SITRACEN, (a Spanish acronym for Real-time Information and Control System), is distinguished by (1) its hierarchical design, which allows the CFE (Comision Federal de Electricidad) a comprehensive view of the entire power grid, (2) its open software architecture, facilitating easier connections with other applications, and (3) its ability to be continuously upgraded, in step with advancements in SCADA/EMS systems. The approach is said to be unique among network control systems, providing CFE with a robust information technology infrastructure that is fully compatible with Mexico's rapidly growing economy and capable of meeting the attendant impact on the country's electric power system. 1 tab., 1 fig.

  15. Cogeneration in Mexico: Weaknesses, Threats, strengths and opportunities; Cogeneracion en Mexico: Debilidades, amenazas, fortalezas y oportunidades

    Energy Technology Data Exchange (ETDEWEB)

    Elizalde Baltierra, Alberto; Garcia Pelaez, Juan [Programa Universitario de Energia, UNAM (Mexico)

    1997-07-01

    In this paper the strategies are formulated and evaluated, taking into account the internal and external aspects of the cogeneration in Mexico that foment their development in the medium term (two or four years). In the formulation of strategies a matrix DAFO (Weaknesses, Threats, Strengths and Opportunities) is employed and in the evaluation is applied the procedure of analytical hierarchical structuring. The future on the cogeneration in the next years will depend on diverse factors, among which can be mentioned: the legal frame; the financial situation of the interested companies; the outsourcing of financing; the prices of the electricity and fuels, as well as their availability, among others. [Spanish] En este trabajo se formulan y evaluan estrategias que, tomando en cuenta los aspectos internos y externos de la cogeneracion en Mexico, fomenten su desarrollo en el mediano plazo (dos o cuatro anos). En la formulacion de estrategias se emplea la matriz DAFO (Debilidades, Amenazas, Fortalezas y Oportunidades) y en la evaluacion se aplica el procedimiento de jerarquizacion analitica. El futuro de la cogeneracion en los proximos anos dependera de diversos factores, entre los que se pueden mencionar: el marco legal; la situacion financiera de las empresas interesadas; las fuentes externas de financiamiento; los precios de la electricidad y de los combustibles, asi como su disponibilidad, entre otros.

  16. Prefeasibility analysis of a cogeneration project in the Mexican food industry; Analisis de prefactibilidad de un proyecto de cogeneracion en la industria alimenticia mexicana

    Energy Technology Data Exchange (ETDEWEB)

    Gongora Gonzalez, Guillermo; Castelazo Hernandez, Arturo [Ultra Energia, S. A. de C. V. Naucalpan (Mexico)

    1993-12-31

    The main technical and economical results of a prefeasibility study of an industry considered of medium size in the food area, which is a subsidiary of an American industrial merger, are shown. The above mentioned facility is located in the highland zone, its installed capacity is 2,350 electrical kw and 8,519 thermal kw needed for the optimum development of the productive process. Five technically feasible cogeneration options are analyzed, comparing the advantages and disadvantages of each option. Guides and conclusions for this type of projects are presented . [Espanol] Se muestran los principales resultados tecnicos y economicos de un estudio de prefactibilidad de una industria considerada como mediana de la rama alimenticia, la cual es filial de un consorcio industrial norteamericano. La planta mencionada se encuentra localizada en la zona del altiplano, cuya capacidad instalada es de 2,350 kW electricos y 8,519 kW termicos necesarios para el desarrollo optimo del proceso productivo. Se analizan cinco alternativas de cogeneracion tecnicamente viables, comparando las ventajas y desventajas de cada alternativa. Se presentan las recomendaciones y conclusiones para este tipo de proyectos.

  17. Cogeneration development in Mexico and its recent environmental impact; Desarrollo de la cogeneracion en Mexico y su reciente impacto ambiental

    Energy Technology Data Exchange (ETDEWEB)

    Elizalde Baltierra, Alberto; Garcia Pelaez, Juan [Universidad Nacional Autonoma de Mexico, Mexico, D. F. (Mexico)

    1996-12-31

    This paper presents the historical development of the electric auto supply systems and cogeneration in Mexico since 1942 to 1995 with the understanding that these are clearly differentiated and defined since 1992. Though it is not, but until 1994 when the first ex profeso permit for cogeneration was granted. It also develops a short prospective vision of the cogeneration in our country, as well as the fuel consumption employed by auto- supply systems during 1993. The pollution emissions to the environment are also analyzed and with it the environmental impact of these electric systems in this year. [Espanol] Se presenta el desarrollo historico de los sistemas de autoabastecimiento electrico y cogeneracion en Mexico desde 1942 a 1995, en el entendido que estos se diferencian y definen claramente desde 1992. Es, sin embargo, hasta 1994 cuando se otorgo el primer permiso ex profeso de cogeneracion. Se desarrolla, ademas, una breve vision prospectiva de la cogeneracion en nuestro pais. Asimismo, se analiza el consumo de combustibles empleados por los sistemas de autoabastecimiento en 1993. Se estiman las emisiones contaminantes a la atmosfera y con ello se valora el impacto ambiental de estos sistemas electricos en ese ano.

  18. Implementation impact of the modern automation technologies propitiated by Sicle in the Comision Federal de Electricidad (CFE) transmission substations; Impacto de la implantacion de tecnologias modernas de automatizacion propiciadas por el Sicle en las subestaciones de transmision de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez Arriola, Gustavo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-03-01

    This paper presents the anticipated implementation impact of the automation system (SICLE) (Sistema de Informacion y Control Local de Estacion) (Station Information and Local Control System) in Comision federal de Electricidad (CFE)`s organization, which includes the daily operation and the changes or influence in the control, protection, measurements, substations and power lines, and communications within the electricity transmission network. Likewise, the possible effects on the system suppliers and equipment manufacturers, as well as the Instituto de Investigaciones Electricas (IIE) participation in the development of applications in online monitoring for primary equipment maintenance, based on the principle named by condition or by requirement of the equipment itself. [Espanol] Se presenta el impacto previsto por la implantacion del sistema de automatizacion Sicle (Sistema de Informacion y Control Local de Estacion) en la organizacion de la CFE, lo que incluye la operacion diaria y cambios o influencia en las areas de control, proteccion, medicion, subestaciones y lineas y comunicaciones de la red de transmision. Asimismo, se presentan los posibles efectos en los proveedores de sistemas y los fabricantes de equipo, asi como la participacion del Instituto de Investigaciones Electricas (IIE) en el desarrollo de aplicaciones sobre monitoreo en linea para mantenimiento de equipo primario basado en el principio denominado por condicion o por requerimiento del mismo equipo.

  19. Gasification of heavy fuels to produce electrical energy and hydrogen; Gasificacion de combustibles pesados para producir energia electrica e hidrogeno

    Energy Technology Data Exchange (ETDEWEB)

    Vera Garcia, Oscar Alberto [Universidad Nacional Autonoma de Mexico(UNAM), Mexico, D.F. (Mexico)

    2006-11-15

    integrado (CCGI). El segundo, examina la incorporacion de un reactor shift en el cual el gas de sintesis se transforma en CO{sub 2} y H{sub 2} el cual se usa para mover la turbina a gas, adaptada para hidrogeno puro. Finalmente se estudia la cantidad de otros subproductos que se pueden obtener de estos ciclos de cogeneracion tales como CO{sub 2} para ser usado en recuperacion secundaria de pozos petroleros, N{sub 2} para ser usado en la industria de fertilizantes o en la propia produccion petrolera y H{sub 2} para ser usado en la industria petroquimica o en la generacion con celdas de combustible. Todos los casos son estudiados en forma cuantitativa, realizando los balances de masa y energia de cada uno de ellos. Para darle mas sentido practico a los calculos, se han tomado como base los datos tecnicos de la Central Valladolid de Comision Federal de Electricidad (CFE). Este articulo proporciona una idea basica, pero muy practica, para estimar el consumo de combustible de los diferentes modos de arreglo de una central CCGI, asi como los volumenes de los diferentes gases que se pueden producir y las modificaciones al tamano de los equipos que se requieren.

  20. Utilization of agricultural sugar cane wastes as fuel in modern cogeneration systems applied in sugar cane mills; Aprovechamiento de los residuos agricolas caneras como combustible en sistemas de cogeneracion modernos aplicados a ingenios

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, Eduardo H. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); De Buen Rodriguez, Odon [Comision Nacional para el Ahorro de la Energia, Mexico, D. F. (Mexico)

    1998-12-31

    Considering the new legal frame on cogeneration in Mexico, the possibility of heat and electricity supply required by the sugar mills to be made by an independent cogenerator of the sugar mill, operating with the sugar cane bagasse and agricultural sugar cane wastes, has been evaluated. Such modern cogenerator would be characterized, besides operating in an independent way of the sugar mill, by the use of high efficiency equipment in its process of heat and electricity generation. In this sense the Comision Nacional para el Ahorro de Energia (CONAE) through its Coordination Program and the Instituto de Investigaciones Electricas (IIE) carried out a joint project to determine the technical and economical viability that the sugar industry maintains the present sugar production without the need of burning fuel oil, installing adjacent to every sugar mill, a modern cogeneration system, operated by independent producers, that using sugar cane bagasse and agricultural sugar cane wastes, allows the supply of all the steam and electricity required by the sugar mill, and additionally can add firm capacity and the supply of electric power to the national grid, during the grinding season as well as out of grinding season. [Espanol] En consideracion al nuevo marco juridico de la cogeneracion en Mexico se ha evaluado la posibilidad de que el suministro de calor y electricidad requerido por los ingenios azucareros sea proporcionado por un cogenerador independiente de la planta de azucar, el cual opere utilizando el bagazo y residuos agricolas caneras (biomasa canera). Dicho cogenerador moderno se caracterizaria, ademas de operar de manera independiente a la planta de azucar, por el uso de equipos de alta eficiencia en su proceso de produccion de calor y electricidad. En este sentido la Comision Nacional para el Ahorro de Energia (CONAE) a traves de la Coordinacion de Programacion y el Instituto de Investigaciones Electricas (IIE) realizaron un trabajo en conjunto para determinar

  1. Control system modernization of a turbo-gas unit of CFE in the Comarca Lagunera; Modernizacion del sistema de control de una unidad turbogas de la CFE en la Comarca Lagunera

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez P, Marino; De Lara J, Salvador; Hernandez Muniz, Alfredo [Industria SIGRAMA, Cuernavaca, Morelos (Mexico); Garcia Cabello, Raymundo [Comision Federal de Electricidad (Mexico)

    2004-07-01

    At the present time, the turbo-gas units (TGU) make an important contribution in the development and growth of the national power sector, since this type of units pertaining to the Comision Federal de Electricidad (CFE) contributes with the 6.23% of the national production, that is to say, 2600 MW approx. The turbo-gas units are aero-derivative gas turbines used for power generation, pumping and compression. Generally, they are used to support urgent requests in the demand of electricity or, for the permanent supply of electrical energy in isolated zones. In addition, they are used to quickly get into and get out of operation, which requires high availability, trustworthiness and flexibility. In this sense, and with the intention of improving the operation of the TGUs, the Gerencia de Control e Instrumentation (GCI) (Management of Control and Instrumentation) of the Instituto de Investigaciones Electricas (IIE), has developed a control technology for this type of units, able to replace the original control systems of units with even 30 years of continuous operation or to be installed in new units. [Spanish] En la actualidad, las unidades de turbogas (UTG) tienen una importante contribucion en el desarrollo y crecimiento del sector energetico nacional, pues este tipo de unidades pertenecientes a la Comision Federal de Electricidad (CFE) aportan el 6.23% de la produccion nacional, es decir, 2600 MW aproximadamente. Las unidades turbogas son turbinas de gas aeroderivativas empleadas para la generacion electrica, bombeo y compresion. Por lo general, son utilizadas para apoyar solicitudes urgentes en la demanda de electricidad o bien, para el suministro permanente de energia electrica en zonas aisladas. Ademas, se usan para entrar y salir rapidamente en operacion, lo que requiere alta disponibilidad, confiabilidad y flexibilidad. En este sentido, y con la intencion de mejorar las UTG, la Gerencia de Control e Instrumentacion (GCI) del Instituto de Investigaciones

  2. Cognitive Functional Evaluation (CFE) Process for Individuals with Suspected Cognitive Disabilities.

    Science.gov (United States)

    Hartman-Maeir, Adina; Katz, Noomi; Baum, Carolyn M

    2009-01-01

    The purpose of this paper is to conceptualize the evaluation process for individuals with suspected cognitive disabilities. The Cognitive Functional Evaluation (CFE) process yields a comprehensive profile of the clients' cognitive strengths and weaknesses in occupational performance. The components of the CFE are outlined in six stages as a decision tree with examples of standardized instruments from which to choose the assessments for each client evaluated: (1) interview and background information; (2) cognitive screening and baseline status tests; (3) general measures of cognition and executive functions in occupation; (4) cognitive tests for specific domains; (5) measures of specific cognitive domains in occupations; and (6) environmental assessment. The first three stages are required to ascertain basic cognitive abilities underlying occupational performance. Tests for each stage can be chosen from the ones listed according to the client characteristics and the theory utilized, there is no need to use all of them. Once this data is available a further decision is made whether a more in-depth assessment is needed (stages (4) and (5)). The environmental component is evaluated in all instances with at least one of the assessments. The CFE process for individuals with suspected cognitive disabilities is recommended to be used by occupational therapists as a common ground for evaluation, documentation, and communicating information. PMID:23930828

  3. Advance of activities report of the contract CFE-PLV/166/90. Second four-monthly

    International Nuclear Information System (INIS)

    In this report a relationship of finished activities of the Global Program of Fuel Management inside the reactor carried out by the ININ under the contract ININ/CFE 1990-1991 (CFE-PLV/166/90) is presented. Those areas of activities are: 1. Nuclear Data Bank area. 2. Static Simulation of the Reactor area. 3. Reload Optimization area. 4. Analysis of Transitory Events of the Reactor area. (Author)

  4. Experiences on energy saving in Comision Federal Electricidad (CFE) buildings; Experiencias de ahorro de energia en edificios de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez Velasco, Jorge E. [Comision Federal de Electricidad (CFE) (Mexico)

    2005-07-01

    This document describes the developed saving projects in buildings and generating power stations in 2004 by the Comision Federal de Electricidad (CFE). The projects considered are: buildings of the oficinas nacionales, Divisions of distribution office buildings, office buildings of production regions, construction deputy manager's office building, buildings of transmission and transformation, generating power stations, investments and savings of the projects in oficinas nacionales, divisions of distribution and construction subdivision buildings. From these projects the ones concluded in the 2004 were: Distribution Divisions, Gulf-Center Division, Center-West Distribution Division. The developing projects of 2005: oficinas nacionales, distribution divisions, Construction Subdivision, Generating Power Stations, Transmission Areas and office buildings. And finally, the projects concluded in the 2005 are the distribution divisions, the construction subdivision, the generating power stations, the office buildings, the minisplit units and their advantages with respect to the air conditioning window units. [Spanish] Este documento describe los proyectos de ahorro desarrollados en inmuebles y centrales generadoras en el ano 2004 por la Comision Federal de Electricidad (CFE), los proyectos tratados son: inmuebles de oficinas nacionales, inmuebles de divisiones de distribucion, inmuebles de regiones de produccion, inmuebles de la subdireccion de construccion, inmuebles de transmision y transformacion, centrales generadoras, inversiones y ahorros de los proyectos en inmuebles de oficinas nacionales y divisiones de distribucion y subdireccion de construccion. De dichos proyectos se tiene que los proyectos concluidos en el 2004 fueron: Divisiones de Distribucion, Division Golfo Centro, Division de Distribucion Centro Occidente. Los proyectos en desarrollo del 2005: oficinas nacionales, divisiones de distribucion, Subdireccion de Construccion, Centrales Generadoras, Areas

  5. Solvent extraction of rubidium from gold waste using conventional SX and new CFE methods

    Institute of Scientific and Technical Information of China (English)

    Mohammad Reza Tavakoli Mohammadi; Seyed Mohammad Javad Koleini; Sepideh Javanshir; Hossein Abolghasemi; Mahmoud Abdollahy

    2015-01-01

    Solvent extraction (SX) of rubidium (Rb) from leaching filtrate of gold waste (GW) in Mouteh Processing Plant by 18-crown-6 (18C6) was studied.High potential of new column flotoextraction (CFE) method in extraction of Rb from dilute solutions was also demonstrated.First,the factors affecting SX of Rb from a synthetic rubidium sulfate solution (containing 100 mg·L-1 Rb) were identified.0.05 mol·L-1 18C6 in kerosene,0.02 mol·L-1 picric acid in aqueous phase,aqueous to organic (A/O) ratio of 1,pH 7 and mixing time of 15 min are the optimum values for affective factors.The three-stage precipitation with sodium carbonate,pH adjustment with sulfuric acid and two-stage evaporation and crystallization were conducted to purify the leaching from impurities such as Fe,Al,Mn,Ca and especially competing cations of K and Na.Almost complete extraction of Rb and K from final filtrate containing 0.08 mol·L-1 picric acid was performed using 0.2 mol·L-1 18C6 in kerosene.The Rb and K strippings of 99.12 % and 9.93 %,respectively,are obtained with 2 mol·L-1 nitric acid with A/O ratio of 2.Finally,the performance comparison of the CFE and SX methods in similar conditions shows increased extraction of K and Rb by 16 % and 5 %,respectively,using CFE method.

  6. Core-free rolled actuators for Braille displays using P(VDF-TrFE-CFE)

    Science.gov (United States)

    Levard, Thomas; Diglio, Paul J.; Lu, Sheng-Guo; Rahn, Christopher D.; Zhang, Q. M.

    2012-01-01

    Refreshable Braille displays require many small diameter actuators to move the pins. The electrostrictive P(VDF-TrFE-CFE) terpolymer can provide the high strain and actuation force under modest electric fields that are required for this application. In this paper, we develop core-free tubular actuators and integrate them into a 3 × 2 Braille cell. The terpolymer films are solution cast, stretched to 6 μm thick, electroded, laminated into a bilayer, rolled into a 2 mm diameter tube, bonded, and provided with top and bottom contacts. Experimental testing of 17 actuators demonstrates significant strains (up to 4%) and blocking forces (1 N) at moderate electric fields (100 MV m-1). A novel Braille cell is designed and fabricated using six of these actuators.

  7. Opportunities for the operation of the Comision Federal de Electricidad`s fossil fuel power plant stations eventually to be retired as cogeneration units; Oportunidades de operar las centrales termoelectricas de la Comision Federal de Electricidad, eventualmente retirables como unidades de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, E. H. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Merlos Rueda, R. M. [Programa de Ahorro de Energia para el Sector Electrico, Mexico, D. F. (Mexico)

    1995-12-31

    The Programa de Ahorro de Energia para el Sector Electrico (PAESE) (Program for Energy Conservation for the Electric Sector) in collaboration with the Instituto de Investigaciones Electricas (IIE), decided to evaluate technically and economically the possibilities of operating the Comision Federal de Electricidad`s Thermoelectric Power Stations (TPS), eventually to be retired as cogeneration units in supplying thermal energy to industry. The study was focussed to the Monterrey and San Jeronimo Power Stations, determining in a first stage, the optimum radius for handling and transporting steam and/or hot water and so to define the industries that potentially could obtain heat energy from the TPS, in this stage the thermal needs of the evaluated industries were determined (pressure, temperature and flow). In a second stage, the different arrangements to be made to operate the selected TPS, so as to be in position of satisfying such thermal energy demands were evaluated. This paper presents the results of this study. [Espanol] El Programa de Ahorro de Energia para el Sector Electrico (PAESE), en colaboracion con el Instituto de Investigaciones Electricas, decidieron evaluar tecnica y economicamente las posibilidades de operar las centrales termoelectricas (CT`s) de la Comision Federal de Electricidad, eventualmente retirables, como unidades de cogeneracion al ofrecer calor a la industria. El estudio se enfoco en las centrales de Monterrey y San Jeronimo, determinado en una primera etapa el radio optimo para el manejo y transporte de vapor y/o agua caliente y asi definir a las industrias que potencialmente podrian recibir calor de las CT`s, en esta etapa se determinaron las necesidades termicas de las industrias evaluadas (presion, temperatura y flujo). En una segunda etapa se evaluo los diferentes arreglos para operar las CT`s seleccionadas para que pudieran satisfacer dichas demandas termicas. En este trabajo se presentaron los resultados de dicho estudio.

  8. Mitsubishi latest coal fired USC boiler technology (CFE Pacifico 700 MW)

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, T.; Sakamoto, K. [Mitsubishi Heavy Industries, Ltd., Nagasaki (Japan). Power Systems; Fujitab, M. [Mitsubishi Heavy Industries, Ltd., Yokohama (Japan). Power Systems

    2013-07-01

    Mitsubishi Heavy Industries, Ltd. (MHI) has successfully completed commissioning work for CFE (Comision Federal de Electricidad) Pacifico 700 MW coal-fired unit in March 2010 which is the first supercritical unit in Latin America. This supercritical boiler was designed with state of the art technologies such as low NOx burners, high fineness pulverizers, advanced vertical furnace wall technology and so on. Especially the advanced vertical furnace wall technology with some improvements is a key technology to realize swift load changes such as 5% load per minute ramping rate with assuring dynamic characteristics. Recently the requirement of the high efficiency and the swift load changes for the power boilers has been increased so that even a coal-fired unit needs flexible operation characteristics for balancing variety of power sources. One of the challenges for the swift load change is to keep the furnace wall metal temperature low during the load change, which the advanced vertical furnace wall could realize. The report describes the features of the unit and commissioning result including load swing test results in details.

  9. Polymethylmethacrylate (PMMA) Material Test Results for the Capillary Flow Experiments (CFE)

    Science.gov (United States)

    Lerch, Bradley A.; Thesken, John C.; Bunnell, Charles T.

    2007-01-01

    In support of the Capillary Flow Experiments (CFE) program, several polymethylmethacrylate (PMMA) flight vessels were constructed. Some vessels used a multipiece design, which was chemically welded together. Due to questions regarding the effects of the experiment fluid (silicone oil) on the weld integrity, a series of tests were conducted to provide evidence of the adequacy of the current vessel design. Tensile tests were conducted on PMMA samples that were both in the as-received condition, and also aged in air or oil for up to 8 weeks. Both welded and unwelded samples were examined. Fracture of the joints was studied using notched tensile specimens and Brazilian disk tests. Results showed that aging had no effect on tensile properties. While the welded samples were weaker than the base parent material, the weld strength was found to be further degraded by bubbles in the weld zone. Finally a fracture analysis using the worst-case fracture conditions of the vessel was performed, and the vessel design was found to have a factor of three safety margin.

  10. Comision Federal de Electricdad (CFE)`s corporate pilot data store; Desarrollo piloto del almacen de datos corporativos de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez Sustaeta, Jorge; Rodriguez Ortiz, Guillermo; Jacome Grajales, Norma Elena; Perez Ramirez, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    The objective of a data store is to permit the access to organizational or corporate data, to offer congruent data, to permit the separation or combination of data from the enterprise`s different points of view, to supply tools for interrogating, to analyze and present information quickly and to feed the re-engineering criteria of the enterprise. In this paper a project is described with two main objectives: first, to develop a pilot version of the corporate data store, considering data coming from diverse operational systems in the electric generation process, such as: SISTERMO (managing indexes of thermoelectric power generation), SISHIDRO (managing indexes for hydroelectric generation) and CB (fuel costs); and second, train its personnel in the development of methodologies and techniques of data storing, in order to prepare them to achieve the project with their own resources [Espanol] Los objetivos de un almacen de datos son permitir el acceso a datos organizacionales o corporativos, brindar datos congruentes, permitir separar o combinar datos desde los diversos puntos de vista de la empresa, proporcionar herramientas para interrogar, analizar y presentar informacion agilmente y alimentar los criterios de reingenieria de la empresa. En este articulo se describe un proyecto con dos objetivos principales: primero, desarrollar una version piloto del almacen de datos corporativos, considerando datos provenientes de diversos sistemas operacionales en el proceso de generacion de energia electrica, tales como: SISTERMO (indices de gestion de generacion termoelectrica), SISHIDRO (indices de gestion de generacion hidroelectrica) y CB (costos de combustible); y segundo, capacitar a su personal en las metodologias y tecnicas de desarrollo de almacenes de datos, con el fin de prepararlos para la consecucion del proyecto con sus propios recursos

  11. APS (Arizona Public Service Company)/CFE (Comision Federal de Electricidad) renewable energy mini-grid project in Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Mathai, C.V. [Arizona Public Service Co., Phoenix, AZ (United States)

    1998-09-01

    Arizona Public Service Company (APS) and Comision Federal de Electridad (CFE), the national electric utility of Mexico, have been collaborating over the past two years to assess the feasibility of using renewable energy technologies (solar and wind) for rural electrification. Mexico has thousands of remote villages that are not connected to the national electricity grid. President Zedillo`s Social Development Plan calls for electrifying these villages with the goal of improving the villagers` standard of living. APS and CFE have been monitoring solar and wind resources in several candidate villages in the states of Sonora and Baja California Sur (BCS) in Northwestern Mexico, and have selected San Juanico in BCS for a pilot project. Under this pilot project, the existing diesel generator and distribution system will be retrofitted with a hybrid (solar/wind/diesel) system that will have at least 2/3 of the total power generated coming from renewable energy resources. It will reduce operational costs as well as CO{sub 2} and other air pollution emissions. It will be the largest system of its kind on the American Continent. It is estimated that the hybrid system will reduce the CO{sub 2} emissions by 80%, compared to emissions from use of the existing diesel generator to provide the same energy. It is expected that the pilot project will be implemented by the end of 1997. (author)

  12. Development of a prototype of a Master Central Unit (MCU) for the automation of Distribution Control Centers; Desarrollo de un prototipo de Unidad Central Maestra (UCM) para la automatizacion de Centros de Control de Distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Uribe Blanco, Carlos Eduardo; Mata Almanza, Rafael; Picasso Blanquel, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2011-07-01

    For the purpose of contributing to the strategic plan and to the improvement of productivity and competitiveness levels, the Federal Electric Commission (CFE, Spanish acronym) is making a significant investment in human resources and materials to modernize electric energy supply systems, including monitoring, protection and automatic control for operating all the elements of the electrical process, from generating plants to transmission lines, distribution systems and commercial applications. With this modernization, the CFE is also creating the infrastructure for the interoperability and interconnectivity of the above systems, in such a way to enable it to broaden, continue and complement the functional integration of the linked institutional systems of the latest generation. The total integration of the systems will allow the CFE to move toward Intelligent Electric Networks. Therefore, the CFE requested help from the Electric Research Institute (IIE, Spanish acronym) to develop part of the infrastructure to modernize the automation of distribution. This consists of the development of a prototype of the supervision and control system, using interoperable open technology owned by the CFE which enables using the functions of a SCADA system (Supervisory Control And Data Acquisition) to supervise and control electric distribution networks. [Spanish] Con el proposito de contribuir al plan estrategico y mejoramiento de los niveles de productividad y competitividad, la Comision Federal de Electricidad (CFE) esta invirtiendo fuertemente en recursos humanos y materiales para la modernizacion de los sistemas de suministro de energia electrica, incluyendo el monitoreo, proteccion y control automatico para la operacion de todos los elementos del proceso electrico, desde los centros de generacion hasta las lineas de transmision, los sistemas de distribucion y las aplicaciones de comercializacion. Con dicha modernizacion, la CFE tambien esta generando la infraestructura para la

  13. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  14. Recent nuclear technology advances of GE-H and GNF in partnership with CFE's Laguna Verde 2

    Energy Technology Data Exchange (ETDEWEB)

    Cuevas V, G.; Iwamoto, T.; Banfield, J. [GE-Hitachi Nuclear Energy Americas LLC, Global Nuclear Fuel - Americas LLC, 3901 Castle Hayne Road, Wilmington, 28401 North Carolina (United States); Calleros M, G., E-mail: Gabriel.Cuevas-Vivas@age.com [Comision Federal de Electricidad, Central Nucleoelectrica de Laguna Verde, Carretera Veracruz-Nautla Km 42.5, Alto Lucero, Veracruz (Mexico)

    2015-09-15

    This paper is presented based on work stemming from the long-standing technical partnership between Comision Federal de Electricidad (CFE) and Global Nuclear Fuel - Americas LLC (GNF), and this paper's purpose is to provide valuable information for the nuclear industry. First, a one-to-one comparison of measurements from Gamma Thermometers (G Ts) installed in Laguna Verde 2 (LV-2) core against axially corresponding Traverse In-core Probe (Tip) measurements is remarkably close. This longest running G T plant validation for the Economic Simplified Boiling Water Reactor (ESBWR) power monitoring devices is also proving that the devices have the potential to simplify power measurements in Boiling Water Reactors (BWRs). Second, code validation results show remarkable reduction of radial power uncertainty with respect to current technology when new GNF codes for three-dimensional core simulations are compared to Tip power measurements. The LV-2 core is of paramount importance for BWR data analysis since the core has been loaded from the start of operation with different GNF fuel bundle types, fuel management has been designed with GNF codes and on-line core monitoring has been performed with GNF's 3-Dimensional Monicore system. This validation is also reliable since gamma Tips are used for local power measurements rather than thermal neutron Tips, which are more sensitive to local turbulence and positional changes. A nuclear/thermal-hydraulic core simulation of GNF fuel is undertaken from the beginning of operation of LV-2 (cycle 1) through the range of different power scenarios including low power, original licensed thermal power, power up rate and extended power up rate. Results confirm the conclusions from previous validations in different BWRs and support GNF efforts for licensing the new generation of nuclear engineering codes. (Author)

  15. Recent nuclear technology advances of GE-H and GNF in partnership with CFE's Laguna Verde 2

    International Nuclear Information System (INIS)

    This paper is presented based on work stemming from the long-standing technical partnership between Comision Federal de Electricidad (CFE) and Global Nuclear Fuel - Americas LLC (GNF), and this paper's purpose is to provide valuable information for the nuclear industry. First, a one-to-one comparison of measurements from Gamma Thermometers (G Ts) installed in Laguna Verde 2 (LV-2) core against axially corresponding Traverse In-core Probe (Tip) measurements is remarkably close. This longest running G T plant validation for the Economic Simplified Boiling Water Reactor (ESBWR) power monitoring devices is also proving that the devices have the potential to simplify power measurements in Boiling Water Reactors (BWRs). Second, code validation results show remarkable reduction of radial power uncertainty with respect to current technology when new GNF codes for three-dimensional core simulations are compared to Tip power measurements. The LV-2 core is of paramount importance for BWR data analysis since the core has been loaded from the start of operation with different GNF fuel bundle types, fuel management has been designed with GNF codes and on-line core monitoring has been performed with GNF's 3-Dimensional Monicore system. This validation is also reliable since gamma Tips are used for local power measurements rather than thermal neutron Tips, which are more sensitive to local turbulence and positional changes. A nuclear/thermal-hydraulic core simulation of GNF fuel is undertaken from the beginning of operation of LV-2 (cycle 1) through the range of different power scenarios including low power, original licensed thermal power, power up rate and extended power up rate. Results confirm the conclusions from previous validations in different BWRs and support GNF efforts for licensing the new generation of nuclear engineering codes. (Author)

  16. Co-generation system with integrated functions of active filter; Sistema de cogeneracion con funciones de filtro activo integradas

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez Grajales, Humberto Raul

    2002-07-15

    adaptive interference. This technique maintains the system in the best functional state, by means of continuous self adjustment facing changes in the operation parameters, generating important and satisfactory results. In addition, simultaneously the PVS uses, in the pursuit of the point of maximum power, the technique of {sup d}isturb and observe{sup ,} which offers a high performance in the injection of active power. [Spanish] Sin duda, la energia electrica es la forma de energia mas ampliamente usada en las actividades economicas y sociales de nuestro mundo moderno. Por ello, se puede decir que las companias generadoras y distribuidoras de electricidad asumen dos retos de relevante preocupacion actual. Uno es generar con mayor eficiencia, menor costo y con un minimo impacto sobre el medio ambiente. El segundo es cumplir con la calidad del suministro, que ha llegado a ser un punto importante tanto para los usuarios como para las companias que distribuyen la energia electrica, y que se refleja en una distribucion y un consumo de energia mas eficiente. El trabajo de tesis que se presenta, describe un sistema fotovoltaico (SFV) interconectado a la red electrica que ayuda a superar los retos citados. Este SFV tiene la funcion de recibir la energia solar entregada por un arreglo de celdas FV; operar en el punto maximo de potencia de las celdas (para mayor aprovechamiento de la energia captada); acondicionarla a una senal alterna, dentro de los parametros tecnicos normativos para la interconexion electrica (establecidos por la compania; Comision Federal de Electricidad en Mexico); e inyectarla a la red electrica con el proposito de compensar potencia reactiva (filtrado activo) demandada por cargas lineales y no lineales, reduciendo la contaminacion de la red electrica; ademas de compensar potencia activa en los picos de demanda de energia electrica maxima. El sistema funciona como filtro activo durante todo el dia, lo que permite que la capacidad de potencia instalada por el

  17. Higher English for CFE

    CERN Document Server

    Bridges, Ann; Mitchell, John

    2015-01-01

    A brand new edition of the former Higher English: Close Reading , completely revised and updated for the new Higher element (Reading for Understanding, Analysis and Evaluation) - worth 30% of marks in the final exam!. We are working with SQA to secure endorsement for this title. Written by two highly experienced authors this book shows you how to practice for the Reading for Understanding, Analysis and Evaluation section of the new Higher English exam. This book introduces the terms and concepts that lie behind success and offers guidance on the interpretation of questions and targeting answer

  18. Energy cogeneration for the industrial sector. Exploration of possibilities for Bahia Blanca petrochemical complex; Cogeneracion de energia para el sector industrial. Exploracion de posibilidades para el polo petroquimico de Bahia Blanca

    Energy Technology Data Exchange (ETDEWEB)

    Salzman, Carlos H. [Buenos Aires Univ. (Argentina). Facultad de Ingenieria. Dept. de Electrotecnia; Baraychart, Rogelio [Tecnolatina S.A., Buenos Aires (Argentina)

    1997-12-31

    Many industrial plants have installed gas turbines in connection with total energy schemes. By combining a gas turbine with a steam plant, through an Independent Power Producer (IPP), increasing in overall efficiency can be archived compared to a steam plant alone. The general applications and economic considerations after privatization of Argentine Network, indicates that for power supply, combined cycle with cogeneration, is appropriate for generation, because of improving quality service, lowering capital cost improving and high efficiency. Figures are shown in this paper, for a project at the petrochemical development pole in Bahia Blanca city, located in the south of Buenos Aires Province. (author) 4 refs., 3 figs.; e-mail: gea at delec.fi.uba.ar; tecnolat at ssdnet.com.ar

  19. Simulator of a geotermoelectric unit for the training of operators; Simulador de una unidad geotermoelectrica para entrenamiento de operadores

    Energy Technology Data Exchange (ETDEWEB)

    Tavira Mondragon, Jose Antonio; Lopez Aguilera, Diana Monica; Roldan Villasana, Edgardo Javier; Rodriguez Lozano, Saul [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    1999-07-01

    The use of simulators replica in real time for operators training has demonstrated to be one of the best forms to enable the personnel of the Comision Federal de Electricidad (CFE). This article shows the basic characteristics of a simulator replica of the Cerro Prieto geotermoelectric power station of Baja California. It is expected that with this simulator 400 people between operators, shift superintendents and operation and maintenance auxiliary personnel become qualified. [Spanish] El uso de simuladores replica en tiempo real para entrenamiento de operadores de centrales generadoras ha demostrado ser una de las mejores formas de capacitar al personal de la Comision Federal de Electricidad (CFE). Este articulo muestra las caracteristicas principales de un simulador replica de la central geotermoelectrica de Cerro Prieto Baja California. Se espera que con este simulador se capaciten 400 personas entre operadores, superintendentes de turno y auxiliares de operacion y mantenimiento.

  20. System for the design of electrical distribution substations; Sistema para el diseno de subestaciones electricas de distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Zayas Perez, Benjamin Eddie; Islas Perez, Eduardo; Bahena Rada, Jessica Liliana; Romero Lima, Jesus [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra Rodriguez, Benjamin; Moreno Diaz, Humberto [Comision Federal de Electricidad (Mexico)

    2011-07-01

    The physical design of electric substations involves a variety of activities, such as developing, reviewing and performing modifications to different design proposals, estimating costs and producing documents to be integrated into an executive project. These activities are usually conducted at the Distribution Divisions of the Federal Electric Commission (CFE) through two separate processes: the development of engineering plans with computer-aided design software (CAD) and volumetric calculations for the initial budget using conventional spreadsheets. The documents are manually developed on an individual basis, without the existence of any functions to allow for automatically updating the design modifications of any of the plans. The corresponding initial budget becomes a lengthy and laborious process with the likelihood of inconsistencies among the documents. In order to optimize the design process for the public and electromechanical works of electric substations (ES) in a three-dimensional (3D) graphic environment, the IIE's Management of Process Supervision, in coordination with the CFE Distribution Subdivision, developed the System for the Design of Electric Substation Distribution (SDESD). This system makes use of the advantages of CAD3D technology to develop detail engineering, cost engineering to calculate initial budgets and virtual reality for three-dimensional interactive navigation. It is worth mentioning that this system is currently in the implementation phase at the CFE Distribution Subdivision. This article briefly describes the main stages in the development of the project, as well as the functioning and principal components of the system. [Spanish] El diseno fisico de subestaciones electricas implica una variedad de actividades, tales como elaborar, revisar y efectuar modificaciones de diferentes propuestas de diseno, estimar costos y producir documentos, para integrarlos como parte de un proyecto ejecutivo. Estas actividades usualmente se

  1. Three-phase shots and monopolar reclose in the core network of 400 kV of the Area de Control Occidental of CFE and Its normal probability of occurrence; Disparos trifasicos y de recierre monopolar en la red troncal de 400 kV del area de control occidental, CFE, y su probabilidad normal de ocurrencia

    Energy Technology Data Exchange (ETDEWEB)

    Narvaez Perez, Camilo; Garcia Conejo, Dante Aristoteles [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)]. E-mail: camilo.narvaez@cfe.gob.mx; camilo.narvaez@univa.mx; Ramirez Peredo, Patricia [Universidad de Guadalajara, Guadalajara, Jalisco (Mexico)]. E-mail: patyrape@hotmail.com; Blanco Gomez, Cesar Eduardo [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)

    2013-03-15

    The growing power demand of users, who make loads of power systems, causes the components of such systems operating near its operating limits. And the transmission line, being the most common component in these, requires a thorough analysis in regard to the probability of three-phase shots and monopolars reclosing, considering thunderstorms, the demand system time, the flows circulating in lines, maintenance on other lines and other imponderantes. This research analyzes the normal probability of occurrence of shots in the 400 kV core network of the Area de Control Occidental, CFE and its impact on studies conducted prior to the maintenance. We intend to use the methodology in the Comision Federal de Electricidad and results can be validated with data from previous years, based on a pseudo shots forecast in a given period. [Spanish] La creciente demanda de energia electrica de los usuarios que componen las cargas de los sistemas electricos de potencia, provoca que los componentes de dichos sistemas funcionen cerca de sus limites operativos. Y la linea de transmision, al ser el componente mas comun en estos, requiere de un analisis minucioso en lo que respecta a la probabilidad de disparos trifasicos y recierres monopolares, considerando tormentas electricas, la demanda horaria del sistema, los flujos que circulan en las lineas, los mantenimientos en las demas lineas y demas imponderantes. En esta investigacion se analiza la probabilidad normal de ocurrencia de disparos en la red troncal de 400 kV del Area de Control Occidental y su impacto en los estudios que se realizan previos a los mantenimientos. Se pretende utilizar la metodologia en la Comision Federal de Electricidad, y los resultados pueden ser validados con datos de los anos anteriores, ya que se hace un pseudo pronostico de disparos en un periodo dado.

  2. Thermodynamic study of residual heat from a high temperature nuclear reactor to analyze its viability in cogeneration processes; Estudio termodinamico del calor residual de un reactor nuclear de alta temperatura para analizar su viabilidad en procesos de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Santillan R, A.; Valle H, J.; Escalante, J. A., E-mail: santillanaura@gmail.com [Universidad Politecnica Metropolitana de Hidalgo, Boulevard acceso a Tolcayuca 1009, Ex-Hacienda San Javier, 43860 Tolcayuca, Hidalgo (Mexico)

    2015-09-15

    In this paper the thermodynamic study of a nuclear power plant of high temperature at gas turbine (GTHTR300) is presented for estimating the exploitable waste heat in a process of desalination of seawater. One of the most studied and viable sustainable energy for the production of electricity, without the emission of greenhouse gases, is the nuclear energy. The fourth generation nuclear power plants have greater advantages than those currently installed plants; these advantages have to do with security, increased efficiencies and feasibility to be coupled to electrical cogeneration processes. In this paper the thermodynamic study of a nuclear power plant type GTHTR300 is realized, which is selected by greater efficiencies and have optimal conditions for use in electrical cogeneration processes due to high operating temperatures, which are between 700 and 950 degrees Celsius. The aim of the study is to determine the heat losses and the work done at each stage of the system, determining where they are the greatest losses and analyzing in that processes can be taken advantage. Based on the study was appointed that most of the energy losses are in form of heat in the coolers and usually this is emitted into the atmosphere without being used. From the results a process of desalination of seawater as electrical cogeneration process is proposed. This paper contains a brief description of the operation of the nuclear power plant, focusing on operation conditions and thermodynamic characteristics for the implementation of electrical cogeneration process, a thermodynamic analysis based on mass and energy balance was developed. The results allow quantifying the losses of thermal energy and determining the optimal section for coupling of the reactor with the desalination process, seeking to have a great overall efficiency. (Author)

  3. Study of reliability for the electricity cogeneration and seawater desalination in the Northwest of Mexico; Estudio de factibilidad para la cogeneracion de electricidad y desalacion de agua de mar en el noroeste de Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez U, G. O.; Ortega C, R. F. [UNAM, Instituto de Ingenieria, 04510 Mexico D.F. (Mexico)]. email: exergiovanni@gmail.com

    2008-07-01

    The IMPULSA project of the Engineering Institute of UNAM, it has dedicated from the year 2005 to the study and development of new desalination technologies of seawater with renewable energies. The objective is to form a group of expert engineers and investigators in the desalination topics able to transform their scientific knowledge in engineering solutions, with a high grade of knowledge of the environment and the renewable energies. In the middle of 2007 was took the initiative in the IMPULSA project to study the nuclear desalination topic by its characteristics of zero gas emissions of greenhouse effect, competitive costs in the generation, operative experience and safety of the nuclear reactors, resulting attractive mainly for the desalination projects of seawater of great size. The Northwest of Mexico is particularly attractive as the appropriate site for one nuclear desalination plant of great size given its shortage of drink water and the quick growth of its population; as well as its level of tourist, agricultural and industrial activity. In this study was analyzed from a thermodynamic viewpoint, mentioning the economic aspect, the nuclear desalination according to the world experience; they were simulated some couplings and operation forms of nuclear reactors and desalination units, was made emphasis in one particularly. The objective of the study was to characterize several types and sizes of nuclear reactors of the last generation that could be coupled to a desalination technology as multi-stage distillation, type flash distillation or inverse osmosis. Specially and topic of this article, it is studied a case of the IRIS reactor of 335 MW{sub e} coupled to a MED station of nominal capacity of 140,000 m{sup 3}/day. It is utilized for this effect the DEEP 3.1 program of the IAEA to simulate the coupling and to carry out a thermodynamic and economic preliminary evaluation, as well as the THERMOFLEX simulator to reinforce and to compare the thermodynamic part. They were costs very competitive of 0.038-0.044 $/ kWh for the production of electric energy and of 0.60 at 0.77 $/ m{sup 3} for the produced water, with a lost of power in the generation of among 28 to 43 MW{sub e}. (Author)

  4. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1997-12-31

    Electricas (IIE) para la CFE con el fin de mejorar la oportunidad para manejar la informacion. El SIME captura, ordena, almacena y reporta los datos obtenidos de las mediciones en las obras con gran eficiencia y flexibilidad. Este sistema es parte de uno de mayor alcance con el que la CFE asegurara un estado optimo de operacion de sus obras civiles.

  5. Alternative analysis to increase the power in combined-cycle power plants; Analisis de alternativas para el incremento de potencia en plantas termoelectricas de Ciclo Combinado

    Energy Technology Data Exchange (ETDEWEB)

    Pacheco Cruz, Hector; Arriola Medellin, Alejandro M. [Gerencia de Procesos Termicos, Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: hpacheco@iie.org.mx; aarriola@iie.org.mx

    2010-11-15

    The electricity industry traditionally had two thermodynamic cycles for power generation: conventional steam turbine (Rankine cycle) used to supply a base load during the day, and gas turbines (Brayton cycle), for its speed response, normally used to cover peak loads. However, to provide variable peak loads, the gas turbine, as a volumetric machine is affected by the change in air density by changing the combustion temperature. This paper shows the scheme of integration of both systems, that it's known as combined cycle and the different options that would have these power plants, to maintain or increase their power in variable ambient conditions. It analyzes different options, such as: 1. Supplementary fire in the stove. 2. Air cooling intake in the gas turbine (evaporation system or mechanical system). 3. Steam injection in the combustion chamber. [Spanish] La industria electrica tradicionalmente a contado con dos ciclos termodinamicos para generacion electrica: las turbinas convencionales de vapor (ciclo de Rankine) se utilizan para suministrar una carga base durante el dia, y las turbinas de gas (ciclo de Brayton), por su rapidez de respuesta, se utilizan normalmente para cubrir las cargas pico. Sin embargo, para suministrar las cargas variables pico, la turbina a gas, por ser una maquina volumetrica, se ve afectada por el cambio de la densidad del aire de combustion al cambiar la temperatura ambiente. En este trabajo se muestra el esquema de integracion de ambos sistemas, en lo que se conoce como ciclo combinado y las diferentes opciones que tendrian estas plantas de generacion electrica para mantener o incrementar su potencia en condiciones ambiente variable. Para ello se analizan diferentes opciones, tales como: 1.- Combustion suplementaria en el recuperador de calor. 2.- Enfriamiento del aire de admision a la turbina de gas (mediante un sistema de evaporacion o mediante un sistema mecanico). 3.- Inyeccion de vapor a la camara de combustion. Palabras

  6. Training system for the maintenance of power lines of the distribution network, ALEn3D; Sistema para la capacitacion y entrenamiento para el mantenimiento de lineas de la red de distribucion, ALEn3D

    Energy Technology Data Exchange (ETDEWEB)

    Galvan Bobadilla, Israel; Perez Ramirez, Miguel; Ayala Garcia, Andres; Munoz Roman, Jaime Javier; Rodriguez Gallegos, Eric; Salgado Martinez, Marco Antonio [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra Rodriguez, Benjamin [Comision Federal de Electricidad (Mexico)

    2011-07-01

    The maintenance of power lines is a complex activity with many inherent risks. Therefore, training of personnel in this area is a priority for electric energy companies. This article presents a capacity-building system based on virtual reality developed by the Federal Electric Commission (CFE), called ALEn3D. This allows maintenance technicians to train in risk-free interactive 3D environments and to later use that knowledge with an actual installation. The work was validated by expert electricians and, therefore, the system represents a wealth of knowledge and best practices for the maintenance of distribution lines. ALEn3D was designed as a tool for self capacity-building for adults, and therefore includes usability and e-learning elements to facilitate learning and automate the students' ongoing progress. The system can be run by a personal computer, is low-cost, optimized and user friendly. It is being used in the 16 distribution divisions of the CFE. [Spanish] El mantenimiento en lineas energizadas es un actividad compleja y con muchos riesgos inherentes, por lo que la capacitacion del personal en esta area es una prioridad para las empresas de energia electrica. Este articulo presenta un sistema de capacitacion basado en realidad virtual desarrollado para la Comision Federal de Electricidad (CFE), denominado ALEn3D, el cual permite a los tecnicos de mantenimiento capacitarse en ambientes 3D interactivos libes de riesgos, para posteriormente usar esos conocimientos en una instalacion real. El trabajo fue validado por expertos electricistas, por lo tanto, el sistema es un acervo de conocimientos y mejores practicas del mantenimiento a lineas de distribucion. ALEn3D fue disenado como una herramienta de autocapacitacion para adultos, por lo que se incluyeron aspectos de usabilidad y e-learning que facilitan el aprendizaje y automatizan el seguimiento del estudiante. El sistema puede ser ejecutado en una computadora personal y es utilizado en las 16

  7. Optimum design of a self-supported power transmission tower type 2M2 for 230 kW; Diseno optimo de una torre de transmision autosoportada tipo 2M2, para 230 kW

    Energy Technology Data Exchange (ETDEWEB)

    Espejel Valdez, Eduardo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Millan Monje, Alejandro; Honk Hernandez, Wenceslao [Comision Federal de Electricidad, (CFE), Mexico, D. F. (Mexico)

    1985-12-31

    A group of specialists from the Comision Federal de Electricidad (CFE) and of the Instituto de Investigaciones Electricas (IIE) analyzes the design of various types of power transmission towers in their application stage, in order to enhance them. In this article the structural characteristics of the self-supported tower type 2M2 for 230 kV of two circuits and of suspension, are presented. [Espanol] Un grupo de especialistas de la Comision Federal de Electricidad (CFE) y del Instituto de Investigaciones Electricas (IIE) analiza el diseno de diversos tipos de torres de transmision en su etapa de aplicacion, con el fin de mejorarlos. En este articulo se presentan las caracteristicas estructurales de la torre autosoportada tipo 2M2 para 230 kV, de dos circuitos y de suspension.

  8. Measurement and control techniques for electric equipment development; Tecnicas de medicion y control para el desarrollo de equipos electricos

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Neblina, Joaquin [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1987-12-31

    In broad outlines the measuring and control techniques that are used in the electric equipment development in the short circuit laboratories, are described. In this article the utilization criteria of the traditional and modern (analogical and digital) instruments are described as well as the tendency towards the system`s integration for the automation of the measurement and control processes. Also, mention is made of the systems currently being developed at the Instituto de Investigaciones Electricas (IIE) to be applied at the Short Circuit Laboratories of Comision Federal de Electricidad (CFE) and of the IIE. [Espanol] Se describen a grandes rasgos las tecnicas de medicion y control que se emplean para el desarrollo de equipos electricos en los laboratorios de corto circuito. En este articulo se describen los criterios de utilizacion de los instrumentos tradicionales y modernos (analogicos y digitales), asi como la tendencia hacia la integracion de sistemas para la automatizacion de los procesos de medicion y control. Tambien se mencionan los sistemas que actualmente se desarrollan en el Instituto de Investigaciones Electricas (IIE) para aplicarlos en los Laboratorios de Corto Circuito de la Comision Federal de Electricidad (CFE) y del Instituto.

  9. Specification for the interconnection to a electric network of low tension of photovoltaic systems with 30 kW of capacity; Especificacion para la interconexion a la red electrica de baja tension de sistemas fotovoltaicos con capacidad hasta 30kW

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Gutierrez, Jose [Comision Federal de Electricidad, Mexico (Mexico)

    2007-06-15

    In this presentation, there are shown the details of the photovoltaic systems interconnected with the electric network (SFVI), carried out by the Mexico's Federal Electricity Commission (CFE) with the support of the Mexican Electric Research Institute (IIE). First of all, there are found the objectives of the photovoltaic system interconnected to the electric network (SFVI). Then, there are mentioned the places where such sort of systems could be installed; besides, it is shown a diagram explaining the process of such systems. At the same time, there are briefly explained the components that are necessaries for their properly operation. Some of the elements previously mentioned are: photovoltaic generator (GFV), inverter, interface, and logic circuits and the control. It is shown a diagram with the location of the electrical disconnect switches. Then, it is shortly explained the place where the SFVI should be connected and there are given some requisites that are important to fulfill in order to have everything updated. Finally, it is mentioned the methodology that should be followed in order to supervise that everything works in a properly way, this last issue is carried out by CFE. [Spanish] En esta presentacion se presentan los pormenores del sistema fotovoltaico interconectado a la red (SFVI), realizado por la Comision federal de Electricidad (CFE) con apoyo del Instituto de Investigaciones Electricas (IIE). En primer lugar, se encuentran los objetivos que tiene el uso de SFVI. Enseguida, se muestra un diagrama que explica el proceso que dichos sistemas realizan. Asimismo, se explican brevemente los elementos que, de uno u otro modo, son necesarios para el adecuado funcionamiento del SFV. Ademas, se muestra un diagrama con la ubicacion de los interruptores de desconexion. Luego, se explica escuetamente el lugar donde se debe de conectar el SFVI, ademas de algunas condiciones que se deben de cumplir para que no haya mayores contratiempos. Finalmente, se

  10. Proceedings of the 7 Annual conference of the Mexican association for the energy economy. The energy sector in Mexico: challenges and solutions. [Selected papers]; 7. Conferencia anual de la asociacion mexicana para la economia energetica. El sector energia en Mexico: retos y soluciones

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The Mexican Association for the Energy Economy (AMEE) had its VII annual conference, The energy sector in Mexico: challenges and solutions, in October, 2004. Some of the expounded topics are: technical and environmental aspects of the combined cycle power stations; analysis of the generation of electric power across biogas from sanitary landfills in Mexico; cogeneration in large power plants; methodologies for the calculation of relative efficiency: description and application of natural gas distributors in Latin American and others. [Spanish] La Asociacion Mexicana para la Economia Energetica A. C. (AMEE), llevo acabo su VII conferencia anual El sector energia en Mexico: retos y soluciones, en octubre del 2004. Algunos de los temas tratados son: Aspectos tecnicos y medioambientales de las centrales de ciclo combinado con gasificacion integrada; Analisis de la generacion de energia electrica a traves de biogas procedente de rellenos sanitarios en Mexico; Cogeneracion en grandes centrales de proceso; Metodologias para el calculo de eficiencia relativa: descripcion y aplicacion para distribuidores de gas natural en Latinoamerica y otros.

  11. Areas to explore surrounding the Cerro Prieto geothermal field, BC; Areas para exploracion en los alrededores del campo geotermico de Cerro Prieto, BC

    Energy Technology Data Exchange (ETDEWEB)

    Aguilar Dumas, Alvaro [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Residencia General de Cerro Prieto, Mexicali, Baja California (Mexico)]. E-mail: alvaro.aguilar@cfe.gob.mx

    2009-07-15

    Exploration plays an important role in tapping underground natural resources-whether water, oil, natural gas or minerals. Exploratory data allow us to learn reservoir conditions, increasing probable reserves and reservoir life span. Around the Cerro Prieto geothermal field, BC, and in the Mexicali Valley in general, exploration had almost stopped but recently was resumed by the Studies Division of Comision Federal de ELectricidad (CFE)'s Gerencia de Proyectos Geotermoelectricos. The division sent technical personnel to structurally map the northern and eastern portions of Laguna Salada. The paper offers a general outline of the main zones undergoing exploratory studies-studies perhaps culminating in siting exploratory wells to locate more geothermal resources (and ultimately producing them using binary power plants). CFE also wants to site injection wells west of the current production zone, and this is covered, as well. All activities are meant to increase the productive lifespan of the geothermal reservoir. [Spanish] Cuando se trata de la explotacion de recursos naturales del subsuelo, sea agua, gas, petroleo o minerales, la exploracion juega un papel muy importante, ya que permite conocer las condiciones del yacimiento que pudieran llevar a incrementar las reservas de los recursos explotados y extender su vida util. En las zonas aledanas al campo geotermico de Cerro Prieto, BC, y en general en el Valle de Mexicali, la exploracion estaba practicamente detenida habiendose reactivado a raiz de que la Subgerencia de Estudios de la Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad (CFE) envio personal para realizar mapeos estructurales en las porciones norte y oriente de la Laguna Salada. Este trabajo presenta un panorama general de las areas prioritarias para realizar estudios exploratorios y poder programar, con mas bases, pozos exploratorios enfocados a localizar mas recursos geotermicos, inclusive para generar energia por medio

  12. Information systems for civil engineering; Sistemas de informacion para ingenieria civil

    Energy Technology Data Exchange (ETDEWEB)

    De Buen R, Pablo R; Alvarado G, Alonso; Alaniz Q, Felipe de J; Guerrero F, Vicente A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2004-07-01

    Since its beginnings, in the Gerencia de Ingenieria Civil (GIC) of the Instituto de Investigaciones Electricas (IIE) the interest has existed to take advantage of and to promote the advantages that the appropriate use of the computerizing systems in the different tasks of civil engineering in the power sector represent. Either as a part of its infrastructure or at the request of their clients, at the GIC have been developed calculation systems for the analysis and design of special structures such as turbo-generators foundations, poles for transmission and distribution and transmission towers, in addition the information systems for the consultation and the analysis of diverse information, such as the related to the Manuals of Civil Works of the Comision Federal de Electricidad (CFE) or the relative to the existing instruments in the large dams of our country. In this article are briefly described some of the computer systems developed by the GIC in recent years. [Spanish] Desde sus inicios, en la Gerencia de Ingenieria Civil (GIC) del Instituto de Investigaciones Electricas (IIE) ha existido el interes por aprovechar y promover las ventajas que representa el uso adecuado de los sistemas de computo en las diferentes tareas de ingenieria civil en el sector energetico. Ya sea como parte de su infraestructura o a solicitud de sus clientes, en la GIC se han desarrollado sistemas de calculo para el analisis y diseno de estructuras especiales como lo son las cimentaciones de turbogeneradores, los postes para transmision y distribucion y las torres de transmision, ademas de sistemas de informacion para la consulta y el analisis de informacion diversa, como es la relacionada con los manuales de obras civiles de la Comision Federal de Electricidad (CFE) o a la relativa a los instrumentos existentes en las grandes presas de nuestro pais. En este articulo se describen brevemente algunos de los sistemas de computo desarrollos por la GIC en anos recientes.

  13. Utilization of the computational technic for the promotion and diffusion of the energy conservation practice; Utilizacion de tecnicas computacionales para promocionar y difundir el ahorro de energia

    Energy Technology Data Exchange (ETDEWEB)

    Kemper Valverde, N. [Laboratorio de Inteligencia Artificial, Instituto de Ingenieria, UNAM, Mexico D. F. (Mexico)

    1995-12-31

    In this paper are presented the developments obtained through the application of the new computational technologies in the diffusion and promotion tasks of energy efficient use and conservation. The most relevant aspects are described of three multimedia courses that were designed in order to increase the possibilities of offering personal training in efficient energy technic, as well as to have on hand totally open consulting and interactive tools. The courses that are described are: ``Design of Energy Conservation Programs for the Industry``, ``Energy Conservation in Combustion Equipment`` and ``Energy Cogeneration Technologies.`` On another subject, an analysis is also made of the possibilities for the development and application of expert systems that advise and give support to the work of technicians and engineers dedicated to energy conservation. The main characteristics of an expert system to give support to the energy analysis of lighting industrial systems, malls, buildings and hotels are also described. [Espanol] En este trabajo se presentan los desarrollos obtenidos por la aplicacion de las tareas de difusion y promocion del uso eficiente y ahorro de energia. Se describen los aspectos mas relevantes de tres cursos multimedia que fueron disenados con el objeto de incrementar las posibilidades de brindar capacitacion individualizada en tecnicas energeticas eficientes, asi como de contar con herramientas de consulta totalmente abiertas e interactivas. Los cursos que se describen son: ``Diseno de Programas de Ahorro de Energia en la Industria,`` ``Ahorro de Energia en Equipos de Combustion`` y ``Tecnologias de Cogeneracion de Energia.`` Por otro lado, tambien se hace un analisis de las posibilidades para el desarrollo y aplicacion de sistemas expertos que asesoren y apoyen el trabajo de tecnicos e ingenieros dedicados al ahorro de energia. Se describen las caracteristicas principales de un sistema experto disenado para brindar apoyo en analisis energeticos

  14. Development and application of a methodology for the classification of the operating conditions of power transformers; Desarrollo y aplicacion de una metodologia para la clasificacion del estado operativo de transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Lara Covarrubias, Hector

    2004-05-15

    This thesis work shows the development of a classification model that allows the user to assess the operative condition of power transformers. The proposed model includes the following steps: Relative weights assignation for each IEEE-62-1995 required test. Those relative weights are obtained from test results and standardized and experience based limits obtained by Comision Federal de Electricidad (CFE). Once the relative weights have been assigned, three states, green, yellow and red were defined. Each state was then ranked with a weight number (1, 2 or 3). Specific weights were assigned for each test included in the model. Test score assignation takes into account the product of the relative value and the specific weight of each test. Transformer risk assessment uses the total score obtained from the sum of the tests partial scores. Transformer risk assessment was then classified in three categories. Total score causes the system to issue maintenance or substitution recommendations. The described model will improve maintenance scheduling according the transformer risk assessment and it is fully applicable to the complete CFE power transformer population. Further, smart investment and substitution plans, can be easily obtained from the model, preventing catastrophic failures that may cause logistic and economical problems to the Mexican Power System operation. As an example, the results obtained from the model application to two transformer banks installed in a CFE hydroelectric power plant were discussed and analyzed. [Spanish] El trabajo que se muestra en esta tesis, es el desarrollo de un modelo para la clasificacion del estado operativo de los transformadores de potencia. El modelo propuesto incluye los siguientes pasos: Asignacion de pesos relativos para cada una de las pruebas establecidas en la norma IEEE-62-1995 en funcion de sus resultados, limites establecidos en la normatividad y limites propuestos con base en la experiencia de la Comision Federal de

  15. Compact fluorescent lamps, innovation for electricity saving; Lamparas fluorescentes compactas, innovacion para el ahorro de electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Rivera, Fernando [Fideicomiso para el Ahorro de Energia Electrica (Mexico); Camacho P, Wendolin E; Villalobos Alarcon, German [Phillips Lighting Mexico (Mexico)

    2007-01-15

    An extremely important resource is electricity because it has provided illumination for homes, buildings and cities in the absence of natural light. Therefore, the human being is considering to save this valuable resource by using sophisticated light bulbs. At the end of the 70's the compact fluorescent lamps appeared. In this article we can disclose the advantages and disadvantages of this technology, and how some years later of its invention, those lamps satisfied the client expectations, due to its cost, electricity saving, longer lifetime, use possibilities, and technological improvements. We can also know how Federal Electricity Commission (CFE) and The Trust Fund for Electric Energy Savings (FIDE) supported a project to favor these lamps to be in the Mexican market. [Spanish] La electricidad es un recurso de suma importancia porque ha contribuido a la iluminacion de casas, edificios y ciudades, ante la ausencia de luz natural, es por ello que se ha buscado ahorrar este recurso tan preciado con el uso de lamparas sofisticadas. Una tecnologia que aparecio a finales de los anos 70 fueron las lamparas fluorescentes compactas. En este articulo encontramos sus ventajas y desventajas, y como despues de algunos anos de su creacion comenzaron a llenar las expectativas del cliente gracias a su costo, ahorro de electricidad, mayor tiempo de vida, posibilidades de aplicacion y mejoras tecnologicas. Asi mismo podemos conocer, el proyecto que se hizo para que esta tecnologia entrara al mercado mexicano, con el apoyo de la Comision Federal de Electricidad (CFE) y del Fideicomiso para el Ahorro de Energia Electrica (FIDE).

  16. Electro-economic, environmental and social consequences in the efficient abatement of a hydroelectric plant (C. H. Santa Rosa, CFE-ACO); Consecuencias electro-economicas, ambientales y sociales del abatimiento eficiente de una central hidroelectrica (C. H. Santa Rosa, CFE-ACO)

    Energy Technology Data Exchange (ETDEWEB)

    Narvaez Perez, Camilo; Garcia Conejo, Dante Aristoteles [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)]. E-mail: camilo.narvaez@cfe.gob.mx; camilo.narvaez@univa.mx; Narvaez Perez, Claudia Universidad de Guadalajara, Zapopan, Jalisco [Mexico]). E-mail: claudia_narvaez@hotmail.com; Blanco Gomez, Cesar Eduardo [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)

    2013-03-15

    Renewable energy systems, like hydroelectric generation system gives electric energy, in reliable economic, it takes care with environment, and growths the society, if the hydroelectric dam is suitably drained in non rainy season, if we consider, flow rate in its river, rain, thunderstorms and floods, dam's size, load shape per day, generators capacity unit and the flow in turbines, generating units maintenance and other necessities like irrigation crops in farms. In this research we propose a new methodology about hydroelectric dam drained in non rainy season. But in rainy season, you can consider this methodology with few changes and you would obtain satisfactory results. The methodology is used since 2010 in the Area de Control Occidental in the Comision Federal de Electricidad with results compared with data from previous years, in which different methodologies were applied. [Spanish] Los sistemas de energias renovables, como los complejos hidroelectricos impactan de manera electrica, economica, ambiental y social, siempre y cuando se realice adecuadamente el abatimiento de la presa en el estiaje, considerando, el aporte del cauce, las lluvias aun siendo escasas, el tamano del embalse, la demanda horaria de la carga abastecida, el tamano de los generadores y su gasto turbinado, los mantenimientos de las unidades, las necesidades hidraulicas aguas abajo y demas imponderantes. En esta investigacion se propone una metodologia de abatimiento de presas de centrales hidroelectricas en estiaje. Y para tiempo de lluvias se aplica la metodologia con variantes pequenas y con resultados satisfactorios. La metodologia es utilizada desde el 2010 en el Area de Control Occidental de la Comision Federal de Electricidad, con resultados comparados con los datos de los anos anteriores, en los cuales se aplicaron metodologias diversas.

  17. Burner redesign for the reduction of the unburned particulate emission in thermal power stations of Comision Federal de Electricidad; Rediseno de quemadores para la reduccion de la emision de particulas inquemadas en centrales termicas de la Comisionon Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Huerta Espino, Mario; Espipnoza Garza, Jesus; Mani Gonzalez, Alejandro; Giles Alarcon, Armando; Pena Garcia, Adriana; Albarran Sanchez, Irma L.; Mendez Aranda, Angel [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    In the presence of the increasing demand for reaching higher efficiencies and a smaller production of polluting emissions in combustion systems, studies focused to the optimization of the present designs of burners are required. The Comision Federal de Electricidad (CFE) and the Instituto de Investigaciones Electricas (IIE) have established a project that contemplates the redesign of burners in ten of its units of thermoelectric generation. In this work the redesign of the flame stabilizer or diffuser for the reduction of the unburned particulate emission is explained. The results of the modeling of a burner of rotational flow of steam generators of the CFE are shown, as well as the graphs of the contours of the recirculation zone generated by each diffuser without combustion and a figure of the velocity profile that is generated in front of the diffuser. In agreement with the results obtained in the aerodynamic evaluation of frontal burners of rotational flow, it is possible to established that the characteristics of the recirculation zone, generated by this type of burners, are related to geometric parameters of the diffuser that identify with the number of turns and the pressure drop, where it is necessary to look for designs that improve the conditions of the mixing process and combustion in the burner. [Spanish] Ante la creciente demanda por alcanzar mayores eficiencias y una menor produccion de emisiones contaminantes en sistemas de combustion, se requieren estudios enfocados a la optimizacion de los disenos actuales de quemadores. La Comision Federal de Electricidad (CFE) y el Instituto de Investigaciones Electricas (IIE) han establecido un proyecto que contempla el rediseno de quemadores en diez de sus unidades de generacion termoelectrica. En este trabajo se explica el rediseno del estabilizador de flama o difusor para la reduccion de la emision de particulas inquemadas. Se muestran los resultados de la modelacion de un quemador de flujo rotacional de

  18. Supervisory system for real time monitoring of transient thermal stresses in turbines rotors; Sistema supervisorio para el monitoreo en tiempo real de esfuerzos termicos transitorios en rotores de turbinas

    Energy Technology Data Exchange (ETDEWEB)

    Urquiza Beltran, Gustavo; Rios Miranda, Edmundo; Venegas Guzman, Ricardo; Alvarez Garcia, Gabriela [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1991-12-31

    This article presents a supervisory system that, as its main functions, assists the operator on base of the thermal stresses, monitoring in real time the high pressure (HP) and intermediate pressure rotors (IP) of a steam turbine during the start, shut down and/or sudden load changes. The system is based on a thermal model uni-dimensional integrated to the SIMPER (Information System for the Predictive Maintenance of Rotating Equipment), tested in a 300 MW unit of Comision Federal de Electricidad (CFE). [Espanol] En este articulo se presenta un sistema supervisorio que, como funciones principales, asiste al operador con base en el monitoreo de esfuerzos termicos en tiempo real en los rotores de presion alta (PA) y presion intermedia (PI) de una turbina de vapor durante un arranque, paro y/o variaciones bruscas de carga. El sistema esta basado en un modelo termico unidimensional integrado al SIMPER (sistema informatico para el mantenimiento predictivo de equipo rotatorio), experimentado en una unidad de 300 MW de la Comision Federal de Electricidad (CFE).

  19. On-line monitoring for the detection and prevention of faults in the power transformers; Monitoreo en linea para la deteccion y prevencion de fallas en transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Tagle, Alfredo; Equihua Tapia, Hugo [Comision Federal de Electricidad (Mexico); Linan Garcia, Roberto; Pascacio de los Santos, Alberth; Nunez Dominguez, Arturo [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2000-07-01

    Power transformers are held to thermal, electrical and mechanical efforts, which degrade the isolation system oil/paper. So that to detect incipient degradations in transformers with more than 25 years of service installed in the transmission network of Commission Federal de Electricidad (CFE). The Instituto de Investigaciones Electricas (IIE), developed and installed six on-line Monitoring Systems for Power Transformers (SMLTP). The systems are installed at the substations Puebla II, banks AT-1 and AT-2, Malpaso II, bank, AT-1 and phase B of bank AT-1 of the electrical substation Villa de Garcia. [Spanish] Los transformadores de potencia estan sujetos a esfuerzos termicos, electricos y mecanicos, los cuales degradan el sistema de aislamiento aceite/papel. De modo que con el proposito de detectar degradaciones incipientes en transformadores con mas de 25 anos de servicio instalado en la red de transmision de la Comision Federal de Electricidad (CFE). El Instituto de Investigaciones Electricas (IIE), desarrollo e instalo seis Sistemas de Monitoreo en Linea para Transformadores de Potencia (SMLTP). Los sistemas se encuentran en las subestaciones Puebla II, bancos AT-1 y AT-2, Malpaso II, banco, AT-1 y fase B del banco AT-1 de la subestacion electrica Villa de Garcia.

  20. Methodology to establish the profile that defines a meta-specification that applies to distribution substations - Mexico case based on norm IEC-61850; Metodologia para establecer el perfil que define una meta-especificacion que aplica a subestaciones de distribucion -caso Mexico- basada en la norma IEC-61850

    Energy Technology Data Exchange (ETDEWEB)

    Picazo Blanquel, Cuitlahuac; Chairez Campos Carlos; Garcia Hernandez, Joaquin; Godinez Enriquez, Hebert; Poujol Galvan, Francisco C.; Suarez Cerda, Dionisio A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Villalobos Ramos, Andres; LLamas Gonzalez, Rosa E. [Comision Federal de Electricidad (Mexico); Samitier Otero, Carlos [Global Networking Engineering (Spain)

    2010-07-01

    In this article is presented a case of study of automation of electrical substations of Comision Federal de Electricidad (CFE) of Mexico, in which the Norm IEC-61850 has been taken as reference. The case of study consists of defining a metaspecification for the protection, control, measurement and communication systems required by the substations of electrical distribution. For the development the obtained previous experience in the development of a bequeathed system SA, norm IEC61850 has been taken as reference, as well as the experiences documented in the Instituto de Investigaciones Electricas (IIE), the Comision Federal de Electricidad (CFE) and Global Networking Engineering (GNE), Spain. This way, the obtained result is the metaspecification, which establishes the application of the control, protective equipment and measurement under the interoperability concepts, as well as the automation functions of substations applied in the intelligent networks (REI's). The methodology put into practice includes the design of the system architecture (SAS), the operation philosophy, the topology of the communications network, the data modeling one with logical nodes that include data types and classes of common data (CDC), transference of information, and administration of the archives ICD, SSD, SCD, and CID. [Spanish] En este articulo se presenta un caso de estudio de automatizacion de subestaciones electricas de la Comision Federal de Electricidad (CFE) de Mexico, en el cual se ha tomado como referencia la norma IEC-61850. El caso de estudio consiste en definir una metaespecificacion para los sistemas proteccion, control, medicion y comunicaciones requeridos por las subestaciones de distribucion electrica. Para el desarrollo se ha tomado como referencia la experiencia previa obtenida en el desarrollo de un sistema SA legado, la norma IEC61850, asi como las experiencias documentadas en el Instituto de Investigaciones Electricas (IIE), la Comision Federal de

  1. para palmito

    Directory of Open Access Journals (Sweden)

    Francisco Paulo Chaimsohn

    2007-01-01

    Full Text Available Densidades de siembra, arreglos espaciales y fertilización en pejibaye (Bactris gasipaes cv Diamantes-10 para palmito. La investigación se llevó a cabo en la Estación Experimental Los Diamantes (Guápiles, Costa Rica, el 3 de octubre del 2003, cuyo objetivo fue la evaluación del efecto de diferentes densidades de siembra (3.333, 5.000 y 6.666 plantas/ha, arreglos espaciales, y diversos métodos de fertilización (química, orgánica, sobre el crecimiento de las plantas de pejibaye para producción de palmito. Se consideraron las variables diámetro y altura del tallo primario y el número de hojas y rebrotes como indicadores de producción. El período de evolución abarcó sólo los primeros 25 meses de crecimiento en el campo. El número de hojas, la altura y el diámetro del tallo no mostraron diferencias de respuesta relevantes. Sólo el número de rebrotes disminuyó al aumentar la densidad de la población, cuando se midió a los 15 meses de edad. El efecto de la fertilización se hizo evidente después de la primera cosecha, realizada a los 20 meses, debido al aumento de la competencia entre plantas, ahora más desarrolladas. Fue entonces cuando la fertilización química indujo la producción de un mayor número y vigor de los rebrotes. Sin embargo, las prácticas evaluadas 25 meses después de la siembra, no habían infl uido hasta ese momento en el número de palmitos cosechados, ni tampoco había afectado las características físicas de los sectores foliar y caulinar del palmito.

  2. Para Leer

    Directory of Open Access Journals (Sweden)

    Adela Sanz Cañibano

    2012-01-01

    Full Text Available Jorge L. Tizón, Ramón Ciurana, M del Carmen Fernández (Comps. Libro de casos. Promoción de la salud mental desde la atención primaria. (Adela Sanz Cañibano Grupo de Expertos en Competencia Intercultural. Instrumento para la valoración de la Competencia Intercultural en la Atención en salud mental. Hacia la equidad en salud. (María Goretti Morón Nozaleda Mariano Hernández Monsalve y Pilar Nieto Degregori (Coords.. Psicoterapia y Rehabilitación de pacientes con psicosis. (Francisco Chicharro Lezcano André du Laurens. De las enfermedades melancólicas. Jourdain Guibelet. Del humor melancólico. (Iñaki Markez Julio José? Segarra Valls. Léxico psico(patológico en la obra de Carlos Castilla del Pino. (Eudoxia Gay Pamos Giorgio Nardone y Alessandro Salvini. El diálogo estratégico. (Fernando Mansilla Izquierdo Michel Foucault. Leçons sur la volonté de savoir, suivi de Le savoir d'Edipe. (Mauricio Jalón Camilo Castelo Branco. La novela de un hombre rico. (Alicia Merisi Kenzaburo Oé. Cuadernos de Hiroshima. (Mauricio Jalón Pascal Quignard. Les solidarités mystérieuses. (Beatriz A. Rubín Documentos en la red (Juan Medrano

  3. Nuclear reactor PBMR and cogeneration; Reactor nuclear PBMR y cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez S, J. R.; Alonso V, G., E-mail: ramon.ramirez@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2013-10-15

    In recent years the nuclear reactor designs for the electricity generation have increased their costs, so that at the moment costs are managed of around the 5000 US D for installed kw, reason for which a big nuclear plant requires of investments of the order of billions of dollars, the designed reactors as modular of low power seek to lighten the initial investment of a big reactor dividing the power in parts and dividing in modules the components to lower the production costs, this way it can begin to build a module and finished this to build other, differing the long term investment, getting less risk therefore in the investment. On the other hand the reactors of low power can be very useful in regions where is difficult to have access to the electric net being able to take advantage of the thermal energy of the reactor to feed other processes like the water desalination or the vapor generation for the processes industry like the petrochemical, or even more the possible hydrogen production to be used as fuel. In this work the possibility to generate vapor of high quality for the petrochemical industry is described using a spheres bed reactor of high temperature. (Author)

  4. Percepción en relación a la cultura acumulada producto de la cultura organizacional y cultura de calidad y tecnológica. El caso de la CFE

    OpenAIRE

    Angel Vallejo Alarcon

    2012-01-01

    Las capacidades culturales son el vehículo en el cual se deben compartir tanto en el desarrollo de las actividades en los centros de trabajo como un sistema de conductas producto de la múltiple cultura de los miembros de la organización. Todo ello para consolidar una cultura sobre la percepción hacia la empresa competitiva en el ámbito de clase mundial. En un contexto global, las organizaciones empresariales viven un ambiente altamente competido y sólo con atributos necesarios de mejora conti...

  5. Computerized procedure for protection coordination in distribution primary circuits; Procedimiento computarizado para coordinacion de protecciones en circuitos primarios de distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Carrillo, Victor M.; Velazquez Sanchez, Raul [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1986-12-31

    Nowadays, the method employed to study the protection coordination are based in the hand outlining of curves time- current and in the visual comparison in log sheets. Due to the large amount of distribution circuits, the engineer makes a considerable effort to perform this type of studies, which besides are routinist and time consuming. In this article a program for the computer aided design for the protection coordination in primary distribution circuits is presented. Such a program -carried out in the Transmission and Distribution Department of the Power Systems Division of the Instituto de Investigaciones Electricas (IIE)- substitutes in an efficient manner, the manual procedures that are performed in the protection coordination studies. The coordination principles, suggested by the equipment manufacturers, were respected, trying, at the same time, to keep the procedures of the Comision Federal de Electricidad personnel (CFE) emerged from the field experience. The algorithm basically consists of an iterative process in the selection of the adjustments taking as a reference the of three-phase short- circuit and of phase to ground, values, as well as the operating times. [Espanol] Actualmente, los metodos que se emplean para estudiar la coordinacion de protecciones se basan en el trazado manual de curvas de tiempo-corriente y en la comparacion visual sobre hojas logaritmicas. Debido a la gran cantidad de circuitos de distribucion, el ingeniero hace un esfuerzo considerable para realizar este tipo de estudios, los que ademas, son rutinarios y tardados. En este articulo, se presenta un programa para el diseno asistido por computadora del proceso de coordinacion de protecciones en circuitos primarios de distribucion. Dicho programa -realizado en el Departamento de Transmision y Distribucion, de la Division de Sistemas de Potencia, del Instituto de Investigaciones Electricas (IIE)- sustituye de manera eficaz los procedimientos manuales que se efectuan en los estudios

  6. El liberalsocialismo para Bobbio y para nosotros

    OpenAIRE

    Bovero, Michelangelo

    2006-01-01

    Partiendo de las ideas sobre el liberalsocialismo en el pensamiento de Norberto BOBBIO y hallando en el ámbito del constitucionalismo el terreno propicio, no ya para un compromiso, sino para una forma de reconciliación entre la tradición liberal y la socialista, el autor propone una caracterización del liberalsocialismo articulada en dos niveles: en un “liberalsocialismo mínimo” (o liberalsocialismo para la democracia), entendido como un “mínimo indispensable para la democracia”, y en un “lib...

  7. Modernization of the subsystem man-machine interface for operation of the combined cycle central of Gomez Palacio; Modernizacion del subsistema de interfaz hombre-maquina para operacion de la central de ciclo combinado de Gomez Palacio

    Energy Technology Data Exchange (ETDEWEB)

    Rivas S, Alfonso; Uribe B, Carlos E; Alvarez C, Victor [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2002-07-01

    In order to take care of the modernization of the Combined Cycle Central of Gomez Palacio (CCCGP) of the Comision Federal de Electricidad (CFE), the Instituto de Investigaciones Electricas (IIE), through the Management of Supervision of Processes (GSP) developed the subsystem of Interface Man-Machine (IMM), to replace the workstations that are deteriorated and obsolete by personal computers, maintaining the same functions of the IMM of the present system, including the management and processing functions that at the present time another system makes. Also, to replace the equipment of the concentrators of communications by a PC with greater capacity, than allows improving in general the flexibility and robustness of the system. Among the main functions integrated in the IMM subsystem there are: the communications master with the controllers (equipment SAC), redundancy of servers, database, historical registry storage, alarm management, tabulations, tendency graphs in real time and historical, process diagrams and Control Panels. [Spanish] Con el objeto de atender las necesidades de modernizacion de la Central de Ciclo Combinado Gomez Palacio (CCCGP) de la Comision Federal de Electricidad (CFE), el Instituto de Investigaciones Electricas (IIE), a traves de la Gerencia de Supervision de Procesos (GSP) desarrollo el subsistema de Interfaz Hmbre-Maquina (IHM), para reemplazar las estaciones de trabajo que se encuentran deterioradas y obsoletas por computadoras personales, manteniendo las mismas funciones de la IHM del sistema actual, incluyendo las funciones de administracion y procesamiento que en la actualidad realiza otro sistema. Asimismo, para reemplazar los equipos de los concentradores de comunicaciones por PC con mayor capacidad, que permitan mejorar la flexibilidad y robustez del sistema en general. Entre las principales funciones integradas en el subsistema de IHM se encuentran: el Maestro de comunicaciones con los controladores (equipo SAC), redundancia de

  8. Feasibility. Technical and financial concepts to determine the feasibility of a self-supplying project; Factibilidad. Conceptos tecnicos y financieros para determinar la factibilidad de un proyecto de autoabastecimiento

    Energy Technology Data Exchange (ETDEWEB)

    Vargas A, Enrique [IGSA S.A. de C.V. (Mexico)

    2005-07-01

    The co-generation is the transformation of an energy source to two or more forms. This document deals with the co-generation equipment: gas turbines, steam turbines and reciprocating motors. It also provides a comparison between turbines and motors altogether with an analysis determining how the savings in the co-generation are obtained -an analysis dealing with thermal balance, the advantage of the radiation, the heat of the oil, the heat of the coolant, the exhaust heat and the production cost of 1 kwh. [Spanish] La cogeneracion es la transformacion de una fuente de energia a dos o mas formas. En este documento se analizan los equipos de cogeneracion: turbinas de gas, turbinas de vapor y motores reciprocantes, de la comparacion entre turbinas y motores, de como se logran los ahorros en la cogeneracion, del balance termico, el aprovechamiento de la radiacion, del calor del aceite, del calor del refrigerante, del calor del escape y del costo en la produccion de 1 kwh.

  9. Implementation of the design attendent by computers (CAD) for the location of structures of power transmission lines; Implementacion del diseno asistido por computadora para la localizacion de estructuras de lineas de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Vega Ortiz, Miguel; Gutierrez Arriola, Gustavo [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2000-07-01

    In order that the tools of CAD (Design Attended by Computer) that are offered in the market are really useful, they must combine the criteria and experiences of the expert designers with the specifications and practices established in the electrical company. This includes, from the introduction to the information system of the available input data and its design criteria, to obtaining the required output information. In the present work the methodology developed by the Instituto de Investigaciones Electricas (IIE) in the design of power transmission lines that integrates the Comision Federal de Electricidad (CFE) requirements in the design of its transmission power lines is an advanced computer tool that results in obtaining better designs. Some of the most important aspects are the reduction of the used working time, the cost of the designed line, its reliability, the flexibility in the information handling and the quality of presentation. [Spanish] Para que las herramientas de diseno asistido por computadora que se ofrecen en el mercado sean realmente utiles deben conjuntar los criterios y experiencias de los disenadores expertos con las especificaciones y practicas establecidas en la empresa electrica. Esto incluye desde la introduccion al sistema de la informacion de datos de entrada de la que se dispone y de sus criterios de diseno hasta la obtencion de la informacion de salida que se requiere. En el presente trabajo se resume la metodologia desarrollada por el Instituto de Investigaciones Electricas (IIE) en el diseno de lineas de transmision, que integra los requerimientos de la Comision Federal de Electricidad (CFE) en el diseno de sus lineas de transmision en una herramienta de computo avanzada y que redunda en la obtencion de mejores disenos. Algunos de los aspectos mas importantes son la reduccion del tiempo de trabajo empleado, el costo de la linea disenada, su confiabilidad, la flexibilidad en el manejo de informacion y la calidad de presentacion.

  10. Generalized conventional and intelligent supervisory control system for combined cycle generation power plants; Sistema de control supervisorio generalizado convencional e inteligente para centrales de generacion de ciclo combinado

    Energy Technology Data Exchange (ETDEWEB)

    Martinez Morales, Miguel Angel

    2004-12-15

    (conventional or intelligent) is possible to get more power generation than if we use the automatic methods based on feedback MW control. Consequently, the financial benefit due to the MW generated along a period of 2 months, is equivalent to return the investment required if the CCPP would had been repowered. Test also showed that with the fuzzy based SGC is possible to get a 'little more' power generation than if we use the PID based SGC. The development and implementation of the SGC was made in three phases: First Phase: Upgrading of the simulation dynamic mathematical model and implementation in a new software platform based on LabWindows/CVI. Second Phase: Design, implementation and testing of the PID based SGC. Third Phase: Design and implementation and testing of the Intelligent SGC, based in fuzzy logic. [Spanish] El programa de obras de generacion de la Comision Federal de Electricidad (CFE) del ano 2004 al ano 2008 esta caracterizado por el dominio del proceso de ciclo combinado para la expansion de generacion de energia en Mexico [CFE, 2000]. De acuerdo con los datos presentados por esta fuente, el incremento estimado en la capacidad de generacion de potencia electrica es de 12876 MW, de los cuales las centrales de ciclo combinado aportaran 10655 MW, lo que representa el 82.75%. Bajo estas expectativas de expansion de generacion de energia en Mexico, en este trabajo de tesis se desarrollo un sistema de control supervisorio generalizado (CSG) convencional (PID) e inteligente (logica difusa) para una central de generacion de ciclo combinado, el cual permite lograr la operacion optima de la planta a traves del arranque automatico de las unidades generadoras y obtener la maxima cantidad posible de potencia electrica en forma automatica y segura. Para el desarrollo del CSG se implanto un lazo de control por temperatura para el sistema de turbina de gas (TG) y un lazo de control por presion estrangulada para la turbina de vapor (TV). El diseno de estos sistemas

  11. Dicty_cDB: CFE377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Zea mays subsp. mays genomic clone ZMMBBb0184K13 3', genomic survey sequence. 48 0.073 1 AC123243 |AC123243...8708.1 CH240_68A20.TV CHORI-240 Bos taurus genomic clone CH240_68A20, genomic survey...red pieces. 46 0.29 1 CC707724 |CC707724.1 OGOBO77TH ZM_0.7_1.5_KB Zea mays genomic clone ZMMBMa0347M09, genomic survey... sequence. 46 0.29 1 CG374571 |CG374571.1 OG2AL08TV ZM_0.7_1.5_KB Zea mays genomic clone ZMMBMa0743B16, genomic survey...BBc Zea mays subsp. mays genomic clone ZMMBBc0527F12 5', genomic survey sequence. 46 0.29 1 AQ844800 |AQ8448

  12. Dicty_cDB: CFE215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , *** SEQUENCING IN PROGRESS ***, 20 unordered pieces. 48 0.12 1 CF974266 |CF974266.1 PSU_nep1G03 Defense-related ESTs from Cacao Lea...ves Theobroma cacao cDNA, mRNA sequence. 44 1.9 1 AC1450

  13. Dicty_cDB: CFE837 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AJ410884 |AJ410884.1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1)) partial N1NA gene for Neuramini...dase, genomic RNA. 42 0.43 2 AJ410883 |AJ410883.1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1)) par

  14. Higher English language for CFE answers and marking schemes

    CERN Document Server

    Firth, Mary M; Mitchell, John

    2015-01-01

    A book of extremely detailed suggested marking instructions to use alongside the student book. This book of suggested answers offers extremely detailed marking instructions to use alongside the student book, that highlight where students can gain - or lose - the extra marks that influence grade awards. This book is photocopiable within the institution of purchase. The student book book provides you with the support and advice you will need to succeed in Higher English. By studying literary techniques and with top experts guiding you through and explaining how to use these skills, you wi

  15. Dicty_cDB: CFE454 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lhfihlqvicipl liifghvivsltktvdsvhlnaimpvsmqfsrppmrsstvmntcfhyfiledpl*mfeie llitvd...e B: kliiffifiiynlislif*wqn*k*lfil**ffvvvsnflldtkrrllhfihlqvicipl liifghvivsltktvdsvhlnaimpvsmqfsrppmrsstvmn

  16. Dicty_cDB: CFE844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA for GDP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEM...OR. ;, mRNA sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184...1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-15.... ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYST

  17. Dicty_cDB: CFE810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tica HM1:IMSS enolase (enl-1) mRNA, complete cds. 56 6e-24 5 BD183626 |BD183626.1 Material for diagnosing...5 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 3e

  18. Technical and economical assessment of the options for energy saving in the library of the Universidad Autonoma Metropolitana-Azcapotzalco; Evaluacion tecnico economica de opciones para el ahorro de energia en la biblioteca de la Universidad Autonoma Metropolitana-Azcapotzalco

    Energy Technology Data Exchange (ETDEWEB)

    Bratu, N.; Campero, E.; Dorantes, R.; Fuentes, V.; Figueroa, A.; Garcia, R.; Zekkour, A. [Universidad Autonoma Metropolitana-Azcapotzalco, Mexico, D. F. (Mexico)

    1993-12-31

    This paper presents a diagnosis of the electrical energy consumption in the library of the Azcapotzalco Unit of the Universidad Autonoma Metropolitana, to determine the actions that can be implemented for energy conservation. This without disturbing the lighting and thermal comfort. The analysis showed that, by changing the reflecting surfaces of the lighting lamps, the number of units can be reduced, without lowering the illumination level below the recommended values. The saving was estimated for replacement of the fluorescent lamps for others of metallic halogenides in the areas where the ceiling is high; for the installation of switches to improve the selectivity in turning on and turning off the lamps, achieving this way a better usage of the natural light; for the reduction of the electric load of the air conditioning units which will be obtained in incorporating induced draft shafts; and for an improvement in the electric and ballast installation. For the actions that turned out to be redeemable in three years the assistance of the Fideicomiso de Apoyo al Programa de Ahorro de Energia del Sector Electrico (FIDE) of the Comision Federal de Electricidad (CFE) has been available. It is expected that the execution of the modifications will be carried out in the November and December months of 1993, and the results will be evaluated in 1994. [Espanol] En este trabajo se presenta un diagnostico del consumo de energia electrica en la biblioteca de la Unidad Azcapotzalco de la Universidad Autonoma Metropolitana para determinar las acciones que se pueden llevar a cabo para ahorrar energia electrica. Esto sin deteriorar el confort luminico y termico. El analisis mostro que, cambiando las superficies reflectoras de las luminarias, se puede reducir el numero de lamparas, sin que el nivel de iluminacion quede debajo de los valores recomendados. Se estimaron ahorros: por la sustitucion de las lamparas fluorescentes por otras de halogenuros metalicos en las partes donde el

  19. The installation IGCC power plans in the petroleum refinement: international experiences and lessons for Mexico; La instalacion de plantas IGCC en la refinacion de petroleo: experiencias internacionales y lecciones para Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, Joel [Ecole du Petrole et des Moteurs, Institut Franzais du Petrole, (France)

    2004-06-15

    refinacion de petroleo ha crecido en un 14.3 % a nivel mundial a partir de 1996, en donde ya se contaba con una capacidad instalada de 160 MW. A finales de 2003 se alcanzo una capacidad instalada de 2,500 MW. El crecimiento en la instalacion de las plantas IGCC se presenta primordialmente en Europa, siendo Italia y Espana paises lideres en la construccion de esta tecnologia en la refinacion de petroleo. No obstante, paises como Holanda, Japon, Singapur y Estados Unidos cuentan con plantas IGCC para la generacion de electricidad e hidrogeno, las cuales aprovechan combustibles de bajo valor como residuos de vacio, coque de petroleo, asfalto, combustibles liquidos, entre otros. En Mexico, la instalacion de plantas IGCC en la refinacion de petroleo es nula, sin embargo Petroleos Mexicanos cuenta con la aprobacion del gobierno para la instalacion de plantas de cogeneracion en sus instalaciones. Esta aprobacion permitiria a PEMEX llevar a cabo proyectos para la instalacion de plantas IGCC, especificamente en PEMEX Refinacion, para la generacion de electricidad e hidrogeno a partir del aprovechamiento de residuos pesados de bajo valor economico. La oportunidad que ofrece la instalacion de plantas IGCC en la refinacion de petroleo es dirigida hacia la comercializacion de la electricidad e hidrogeno, lo que impulsaria a PEMEX Refinacion entrar en la competencia del mercado electrico en Mexico.

  20. Monitoring systems for the analysis of vibrations and balance of rotary machines; Sistemas de monitorizacion para el analisis de vibraciones y balanceo de maquinas rotatorias

    Energy Technology Data Exchange (ETDEWEB)

    Serrano R, Luis E; Ramirez Solis, J. Antonio; Munoz Q, Rodolfo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2004-07-01

    Often, the rotary equipment faults appear as an abnormal vibration or a change in the characteristic vibration pattern of each machine. From here the importance of counting on tools that allow to acquire and to analyze the vibration signals of the equipment while it is in operation. The Gerencia de Turbomaquinaria has worked in this field since the end of the Seventies, developing diagnosis systems based on personal computers that allow the monitoring of the dynamic behavior of the rotary equipment. The main system of this type that the Instituto de Investigaciones Electricas (IIE), nowadays offers, is the Computerized System for Dynamic Analysis, also known by its abbreviation in Spanish as: SICAD II. This was designed under the requirements of the Comision Federal de Electricidad (CFE) to collect, measure and analyze vibration data of rotary equipment. It is also used in the balance, fault diagnosis and the solution of problems in rotary equipment. The system SICAD II is portable and versatile system with which vibrations are acquired, measured and analyzed by means of the presentation of the data in graphical formats of different type and application. [Spanish] A menudo, las fallas en los equipos rotatorios se manifiestan como una vibracion anormal o como un cambio en el patron de vibraciones caracteristico de cada maquina. De ahi la importancia de contar con herramientas que permitan adquirir y analizar las senales de vibracion de los equipos mientras estan en operacion. La Gerencia de Turbomaquinaria ha trabajado en este campo desde finales de la decada de los setenta, desarrollando sistemas de diagnostico basados en computadoras personales que permiten monitorear el comportamiento dinamico de los equipos rotatorios. El principal sistema de este tipo que ofrece, actualmente, el Instituto de Investigaciones Electricas (IIE) es el Sistema Computarizado para Analisis Dinamico, conocido tambien por su abreviacion como: Sicad II. Este fue disenado bajo los

  1. Aviso para las viudas.

    Directory of Open Access Journals (Sweden)

    Francisco de Sales

    2000-01-01

    Full Text Available San Pablo instruye todos los prelados en la persona de su Timoteo, diciendo: «Honra las viudas que son verdaderamente viudas». Para ser, pues, verdaderamente viuda, son necesarias estas cosas

  2. Leer para Sophia

    OpenAIRE

    Cassany, Daniel

    2009-01-01

    Leer para Sophia re??ne algunos de mis trabajos m??s recientes sobre la lectura, desde perspectivas complementarias, te??ricas y pr??cticas, destacando el tema de futuro de la lectura electr??nica o en l??nea. El t??tulo de este volumen tiene un doble sentido : primero apela al significado griego del vocablo sophia (sabidur??a), para iluminar uno de los prop??sitos esenciales de la lectura: aprender y comprender; luego quiere agradecer ...

  3. Diagnosis system for nozzles in high voltage equipment; Sistema de diagnostico para boquillas en equipos de alta tension

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez Nino, Jose; Escorsa Morales, Oscar [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico); Lopez Azamar, Ernesto [Comision Federal de Electricidad (Mexico)

    2000-07-01

    boquillas y que permitan prever su posible falla, el Instituto de investigaciones electricas (IIE) realizo para el laboratorio de pruebas de equipos y, materiales (LAPEM) de la Comision Federal de Electricidad (CFE), un proyecto para el desarrollo de un sistema para la medicion de corrientes capacitivas en estos equipos. Este sistema permite determinar la variacion en capacitancia y perdidas dielectricas, asi como la presencia de descargas parciales internas en boquillas de 115, 230 y 400 kV. Con esta informacion es posible determinar el estado del aislamiento interno de las boquillas y retirarlas del servicio antes de que se produzca un deterioro que ponga en peligro la integridad del equipo. La gerencia de equipos electricos del Instituto de Investigaciones Electricas desarrollo para el LAPEM un sistema que mide corrientes capacitivas de boquillas de transformadores de potencia. Este sistema se diseno con el fin de instalarse en un transformador de maquina de 400 kV en la central termoelectrica de Tula, Hidalgo, de la Comision Federal de Electricidad.

  4. Tiempo para un cambio

    Science.gov (United States)

    Woltjer, L.

    1987-06-01

    En la reunion celebrada en diciembre dei ano pasado informe al Consejo de mi deseo de terminar mi contrato como Director General de la ESO una vez que fuera aprobado el proyecto dei VLT, que se espera sucedera hacia fines de este aAo. Cuando fue renovada mi designacion hace tres aAos, el Consejo conocia mi intencion de no completar los cinco aAos dei contrato debido a mi deseo de disponer de mas tiempo para otras actividades. Ahora, una vez terminada la fase preparatoria para el VLT, Y habiendose presentado el proyecto formalmente al Consejo el dia 31 de marzo, y esperando su muy probable aprobacion antes dei termino de este ano, me parece que el 10 de enero de 1988 presenta una excelente fecha para que se produzca un cambio en la administracion de la ESO.

  5. Instalaciones para hotel rural

    OpenAIRE

    Roig Riera, José Antonio

    2015-01-01

    El presente proyecto cuenta con la información necesaria para el desarrollo de las instalaciones de un hotel rural. Dichas instalaciones son; la eléctrica, la de agua caliente sanitaria, las telecomunicaciones y la climatización. En el apartado de la instalación eléctrica, se han calculado todos los cables necesarios para el correcto funcionamiento del hotel, partiendo de las potencias demandadas en cada punto de consumo. Se ha calculado la línea general de alimentación, acomet...

  6. Instrucciones para autores

    OpenAIRE

    Cramer, Thomas

    2012-01-01

    Instrucciones para autoresNota preliminar: ¡Es de suma importancia que antesde enviar cualquier documento a la Revista GeologíaColombiana, lea y cumpla cuidadosamente cada uno delos subíndices de las Normas para autores!A partir del Volumen 35 (2010) recibimos artículosprincipalmente a través del sistema digital enhttp://www.revistas.unal.edu.co/index.php/geocol/index.Si quiere enviar un artículo, por favor regístrese comoAutor en el menú INGRESAR (aquí pueden registrarsetambién evaluadores u...

  7. Tempo para aprender vs tempo para brincar

    OpenAIRE

    Correia, Ana Rita Coelho

    2016-01-01

    Relatório de Estágio apresentado à Escola Superior de Educação de Paula Frassinetti para a obtenção de grau de Mestre em Educação Pré-Escolar e Ensino do 1º Ciclo do Ensino Básico Esta investigação surge da reflexão sobre a urgência atual, generalizada por parte de muitos pais e encarregados de educação, bem como de algumas instituições, no sentido de escolarizar as crianças precocemente, com vista a que estas possam chegar ao ensino básico “mais preparadas”, esquecendo-se muitas ...

  8. Aprendizaje cooperativo para ELE

    OpenAIRE

    Cassany, Daniel

    2004-01-01

    Presentación sucinta para docentes de español como lengua extranjera del conjunto de propuestas metodológicas conocidas bajo la denominación aprendizaje cooperativo : origen, fundamentación, principales principios psicopedagógicos y algunas propuestas prácticas.

  9. Consejos para pacientes

    OpenAIRE

    M. Eulalia Lucio-Villegas Menéndez; Laura López González; M. Isabel Gutiérrez Pérez; Natalia Aresté Lluch; M. Luisa Morató Agustí; Santiago Pérez Cachafeiro

    2014-01-01

    En el cuidado de las heridas es tan importante saber qué hacer como saber qué no hacer. Lo primero es valorar la gravedad de la lesión y saber si es necesario acudir a un centro sanitario o no. Si la herida es simple, lo más recomendable es hacer una buena limpieza con suero o agua tras lavado de manos, realizando la desinfección de esta con el antiséptico más adecuado. Los antisépticos no deben usarse para la limpieza de las heridas (usar suero fisiológico o agua del grifo) ni para la cur...

  10. Educando para la ignorancia

    Directory of Open Access Journals (Sweden)

    Miguel Durán

    1996-06-01

    Full Text Available Más que describir una situación particular, los autores buscan con este escrito motivar al estudiante para que asuma posiciones críticas; así como dar un campanazo de alerta a los profesores, en relación a los conocimientos que transmiten a sus alumnos y la forma en que lo hacen; todo con el ánimo de generar verdaderos espacios de reflexión en la universidad.

  11. Arquitectura para el conocimiento

    OpenAIRE

    Moreno-Torres Sánchez, Rosario; Sánchez Relinque, Javier

    2011-01-01

    La Málaga del siglo XXI se prepara para hacer de la investigación y de la innovación su nuevo sello. Entrevista a tres de los artífices de la urbanización y la edificación de la ampliación de Teatinos, clave en el eje sociocultural, científico y empresarial que conforman ya la capital, UMA y Parque Tecnológico.

  12. INICIATIVAS PARA EL CAMBIO

    Directory of Open Access Journals (Sweden)

    César Alfonso Defrancisco-Larrañaga

    2013-07-01

    Full Text Available El planeta no atraviesa por su mejor momento en materia de conservación y renovación de sus recursos naturales. Claramente en los últimos tiempos los recursos hídricos han venido haciéndose cada vez menores; el hombre ha notado con preocupación y vivido en carne propia este fenómeno, que de no ser tratado a tiempo, podría atentar contra la existencia misma. Esto lo ha alentado a buscar métodos que sirvan como solución para contrarrestar éste mal y crear conciencia entre sus iguales, para así poder garantizar su permanencia y la de su entorno durante muchas generaciones. En países desarrollados del continente europeo y en algunos lugares de América del norte, el uso de sistemas de reutilización y tratamiento de aguas grises y aprovechamiento de las aguas lluvias se ha convertido en una constante y nos están dando las pautas para poder seguir el ejemplo y así de esta manera poder aportar a la causa ambiental y a su vez crear un ahorro en nuestros gastos mensuales de consumo.

  13. para mejorar el %R

    Directory of Open Access Journals (Sweden)

    Alfredo Díaz Mata

    2001-01-01

    Full Text Available En este trabajo se revisan dos indicadores técnicos bursátiles que están estrechamente relacionados, el oscilador estocástico %K de Lane y el oscilador %R de Williams; asimismo, se evalúa el uso de dos mecanismos asociados con el primero y que no suelen utilizarse con el %R: el proceso de frenado (slowing y el uso de un promedio móvil del propio oscilador estocástico como disparadores de señales de compra y de venta. Realizando simulaciones con 27 acciones y el Índice de Precios y Cotizaciones de la Bolsa Mexicana de Valores se verifica la hipótesis principal y se comprueba que, efectivamente, en muchos casos, el uso del proceso de frenado con el oscilador %R de Williams permite tomar mejores decisiones. Por otro lado, se concluye que de los dos disparadores de señales el que mejor funciona, tanto para %K como para %R es el uso de cotas inferior y superior. Este artículo surgió en el curso de una investigación sobre el análisis técnico bursátil de acciones que se puede realizar en su totalidad por computadora y que, esencialmente, excluye el análisis gráfico. Uno de los propósitos del estudio es determinar si es posible, y bajo qué mecanismos, establecer un sistema de análisis bursátil que le permita al inversionista tomar decisiones de inversión en acciones en la Bolsa Mexicana de Valores sin tener que emplear la considerable cantidad de tiempo que es necesario para el análisis gráfico tradicional. Durante este estudio se realizó un análisis preliminar de unos 120 indicadores técnicos para, por un lado, conocerlos con cierto detalle y, por otra parte, aislar aquellos que prometían ser de utilidad para el objetivo de la investigación. Fue en este proceso cuando se detectó que existen dos indicadores que están relacionados y que permiten un análisis por separado que tiene, cuando menos, dos ventajas. En primer lugar está el placer que da a quien gusta de estos temas encontrarse con indicadores que, de acuerdo

  14. Inmunopotenciadores para la acuicultura

    Directory of Open Access Journals (Sweden)

    Rocmira Pérez

    2014-04-01

    Full Text Available La acuicultura es una de las actividades económicas de mayor crecimiento para la producción de alimentos. Uno de sus principales retos es la obtención de grandes volúmenes de producción con la mayor calidad posible. Esto conlleva a una reducción de la aplicación de antibióticos y productos quimioterapéuticos. Una de las estrategias más prometedoras es la aplicación de inmunopotenciadores, principalmente en los cultivos intensivos. El objetivo de este trabajo fue revisar los principales inmunopotenciadores, así como las tendencias y retos de su uso mundial. Se resumen las particularidades moleculares y funcionales de los mismos y se hace énfasis en los más estudiados: levamisol, ß-glucanos, lipopolisacárido, vitamina C, extractos de plantas y hormonas. Todos estos compuestos de naturaleza heterogénea inciden mayoritariamente en los componentes de la inmunidad innata de los peces, fortaleciendo y potenciando la resistencia a enfermedades; adicionalmente algunos de ellos tienen funciones antiestrés y favorecen su crecimiento. Se concluye que los inmunopotenciadores constituyen una estrategia viable para reducir las pérdidas por problemas sanitarios en el sector de la acuicultura; pero aún quedan por solucionar aspectos como la vía de administración y la etapa de inmunización adecuada para cada especie y tipo de cultivo.

  15. Instrucciones para los autores

    OpenAIRE

    Ana Silvia Bermúdez

    2011-01-01

    La Revista Colombiana de Química es una publicación científica, arbitrada del Departamento de Química, Facultad de Ciencias, Universidad Nacional de Colombia que acepta contribuciones provenientes de investigación en las diversas áreas de la química. El contenido de los artículos debe ser original, inédito y no debe haber sido enviado, total o parcialmente, para publicación a otra revista. La redacción asume el derecho de reproducción de los trabajos aceptados. Su publicación en otro medio re...

  16. Comunicar para la salud

    OpenAIRE

    Lic. Eva Bocco

    1998-01-01

    Con este trabajo quiero plantearles una inquietud en torno al rol que nos cabe a los comunicadores en el área de la salud desde la perspectiva de la comunicación para la salud. ¿Se puede pensar la salud pública desvinculada de la comunicación? ¿La comunicación es posible sin la existencia de salud en la comunidad? ¿Qué puede hacer un comunicador en el ministerio de salud? ¿Puede un estado desarrollar políticas de salud sin la presencia de la comunicación?

  17. Computerized system for the support of the predictive maintenance in thermoelectric power stations of Comision Federal de Electricidad; Sistema computarizado para el apoyo del mantenimiento predictivo en centrales termoelectricas de la Comision Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Aranda A, Segio; Garcia M, Raul; Poujol G, Francisco; Chairez C, Carlos; Dominguez M, Nely [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2002-07-01

    This paper describes the functionality of the Integral System of Information for the Diagnosis of Predictive Maintenance (SIIDMP) in the thermoelectric centrals, whose primary target is to give support to the personnel related with the maintenance and operation of the thermoelectric central to optimize the application of the inspection, maintenance and its associated costs. It is important to comment that in the generating power stations of Comision Federal de Electricidad (CFE) techniques and methodologies for the preventive and corrective maintenance are applied, in addition of which they count on electronic equipment of operation dedicated to the inspection and control of vibratory equipment. The architecture of the SIIDMP is of the client-server type and for its design and implantation Windows NT 4.0 was used as operating system, SQL Server 7.0 as server and manager of the database, Visual C++ for the programs of data mining, Vision Basic 6.0 for the codification of the application programs and Interface Man-Machine (IMM), the communication mechanism Open Data Base Connectivity (ODBC) to establish the connection with the different data sources, as well as libraries of symbols and graphs that were included in the interface of the user. The main objective of the SIIDMP is to take care of the own necessities on optimization, improvements and savings in the operation of the power stations. With systems like the SIIDMP, a reduction of the costs due to shutdowns by accidental failures of the main equipment is looked for, limiting the deterioration of the equipment, as well as to provide knowledge and aid to all the personnel who take part in the management of the operation and conservation of the facilities of the power station. [Spanish] Se describe la funcionalidad del Sistema Integral de Informacion para el Diagnostico de Mantenimiento Predictivo en las centrales termoelectricas (SIIDMP), cuyo objetivo principal es apoyar al personal relacionado con el

  18. "Colaborar para Competir"

    Directory of Open Access Journals (Sweden)

    Martha Liliana Hijuelos-Cárdenas

    2016-08-01

    Full Text Available De acuerdo con Michael Porter, los Clusters se definen como “Una agrupación de empresas e instituciones relacionadas entre sí, pertenecientes a un mismo sector o segmento de mercado, que se encuentran próximas geográficamente y que colaboran para ser más competitivas”. Los Clusters son en última instancia una herramienta de competitividad basada en la cooperación de sus miembros, y es una de las estrategias recientes, en el país, para incrementar la productividad y competitividad y las apuestas productivas desde el nivel local. Y es precisamente esta cercanía geográfica de las empresas de un mismo sector, lo que a la vez que genera la competencia entre ellas, también les facilita el acceso a insumos y a conocimientos específicos y en última instancia les permite promover la innovación.

  19. Characterization of the voltage control systems and speed of a synchronous machine of high power for short circuit testing; Caracterizacion de los sistemas de control de voltaje y velocidad de una maquina sincrona de alta potencia para pruebas de corto circuito

    Energy Technology Data Exchange (ETDEWEB)

    Segura Ozuna, Victor Octavio; Hernandez Rodriguez, Isaura Victoria; Alcaide Godinez, Indira Xochiquetzal; Garduno Ramirez, Raul; Montero Cervantes, Julio Cesar [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Ruiz Rodriguez, Genaro; Martinez Torres; Ricardo [CFE-LAPEM, Irapuato, Guanajuato (Mexico)

    2012-07-01

    This paper introduces a characterization of the behavior of the speed and voltage control systems of a special purpose synchronous machine (GCC) based on measuring and monitoring physical signals, and recording of the sampled waveforms. Basically, the GCC supplies the energy to perform high-power short-circuits tests to certify electrical equipment and components, as required by the Comision Federal de Electricidad (CFE) in Mexico. The GCC operates alternately as motor and generator. With the GCC operating as motor, speed control during startup, acceleration, re-acceleration and braking is carried out by a static frequency converter (SFC). Complementary, the voltage controller manipulates excitation power to control terminal voltage when the GCC operates as generator and regulates excitation current when the GCC operates as motor. Compared to conventional voltage regulation systems, which must go off in case of short-circuit, the GCC voltage regulator must keep controlling field excitation to maintain the required line current and terminal voltage during short-circuit tests. Monitoring of physical signals was carried out with a portable data acquisition system based on SCXI and PXI digital platforms. A total of 78 signals were monitored with a 6 kHz sampling rate that was enough to obtain detailed signal waveforms. Data captured was processed and plotted for analysis. The signal graphs show the current real behavior of both, the voltage control system and the speed control system, and constitute a precise characterization of their behavior. [Spanish] Este documento presenta una caracterizacion del comportamiento de los sistemas de control de velocidad y voltaje de una maquina sincrona de proposito especial (GCC) basada en la medicion y monitoreo de senales fisicas, asi como en el registro de las formas de onda muestreadas. Basicamente, la GCC suministra la energia para efectuar pruebas de corto circuito de alta potencia para certificar equipo y componentes

  20. Requerimientos para aplicaciones web

    OpenAIRE

    Oliveros, Alejandro; Wehbe, Ricardo; Rojo, Silvana del Valle; Rousselot, Julián

    2011-01-01

    El objetivo del presente proyecto es la elaboración de un conjunto de políticas, estándares, procesos, metodologías, técnicas, herramientas y métricas para aplicar en el desarrollo de aplicaciones Web, específicamente en la obtención y representación de los requerimientos que debe satisfacer el sistema o aplicación Web. Estos distintos elementos se desarrollarán en forma gradual y eventualmente se integrarán en un sitio Web que centralice toda la información. Hay varias líneas de investigació...

  1. Contratados peninsulares para Cuba

    Directory of Open Access Journals (Sweden)

    Iglesias García, Fe

    1994-12-01

    Full Text Available Not available.

    Ante las presiones británicas, la metrópoli española y los ideólogos de los hacendados cubanos tuvieron que dar, desde la tercera década del siglo XIX, una respuesta a la previsible escasez de mano de obra esclava. El artículo estudia los sistemas de contrata implantados en la isla para abastecer de mano de obra blanca y barata a Cuba, deteniéndose particularmente la autora en el estudio de las condiciones de semiesclavitud que se escondían en las mencionadas contratas y en el perfil de los inmigrantes (profesiones, sexo, edad, procedencia....

  2. Bases para proyectiles dirigidos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1959-03-01

    Full Text Available Aunque actualmente no se ha llegado a una línea general de métodos o sistemas que gobiernen un tipo característico de rampa y servicios auxiliares necesarios para el lanzamiento al espacio de proyectiles dirigidos a grandes alturas y distancias, las experiencias obtenidas en diferentes ensayos, utilizando distintos tipos de proyectiles y trayectorias balísticas, han sentado toda una serie de procedimientos, datos y conclusiones de gran valor balístico que, aun teniendo en cuenta la continua evolución del proyectil, sus formas, combustibles y alcances, se conocen ya, con bastante aproximación, las condiciones mínimas que ha de reunir una base dedicada a este tipo de lanzamientos.

  3. Para Para舞不停

    Institute of Scientific and Technical Information of China (English)

    周鹏程

    2002-01-01

    @@ 提问:目前在全亚洲最热门的舞蹈是什么? 回答:HIP HOP. 错!错!错!是Para Para! 君不见,从日本到韩国,从马来西亚到新加坡,从香港到台湾,无论是公园广场,还是迪厅PARTY,到处都涌动着这股来势汹汹的Para Para潮.而且,偷偷告诉你,最近这股Para Para风暴已经悄悄在内地登陆了!各位时尚MMGG们,准备好了吗?让我们一起投身Para Para大潮!

  4. Systems for the calculation of electrical parameters and energy efficiency for high-capacity hydroelectric generators; Sistemas para el calculo de parametros electricos y eficiencia energetica para generadores hidroelectricos de gran capacidad

    Energy Technology Data Exchange (ETDEWEB)

    Reyes Martinez, Oscar Alfonso; Pascacio de los Santos, Alberth; Perez Abad, Carlos Alberto [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Leon Rivera, Nicolas [CFE-LAPEM, Irapuato, Guanajuato (Mexico)

    2012-07-01

    In recent years, the Comision Federal de Electricidad (CFE) has developed important hydroelectrical power projects in Mexico. Most of them are located in the Santiago River Hydrological System in Nayarit, Mexico. A total of 27 projects with a capacity of 4,300 MW are considered but only 32% of them have been carried out. One of the most ambitious projects that continue in process of construction is the Hydroelectrical Plant La Yesca. This project will conclude in late 2012 and consists of two electric generators of 375 MW, 17 kV. It will be second in power and the third in electrical generation at the system. According to national and international standards, a set of static and dynamic tests must be performed in these generators before commissioning, to ensure their proper operation. Winding stator high voltage endurance test, three phase sudden short circuit test and energy efficiency calculation are some of the most important tests to be performed in a new electrical generator. These tests are difficult to perform on-site due to the equipment capacity required, so very few companies in the world can conduct them. In Mexico no one has the necessary infrastructure for testing in high capacity hydroelectric generators such as those from La Yesca, so the Laboratorio de Pruebas a Equipos y Materiales (LAPEM) has invested in projects to improve this project in order to meet the needs of the Mexican electricity sector. This paper is a description of the systems developed for the calculation of electrical parameters and energy efficiency for this class of generators. [Spanish] En los ultimos anos, la Comision Federal de Electricidad (CFE) ha desarrollado importantes proyectos hidroelectricos en Mexico. La mayor parte se ubican en el Sistema Hidrologico del Rio Santiago en Nayarit, Mexico. Se consideran un total de 27 proyectos con capacidad de 4300 MW, pero solo 32 % de ellos se han llevado a cabo. Uno de los proyectos mas ambiciosos que continua en proceso de

  5. Pequenos para idade gestacional: fator de risco para mortalidade neonatal

    OpenAIRE

    Almeida Márcia Furquim de; Jorge Maria Helena Prado de Mello

    1998-01-01

    OBJETIVO: Estudar as variáveis contempladas na Declaração de Nascimento (DN) como possíveis fatores de risco para nascimentos pequenos para a idade gestacional (PIG) e o retardo de crescimento intra-uterino como fator de risco para a mortalidade neonatal. MATERIAL E MÉTODO: As variáveis existentes na DN foram obtidas diretamente de prontuários hospitalares. Os dados referem-se a uma coorte de nascimentos obtida por meio da vinculação das declarações de nascimento e óbito, correspondendo a 2.2...

  6. Leer para Creer

    Directory of Open Access Journals (Sweden)

    Roberto Polanco-Carrasco

    2011-12-01

    Full Text Available Más allá de los prejuicios que se puedan alimentar en las aulas por -en ocasiones- brillantes exponentes de la clínica psicológica, resultaría difícil creer que exista hoy en día un profesional que se atreva a sostener que el ser humano es sólo mente, o argumentar que lo corporal o cerebral es secundario e incluso irrelevante en los pacientes con los que habitualmente se deberá tratar. De hacerlo simplemente sería un acto de ignorancia, sobretodo en un momento en que disponemos de evidencias diarias desde las neurociencias que dan para sostener la unidad mente-cuerpo como nunca antes en la historia del estudio de “lo psicológico”. La convicción de que los estudiantes deberán ser nutridos con las nociones básicas de los modernos estudios del cerebro debería reflejarse en la bibliografía de diversas asignaturas y estar presente en el espíritu central del quehacer académico como una manera de prevenir esta viciosa tendencia a ningunear aquello que se desconoce y que finalmente cegará a la hora de probar nuevas formas de ver “el síntoma”.

  7. para promover la salud

    Directory of Open Access Journals (Sweden)

    Ma. del Consuelo Chapela

    2002-01-01

    Full Text Available Hablar de educación a distancia sustentada en el desarrollo de la cibernética obliga a reflexionar sobre sus definiciones, objetivos y medios, especialmente si pensamos en las necesidades de la fracción de población que no tiene acceso a las posibilidades que ofrece el desarrollo tecnológico. En este trabajo se presenta e ilustra con un ejemplo práctico, una perspectiva sobre las posibilidades de la educación a distancia desde las necesidades de la promoción de la salud entre grupos de población marginada en el mundo virtual. Se propone la creación de bibliotecas itinerantes regionales que pongan a disposición de la población con acceso limitado a la información, la tecnología comunicativa necesaria para apoyar los trabajos de promoción de la salud.

  8. Remedial actions to improve the availability in steam generators; Acciones correctivas para mejorar la disponibilidad en generadores de vapor

    Energy Technology Data Exchange (ETDEWEB)

    Torres Toledano, J. Gerardo; Porras Loaiza, G. Lizbeth; Sanchez Hernandez, Laura E.; Salinas B, Victor M.; Nebart G, Jesus [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    was demonstrated that the lack of power of the unit is not due to the combustion air deficiency. The metallographic study of the fault of the RU tube is mentioned, where a graph of the estimated life span at different rates of wear by corrosion and metal temperature for a tube of SA-213-TPH metal is presented. The details of the interconnections at the reheater are shown and a table of comparison of proposed temperatures at the RH outlet is present. A table of main causes of power decrease is attached. [Spanish] En este articulo se presentan los resultados del analisis de fallas recurrentes de cuatro Unidades Generadoras de Centrales Termoelectricas (UGT) de la Comision Federal de Electricidad (CFE). En tres de los cuatro casos, los estudios se enfocaron a identificar y corregir las causas raiz de fallas recurrentes en tubos de generadores de vapor, las unidades analizadas son: U-2 del Complejo Termoelectrico Pdte. Adolfo Lopez Mateos (CTPALM) de Tuxpan, Veracruz; U-3 de la Central Termoelectrica (CT) de Salamanca, y U-1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan. En el otro caso se analizo la insuficiencia de aire de combustion como una de las causas de decremento de potencia de la unidad 1 de la CT Gral. Manuel Alvarez Moreno de Manzanillo, Colima. Los generadores de vapor de la unidad 2 del CTPALM y la unidad 3 de la CT de Salamanca presentaron fallas en el banco del recalentador (RH). En este caso las recomendaciones se enfocaron al mejoramiento en las condiciones operativas para atenuar las fallas por corrosion en alta temperatura. A diferencia del CTPALM, en el caso de la U-3 de Salamanca se concluyo que es necesario el rediseno del RH; para ello se propuso permutar trayectorias de tubos calientes con los frios para uniformizar la temperatura de vapor a la salida del RH. Para evaluar los problemas que se han presentado en el generador de vapor de las unidades 1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan se analizaron las fallas de

  9. Marcadores para la Realidad Aumentada para fines educativos

    Directory of Open Access Journals (Sweden)

    María Reina Zarate Nava

    2013-12-01

    Full Text Available La Realidad Aumentada (AR es considerada por algunos expertos como la tecnología en crecimiento para el 2014, en diferentes sectores: ingeniería, educación, juegos y negocios, siendo este último el más usado en él 2013. Sin embargo en el sector educativo la AR se presenta en algunos proyectos que se han desarrollado para diferentes áreas de las ciencias, como Química, Física y Matemáticas, lo anterior con el objetivo de facilitar el proceso de Enseñanza-Aprendizaje. En el presente artículo se presenta el modelo de patrones utilizado para un Proyecto AR enfocado en Química, el cual presenta un conjunto de patrones que fueron valorados para facilitar el rastreo de los objetos y a su vez el entendimiento de algunos materiales de los laboratorios de Química I.

  10. Plataforma VMware para academia virtual

    OpenAIRE

    Martínez Sánchez, José María

    2014-01-01

    Este PFC surge para dar respuesta a los problemas que se presentan en una unidad educativa a la hora de diseñar y crear una nueva infraestructura de red, servidores y equipos de trabajo que se presenta en el diseño y puesta en marcha de una nueva entidad educativa. Se proyecta la creación y configuración de una infraestructura virtual que aborde todos estos problemas, ofreciendo la solución mediante un único nodo virtual. Para ello, utilizamos sw de VMware para la creación de dicho nodo virtu...

  11. Una agenda para educadores

    Directory of Open Access Journals (Sweden)

    Robert O. McClintock

    2007-01-01

    Full Text Available Las instituciones educativas constituyen los principales factores en la construcción social de un nuevo sistema educativo. Las escuelas y los educadores controlan y producen propiedad intelectual de una extraordinaria profundidad y amplitud. Los cambios producidos por las tecnologías digitales están consiguiendo que el acceso y la producción de conocimiento sea más accesible y universal. Lo que es, a la vez, un gran logro de apertura curricular, pero también un grave peligro de perder la perspectiva eminentemente “educativa” de la transmisión del conocimiento en la escuela. Los nuevos recursos permiten a los educadores romper el ciclo de reproducción en los logros educativos, acercarse al medio y a la familia y transformar la escuela. Los educadores y las escuelas deben asumir el reto de constituir comunidades de aprendizaje. Así como de atreverse a producir y difundir ese conocimiento con soporte digital. Lo contrario sería una terrible abdicación. El artículo traza un recorrido histórico sobre esta función de la escuela y su adaptación a los medios y recursos de cada época. Tras lo cual, aboga por asumir el desafío actual de las TICs, para renovar el vínculo progresista con la posteridad y construir un mejor futuro. Los nuevos recursos permiten a los educadores romper el ciclo de reproducción en los logros educativos, acercarse al medio y a la familia y transformar la escuela.

  12. Proyecto de red para ONG

    OpenAIRE

    Ruiz López, David

    2013-01-01

    Proyecto de una red de comunicaciones para una ONG en la Comunidad de Madrid. Projecte d'una xarxa de comunicacions per a una ONG a la Comunidad de Madrid. Bachelor thesis for the Telecommunication Technologies program on Telematics.

  13. Planar Para Algebras, Reflection Positivity

    CERN Document Server

    Jaffe, Arthur

    2016-01-01

    We define the notion of a planar para algebra, which arises naturally from combining planar algebras with the idea of $\\Z_{N}$ para symmetry in physics. A subfactor planar para algebra is a Hilbert space representation of planar tangles with parafermionic defects, that are invariant under isotopy. For each $\\Z_{N}$, we construct a family of subfactor planar para algebras which play the role of Temperley-Lieb-Jones planar algebras. The first example in this family is the parafermion planar para algebra. Based on this example, we introduce parafermion Pauli matrices, quaternion relations, and braided relations for parafermion algebras which one can use in the study of quantum information. Two different reflections play an important role in the theory of planar para algebras. One is the adjoint operator; the other is the modular conjugation in Tomita-Takesaki theory. We use the latter one to define the double algebra and to introduce reflection positivity. We give a new and geometric proof of reflection positivi...

  14. Gas turbine modular helium reactor in cogeneration; Turbina de gas reactor modular con helio en cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, G. [UNAM, Facultad de Ingenieria, Division de Ingenieria Electrica, Departamento de Sistemas Energeticos, Ciudad Universitaria, 04510 Mexico, D. F. (Mexico)], e-mail: tesgleon@gmail.com

    2009-10-15

    This work carries out the thermal evaluation from the conversion of nuclear energy to electric power and process heat, through to implement an outline gas turbine modular helium reactor in cogeneration. Modeling and simulating with software Thermo flex of Thermo flow the performance parameters, based on a nuclear power plant constituted by an helium cooled reactor and helium gas turbine with three compression stages, two of inter cooling and one regeneration stage; more four heat recovery process, generating two pressure levels of overheat vapor, a pressure level of saturated vapor and one of hot water, with energetic characteristics to be able to give supply to a very wide gamma of industrial processes. Obtaining a relationship heat electricity of 0.52 and efficiency of net cogeneration of 54.28%, 70.2 MW net electric, 36.6 MW net thermal with 35% of condensed return to 30 C; for a supplied power by reactor of 196.7 MW; and with conditions in advanced gas turbine of 850 C and 7.06 Mpa, assembly in a shaft, inter cooling and heat recovery in cogeneration. (Author)

  15. Methodology for the electric energy distribution systems planning of small and rural zones of Comision Federal de Electricidad; Metodologia para la planeacion de sistemas de distribucion de energia electrica de zonas pequenas y rurales de Comision Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Ochoa Gomez, Miguel Armando

    2008-12-15

    retiro de las instalaciones que ya no seran utiles. Por otra parte, la gran mayoria de los estudios de planeacion de los sistemas de distribucion que se realizan estan orientados hacia grandes urbes o areas de alto crecimiento, y aunque estos estudios pueden ser aplicados a cualquier sistema, los ingenieros de planeacion de las Zonas de Distribucion medianas o pequenas, con frecuencia se confunden tratando de hacer las actualidades de forma similar a las politicas de planeacion de esas urbes. Las Zonas de Distribucion pequenas tienen particularidades propias, por lo que vale la pena hacer un esfuerzo para investigarlas y analizar todas las oportunidades de mejorar que se presentan y aplicarlas en otras zonas de la Division Jalisco o del pais con caracteristicas similares. Despues de todo, en la Division Jalisco el 60% de las Zonas estan dentro de esta clasificacion y puede ser un porcentaje similar en las otras Divisiones de Distribucion de la CFE. Asimismo, aunque en mucha menor proporcion, estas Zonas tambien tienen necesidades de inversion que sumandolas en ciertos casos, pueden ser superiores a la suma de las necesidades de las grandes Zonas. Para atender la deficiencia anterior, en el Capitulo 2 se propone una metodologia que se especialice en la planeacion de los sistemas electricos de distribucion de las Zonas pequenas o rurales, en el cual se integraron los aspectos mas relevantes de los manuales de planeacion, la teoria de la ingenieria electrica, los procedimientos institucionales, las normas, los programas comerciales y los programas desarrollados por la Gerencia de Planeacion; utilizados en la CFE para hacer la planeacion de los sistemas electricos de distribucion. De la misma manera, en el Capitulo 4 se propone una metodologia para la optimizacion de las redes electricas en baja tension, resaltando algunos errores que comunmente se cometen en el diseno de estos tipos de redes, haciendo recomendaciones para corregirlos con inversiones de bajo costo. Por su

  16. Atmospheric electric discharges and grounding systems; Descargas atmosfericas y sistemas de conexion a tierra

    Energy Technology Data Exchange (ETDEWEB)

    Rivas, Elena [ed.] [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    1999-07-01

    In this article the work made by the Institute of Investigaciones Electricas (IIE), in the area of atmospheric electric discharges and grounding connections at Comision Federal de Electricidad (CFE) is presented. The work consisted of the revision of the procedures for the design of transmission lines and substations of CFE from which high indexes of interruptions are reported, from this, a program was defined that allowed to improve the existing designs in CFE. [Spanish] En este articulo se presenta el trabajo realizado por el Instituto de Investigaciones Electricas (IIE), en el area de descargas atmosfericas y conexiones a tierra en Comision Federal de Electricidad (CFE). El trabajo consistio en la revision de los procedimientos de diseno de las areas de transmision y subestaciones de la CFE para los que se reportan altos indices de salidas, a partir de esto se definio un programa que permitio mejorar los disenos existentes en la CFE.

  17. Marcadores para la Realidad Aumentada para fines educativos

    OpenAIRE

    María Reina Zarate Nava; Cecilio Francisco Mendoza González; Honorato Aguilar Galicia; Juan Manuel Padilla Flores

    2013-01-01

    La Realidad Aumentada (AR) es considerada por algunos expertos como la tecnología en crecimiento para el 2014, en diferentes sectores: ingeniería, educación, juegos y negocios, siendo este último el más usado en él 2013. Sin embargo en el sector educativo la AR se presenta en algunos proyectos que se han desarrollado para diferentes áreas de las ciencias, como Química, Física y Matemáticas, lo anterior con el objetivo de facilitar el proceso de Enseñanza-Aprendizaje. En el presente artículo s...

  18. Taller para desarrollar la creatividad

    OpenAIRE

    MARTÍNEZ GUEROLA, BEATRIZ

    2015-01-01

    [ES] Partimos de la base de que la creatividad es una capacidad realmente valiosa, no solo para el ámbito artístico, si no para cualquier aspecto de la vida. Este proyecto está enfocado a un taller diseñado para que a partir de técnicas de expresión gráfico-plásticas podamos estimular y desarrollar la creatividad, principalmente en niños de tercer ciclo de primaria. Con este proyecto relacionamos el arte y la creatividad que se asocia a esté con la educación. Martínez Guerola, B. (2015). T...

  19. Para todo mal, a cura

    Directory of Open Access Journals (Sweden)

    Maria Borges

    2014-11-01

    Full Text Available Nesse artigo, eu apresento a teoria kantiana do mal. Mostrarei que Kant divide o mal em três níveis: fraqueza, impureza e perversidade, relacionando-os com afetos e paixões. Eu defendo que Kant apresenta várias formas de curar o mal nos diversos textos, tais como Doutrina da Virtude, Antropologia, Ideia para uma história universal do ponto de vista cosmopolita e Religião nos limites da simples razão. Eu tentarei mostrar que a virtude é impotente para curar o mal e que Kant apresenta uma comunidade ética para esse fim. Por fim, eu compararei a construção de comunidade ética com o estabelecimento de uma sociedade civil jurídica

  20. Instrucciones para los Autores

    Directory of Open Access Journals (Sweden)

    Revista Ciencias Biomedicas

    2014-04-01

    intereses debe estar especificada al final del artículo. También debe especificarse si se ha recibido dinero por concepto de financiación, especificando los orígenes y los códigos de las convocatorias donde se obtuvieron los recursos. De ser pertinente inmediatamente después pueden darse los agradecimientos respectivos a instituciones o personal que de otra manera aportaron al artículo y/o la investigación. 3. Políticas de arbitraje por pares. Los originales serán sometidos a un proceso de evaluación editorial que se cumplen en varias fases. Inicialmente los artículos recibidos son sometidos a un estudio preliminar por parte del director, editor o comité editorial quienes determinan la adecuada estructuración del manuscrito y su pertinencia con las políticas de la revista y de la institución. Si el artículo es aceptado por cumplir los requisitos formales y de contenido presentes en estas instrucciones, es enviado a dos pares académicos externos quienes de forma anónima realizan sugerencias y correcciones. Los pares evaluadores realizan su veredicto de la siguiente manera. (1 Publicar sin cambios. (2 publicar cuando se hayan cumplido las correcciones menores. (3 publicar cuando se hayan realizados correcciones de fondo y contenido. (4 no publicable. En caso de discrepancia en las opiniones será enviado a un tercer arbitro, de ser pertinente se solicitará la opinión a los miembro del comité científico. Los autores serán informados oportunamente de las diferentes fases que se cumplen en el proceso de evaluación editorial. Ellos recibirán las opiniones que han dado los pares evaluadores externos y siempre de forma anónima. También serán sometidos a evaluación por lingüística en español y en inglés. Al ser aprobada la publicación inmediatamente serán notificados los autores y se expedirá la certificación respectiva. Al estar disponibles las galeradas serán enviadas a los autores para evaluación y aprobación final.

  1. Verification and software validation for nuclear instrumentation; Verificacion y validacion de software para instrumentacion nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gaytan G, E. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Salgado G, J. R. [Comision Nacional de Seguridad Nuclear y Salvaguardias, Dr. Barragan No. 779, Col. Narvarte, 03020 Mexico D. F. (Mexico); De Andrade O, E. [Universidad Federal de Rio de Janeiro, Caixa Postal 68509, 21945-970 Rio de Janeiro (Brazil); Ramirez G, A., E-mail: elvira.gaytan@inin.gob.mx [Comision Federal de Electricidad, Gerencia de Centrales Nucleoelectricas, Alto Lucero, Veracruz (Mexico)

    2014-10-15

    In this work is presented a Verification Methodology and Software Validation, to be applied in instruments of nuclear use with associate software. This methodology was developed under the auspices of IAEA, through the regional projects RLA4022 (ARCAL XCIX) and RLA1011 (RLA CXXIII), led by Mexico. In the first project three plans and three procedures were elaborated taking into consideration IEEE standards, and in the second project these documents were updated considering ISO and IEC standards. The developed methodology has been distributed to the participant countries of Latin America in the ARCAL projects and two related courses have been imparted with the participation of several countries, and participating institutions of Mexico like Instituto Nacional de Investigaciones Nucleares (ININ), Comision Federal de Electricidad (CFE) and Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS). In the ININ due to the necessity to work with Software Quality Guarantee in systems for the nuclear power plant of the CFE, a Software Quality Guarantee Plan and five procedures were developed in the year 2004, obtaining the qualification of the ININ for software development for the nuclear power plant of CFE. These first documents were developed taking like reference IEEE standards and regulator guides of NRC, being the first step for the development of the methodology. (Author)

  2. Interfaces no convencionales para juegos

    OpenAIRE

    Castro, Silvia Mabel; Larrea, Martín Leonardo; Martig, Sergio R.

    2005-01-01

    Además de los juegos para PCs de escritorio y consolas, hay numerosos juegos desarrollados para dispositivos móviles, tales como los celulares y las PALMs. Sin embargo, sólo unos pocos pueden sentir el ambiente físico. La mayoría de los juegos están atados al escritorio o a los dispositivos en los que el juego se ejecuta y son raros los que salen de allí, sin siquiera pensar en una experiencia que extienda considerablemente el área de juego. Esto plantea el desafío de nuevas tecnologías o ...

  3. Gas turbine application in power plants of Mexican refineries; Aplicacion de turbinas de gas en plantas de fuerza de refinerias mexicanas

    Energy Technology Data Exchange (ETDEWEB)

    Alcaraz Calderon, A. M.; Rodriguez Martinez, H.; Garcia Paredes, Job; Morales Guillen, Magdalena; Manzanares Papayanapolous, Emilio [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: malcaraz@iie.org.mx; jhrm@iie.org.mx; jgarcia@iie.org.mx; mmmg@iie.org.mx; emp@iie.org.mx

    2010-11-15

    This article presents an overview of the application to have the gas turbine power generation systems, electric and steam for Mexican refineries. First there is a general description of the gas turbines and heat recovery (system components CHP) and CHP schemes are based on gas turbines capable of use in Mexican refineries. Subsequently referred to the characteristics of energy consumption (steam and electricity) from Mexican refineries and performs a technical analysis of CHP schemes based on gas turbines from the point of view of rates Q/W, power efficiencies and combined concluded that by their nature are very useful for refinery and gives some recommendations for improved implementation. [Spanish] En este articulo se presenta una vision general de la aplicacion que tienen las turbinas de gas en sistemas de generacion de energia electrica y vapor para refinerias mexicanas. Primeramente se da una descripcion general de las turbinas de gas y recuperadores de calor (componentes principales del sistema de cogeneracion) y se muestran los esquemas de cogeneracion basados en turbinas de gas susceptibles de utilizar en refinerias mexicanas. Posteriormente se mencionan las caracteristicas de consumos energeticos (vapor y energia electrica) de las refinerias mexicanas y se realiza un analisis tecnico de los esquemas de cogeneracion basado en turbinas de gas desde el punto de vista de tasas Q/W, eficiencias electricas y combinadas, concluyendose que por sus caracteristicas son muy utiles para refinerias y se dan algunas recomendaciones para su mejor aplicacion.

  4. Remedial actions to improve the availability in steam generators; Acciones correctivas para mejorar la disponibilidad en generadores de vapor

    Energy Technology Data Exchange (ETDEWEB)

    Torres Toledano, J. Gerardo; Porras Loaiza, G. Lizbeth; Sanchez Hernandez, Laura E.; Salinas B, Victor M.; Nebart G, Jesus [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    was demonstrated that the lack of power of the unit is not due to the combustion air deficiency. The metallographic study of the fault of the RU tube is mentioned, where a graph of the estimated life span at different rates of wear by corrosion and metal temperature for a tube of SA-213-TPH metal is presented. The details of the interconnections at the reheater are shown and a table of comparison of proposed temperatures at the RH outlet is present. A table of main causes of power decrease is attached. [Spanish] En este articulo se presentan los resultados del analisis de fallas recurrentes de cuatro Unidades Generadoras de Centrales Termoelectricas (UGT) de la Comision Federal de Electricidad (CFE). En tres de los cuatro casos, los estudios se enfocaron a identificar y corregir las causas raiz de fallas recurrentes en tubos de generadores de vapor, las unidades analizadas son: U-2 del Complejo Termoelectrico Pdte. Adolfo Lopez Mateos (CTPALM) de Tuxpan, Veracruz; U-3 de la Central Termoelectrica (CT) de Salamanca, y U-1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan. En el otro caso se analizo la insuficiencia de aire de combustion como una de las causas de decremento de potencia de la unidad 1 de la CT Gral. Manuel Alvarez Moreno de Manzanillo, Colima. Los generadores de vapor de la unidad 2 del CTPALM y la unidad 3 de la CT de Salamanca presentaron fallas en el banco del recalentador (RH). En este caso las recomendaciones se enfocaron al mejoramiento en las condiciones operativas para atenuar las fallas por corrosion en alta temperatura. A diferencia del CTPALM, en el caso de la U-3 de Salamanca se concluyo que es necesario el rediseno del RH; para ello se propuso permutar trayectorias de tubos calientes con los frios para uniformizar la temperatura de vapor a la salida del RH. Para evaluar los problemas que se han presentado en el generador de vapor de las unidades 1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan se analizaron las fallas de

  5. Renewable energies for power generation in Latin America: market, technologies and perspectives; Energias renovables para generacion de electricidad en America Latina: mercado, tecnologias y perspectivas

    Energy Technology Data Exchange (ETDEWEB)

    De Martino Jannuzzi, Gilberto [Universidade Estadual de Campinas, UNICAMP e International Energy Initiative (Brazil); De Buen Rodriguez, Odon [Energia, Tecnologia y Educacion, S.C., ENTE, S.C. (Mexico); Gorenstein Dedecca, Joao [International Energy Initiative, IEI (Brazil); Goncalves Nogueira, Larissa [International Energy Initiative, IEI (Brazil); Maia Gomes, Rodolfo Dourado [International Energy Initiative, IEI (Brazil); Navarro, Judith [Energia, Tecnologia y Educacion, S.C., ENTE, S.C. (Mexico)

    2010-07-01

    hidroelectrica en la region. La energia geotermica es un recurso importante en Mexico y en America Central, con una capacidad instalada de 965 MW y 502 MW en 2008, respectivamente. En esos dos casos, es la principal fuente de generacion de electricidad. Argentina posee campos de alta entalpia, adecuados para el aprovechamiento geotermico para la generacion de electricidad, pero no hay ninguna estimacion del potencial de generacion. Chile es otro pais que trata de desarrollar su potencial geotermico. En 2009, el Gobierno de Chile llamo una licitacion para 20 concesiones de explotacion de energia geotermica. Durante el proceso de licitacion geotermica se recibieron 59 ofertas de proyectos de explotacion y se concedio a 9 empresas la concesion de las 20 areas licitadas. La biomasa es un recurso energetico de especial importancia en Brasil, donde ya supera a las PCH. Tambien es relevante en Argentina y Colombia, donde esta asociada a la industria alco-azucarera y al creciente interes en sistemas de cogeneracion.

  6. Espacio de trabajo colaborativo para emprendedores, Pinedo

    OpenAIRE

    FERRIZ NAVARRO, ANDRÉS

    2016-01-01

    Espacio de trabajo colaborativo (CoWorking) para emprendedores en Pinedo. Ferriz Navarro, A. (2014). Espacio de trabajo colaborativo para emprendedores, Pinedo. http://hdl.handle.net/10251/67050. Archivo delegado

  7. MODELO PARA ESTABLECER SANCIONES PECUNIARIAS PARA DELITOS AMBIENTALES

    Directory of Open Access Journals (Sweden)

    LUIS DIEGO VÉLEZ GÓMEZ

    2012-01-01

    Full Text Available Este artículo pretende exponer el modelo básico que sustenta el desarrollo de multas óptimas; en él se muestra la forma de desincentivar los intereses del violador de la normatividad ambiental, e igualmente el método para alcanzar efectos compensatorios sobre los daños cometidos al medio ambiente. El desarrollo del tema sobre sanciones pecuniarias (multas y penalidades (encarcelamiento toma la relación contractual entre el agente (la empresa y el principal (La entidad reguladora para, a través de esta relación, entrar en la determinación de un diseño eficaz de sanciones. Se utilizara el modelo de agente-principal para examinar los efectos de las sanciones corporativas e individuales sobre los incentivos de cumplimiento en el contexto ambiental; además se emplearán los conceptos de bienes públicos, bienes comunes y externalidades como categorías de análisis que permiten la identificación y valoración de daños ambientales.

  8. Nacidos para curar...y vivir.

    Directory of Open Access Journals (Sweden)

    Pedro A Marina González

    2009-01-01

    Full Text Available Se presentan argumentos para el debate acerca del impacto para la sociedad y el individuo de las técnicas de reproducción que permiten el “diseño” genético de bebes para el tratamiento de hermanos con enfermedades incurables.

  9. Ocio Inclusivo para personas con discapacidad

    OpenAIRE

    Ruiloba Arce, Marta María

    2014-01-01

    Mi proyecto de Fin de Grado trata del ocio inclusivo para personas con discapacidad intelectual. Como educadora social apuesto por la inclusión social para la mejora de calidad de vida de las personas, siendo uno de los medios más efectivos para lograr una sociedad sin diferencias ni prejuicios. [...

  10. Uma taxonomia para modelos multiparadigma

    OpenAIRE

    Barbosa, Jorge L. V.; Geyer, Cláudio Fernando Resin

    1998-01-01

    Desde os primórdios da humanidade a raça humana busca compreender. A ciência, como instrumento de descobrimento do universo, vem alcançando contínuos sucessos. As descobertas científicas permitiram ao Homem criar um modelo bastante estável e previsível para a realidade na qual está inserido. Em grande parte, o sucesso da ciência basea-se na estratégia de fragmentação do conhecimento, ou seja, na criação de diversas áreas de especialização. A fragmentação é uma solução natural para resolver pr...

  11. Separating Para and Ortho Water

    CERN Document Server

    Horke, Daniel A; Długołęcki, Karol; Küpper, Jochen

    2014-01-01

    Water exists as two nuclear-spin isomers, para and ortho, determined by the overall spin of its two hydrogen nuclei. For isolated water molecules the conversion between these isomers is forbidden and they act as different molecular species. Yet, these species are not readily separable, and little is known about their specific physical and chemical properties, conversion mechanisms, or interactions. Here we demonstrate the production of isolated samples of both spin isomers in pure beams of para and ortho water, with both species in their respective absolute ground state. These single-quantum-state samples are ideal targets for unraveling spin-conversion mechanisms, for precision spectroscopy and fundamental-symmetry-breaking studies, and for spin-enhanced applications, e. g., laboratory astrophysics and -chemistry or hypersensitized NMR experiments.

  12. Argumentos para repensar el "desarrollo"

    Directory of Open Access Journals (Sweden)

    María Luisa Eschenhagen

    2001-06-01

    Full Text Available Con este trabajo se quiere hacer una aproximación al problema desde una perspectiva diferente, considerando nuevos argumentos que hasta hace muy poco tiempo no se habían tenido en cuenta y que se vienen formulando de una manera muy interesante en los últimos años. El objetivo del artículo es presentar tres argumentos para señalar la necesidad de repensar, desde sus fundamentos, el concepto de desarrollo.

  13. para asegurar un hijo sano

    Directory of Open Access Journals (Sweden)

    Carmen Amarilis Guerra de Castillo

    2006-01-01

    Full Text Available Esta investigación etnográfica focalizada exploró las creencias, los valores, los hábitos y los padrones comportamentales de las embarazadas diabéticas atendidas en el Hospital Doctor Enrique Tejera, quienes residen en tres comunidades urbanas pobres de la ciudad de Valencia - Venezuela, con el objetivo de encontrar el significado del cuidado de si para dichas grávidas. Se utilizó como referencial teórico el Modelo del Análisis de la Salud y la Teoría Antropológica de la Salud, siendo fundamentales para revelar aquello que estaba implícito en el comportamiento de las mujeres con relación a su cuidado. Surgieron tres temas: la salud y la enfermedad - valores culturales del cuidado de si; las prácticas del cuidado de la salud y cuidándose en el embarazo garantiza tener un hijo más saludable. Los temas culturales revelaron que las creencias, los valores, los hábitos y los patrones culturales comportamentales, conforme las tres maneras de acción identificadas, pueden ser preservadas, acomodadas y re-estructuradas para proporcionar un cuidado culturalmente congruente.

  14. Estrategia para la sustentabilidad ambiental

    Directory of Open Access Journals (Sweden)

    Cecilia Erbiti

    2006-01-01

    Full Text Available En el contexto de los postulados conceptuales y metodológicos de la planificación estratégica y de sustentabilidad ambiental, el objetivo de esta investigación es describir el proceso de formulación del Plan de Ordenamiento Territorial del Municipio de Tandil (POTM y analizar su potencialidad para avanzar hacia la sustentabilidad ambiental del sistema. Los resultados de la misma muestran que el POTM no sólo prioriza principios, objetivos y estrategias que materializan las diferentes manifestaciones de la sustentabilidad (económica, social, ecológica y política, sino que la totalidad del Plan se fundamenta en el concepto de desarrollo sostenible y, con ello, se establecen prioridades de actuación que posibilitarán la gestión ambiental urbana. Si bien el POTM muestra una gran potencialidad para avanzar hacia la sustentabilidad del territorio, la implementación y cumplimiento del mismo constituye un fuerte desafío para las autoridades de aplicación.

  15. PLATAFORMA PARA LA VENTA DE VIDEOJUEGOS DIGITALES PARA PC

    OpenAIRE

    Gómez-Eguílar, Javier

    2013-01-01

    A lo largo del trabajo vamos a exponer nuestra propia idea de negocio de una nueva empresa, llamada GAMERINET, que se dedique a la venta de videojuegos de ordenador en descarga digital a través de nuestra web. Para ello vamos a ver una breve introducción a este sector de negocio y su historia, haremos un análisis de las condiciones actuales del sector, a través del análisis del entorno específico (5 Fuerzas de Porter) y del análisis del entorno general (Análisis PEST). Posterio...

  16. Procedure of generation of the ECP database for Laguna Verde; Procedimiento de generacion de base de datos ECP para Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-09-15

    This procedure will be used by the personnel of the Discipline of Nuclear Analysis of the Reactor of CFE to execute PRESTO with the purpose of generating the base for the Estimate of the Position of critical bars during the start up (ECP Database). (Author)

  17. Bombas extractoras para lactancia materna

    OpenAIRE

    Rozas García, M. Rosa

    1997-01-01

    Durante la lactancia materna pueden utilizarse diferentes accesorios para complementarla, entre los cuales se encuentran las bombas extractoras de leche materna. Describiremos las características generales de los diferentes tipos de bombas extractoras, de modo que el profesional de enfermería conozca no sólo el funcionamiento de los aparatos, sino que también adquiera unos conocimientos acerca de sus indicaciones, manipulación, ventajas e inconvenientes, y pueda asesorar en todo momento a la ...

  18. Ambiente Java para sistemas embedded

    OpenAIRE

    Silva, Valter Filipe Miranda Castelão da

    2002-01-01

    Os sistemas integrados, ou genericamente os sistemas com reduzida capacidade de processamento e pouca memória, são actualmente sistemas economicamente acessíveis e muito divulgados. Os seus sistemas operativos estão, no entanto, ainda bastante dependentes do hardware o que faz que cada aplicação seja especialmente desenvolvida para cada tipo de sistema. Neste documento discute-se a aplicabilidade de uma máquina virtual Java em equipamentos com estas restrições. É proposta a ...

  19. Tendiendo puentes para la convivencia

    OpenAIRE

    Marcos Aranda, Rafael

    2006-01-01

    El Foro Iberoamericano sobre Seguridad Ciudadana, Violencia Social y Políticas Públicas, que se celebró en Madrid y Alcalá de Henares, entre los días 19 y 23 de junio del presente año, concluyó con la presentación de un documento de compromiso titulado «Tendiendo puentes para la convivencia». Dicho documento puede calificarse de mínimos, aunque en él se establecen una serie de consensos básicos, los cuales nos invitan a reflexionar sobre una realidad terriblemente complej...

  20. Manual de mercadeo para pymes

    OpenAIRE

    Botero Ardila, José Luis

    2012-01-01

    Este texto presenta las definiciones y lineamientos a seguir por parte de los empresarios, con el fin de hacerlos más competitivos a la hora de enfrentar las variaciones del mercado o del entorno competitivo. Su diseño tiene en cuenta al empresario que no dispone de mucho tiempo para aplicar el mercadeo en su empresa, por lo cual incluye la posibilidad de diagnosticar de manera autónoma el estado de la misma. Entre los temas que encontrará el lector se encuentran: ¿qué es mercadeo, investigac...

  1. Pequenos para idade gestacional: fator de risco para mortalidade neonatal

    Directory of Open Access Journals (Sweden)

    Almeida Márcia Furquim de

    1998-01-01

    Full Text Available OBJETIVO: Estudar as variáveis contempladas na Declaração de Nascimento (DN como possíveis fatores de risco para nascimentos pequenos para a idade gestacional (PIG e o retardo de crescimento intra-uterino como fator de risco para a mortalidade neonatal. MATERIAL E MÉTODO: As variáveis existentes na DN foram obtidas diretamente de prontuários hospitalares. Os dados referem-se a uma coorte de nascimentos obtida por meio da vinculação das declarações de nascimento e óbito, correspondendo a 2.251 nascimentos vivos hospitalares, de mães residentes, ocorridos no Município de Santo André, Região Metropolitana de São Paulo, no período de l/1 a 30/6/1992, e aos óbitos neonatais verificados nessa coorte. RESULTADOS: Obteve-se a proporção de 4,3% de nascimentos PIG, significativamente maior entre os recém-nascidos de pré-termo e pós-termo, entre os nascimentos cujas mães tinham mais de 35 anos de idade e grau de instrução inferior ao primeiro grau completo. Os recém-nascidos PIG apresentam maior risco de morte neonatal que aqueles que não apresentavam sinais de retardo de crescimento intra-uterino. CONCLUSÕES: Em áreas com menor freqüência de baixo peso ao nascer, é importante investigar a presença de retardo de crescimento intra-uterino entre os nascimentos prematuros e não apenas nos nascimentos de termo. O registro da data da última menstruação (ou da idade gestacional em semanas não agregadas na DN facilitaria a detecção de PIGs na população de recém-nascidos.

  2. Spectral Analysis Code: PARAS SPEC

    CERN Document Server

    Chaturvedi, Priyanka; Anandarao, B G

    2016-01-01

    The light emitted from the stellar photosphere serves as a unique signature for the nature of stars. The behaviour of these stellar lines depend upon the surface temperature, mass, evolutionary status and chemical composition of the star. With the advent of high-resolution spectrographs coupled with medium to large aperture telescopes around the globe, there is plenty of high-resolution and high signal-to-noise ratio data available to the astronomy community. Apart from radial velocity (RV) studies, such data offer us the unique opportunity to study chemical composition and atmospheric properties of the star. The procedure used to derive these parameters must be automated and well adaptable to data available from any high-resolution spectrograph. We hereby present an IDL code, PARAS SPEC, which was primary designed to handle high-resolution spectroscopy data from PARAS spectrograph coupled with the 1.2~m telescope at Mt. Abu, India. This code is designed to adapt with data from other spectrographs as well. Th...

  3. Edificio para viviendas, en Barcelona

    Directory of Open Access Journals (Sweden)

    Barba Corsini, F.

    1967-05-01

    Full Text Available This building has a garage basement, a ground floor with a communed playing zone for all the children of the block, and the entrance vestibule. The rest of the building is occupied with apartments, of about 200 m2 each, which are functionally designed, and are suitable for medium sized average income families. Special attention has been given to the external facades, which, among other things, are of extremely simple design.El edificio contiene: en el sótano, un guardacoches; en la planta baja, una zona de juegos común para los niños de todas las viviendas, además de los vestíbulos. El resto de la superficie edificada está destinado a viviendas, de unos 200 m2, construidos con distribución funcional y adecuada para familias medias ya constituidas. Fue dedicada una especial atención a la composición de las fachadas, que ofrecen, entre otros atractivos, el de su elegante sencillez.

  4. Internet como instrumento para la Yihad

    Directory of Open Access Journals (Sweden)

    Alfonso Merlos García

    2006-01-01

    Full Text Available Las extraordinarias ventajas que ofrece Internet lo han convertido en un instrumento clave y dinámico en la estrategia de los yihadistas. Los medios de comunicación, la clase política y las agencias de seguridad e información han tendido a concentrar sus esfuerzos en la neutralización del ciberterrorismo sin prestar suficiente atención a los múltiples usos de Internet que están haciendo los neosalafistas: para la propaganda y para la guerra psicológica, para el reclutamiento y para la financiación, para la documentación y para la planificación de atentados. Las democracias deberían considerar el coste que tendrá la derrota frente al movimiento yihadista globalizado en la batalla por el ciberespacio

  5. Aprender para la vida o para el placer

    Directory of Open Access Journals (Sweden)

    Diobaldo César Heredia Gutiérrez

    2011-07-01

    Full Text Available El proceso enseñanza aprendizaje, se corresponde con un sistema comunicativo por excelenciaque requiere una alta dosis de amor que garantice el disfrute o goce de los participantes, enun interactuar de búsqueda y descubrimiento satisfactorio. Para imprimirle un alto grado de calidad, esdeseable la participación de estudiantes y docentes más emprendedores y críticos y menos académicoso dependientes, por ello el aprendizaje autónomo es clave, el logro u objetivo, entonces, es estudiantesque aprendan como si fueran a enseñar y docentes investigadores, proactivos y expertos en las materiasque enseñan.

  6. Inteligencia Emocional para tiempos de crisis

    OpenAIRE

    Fernandez-Berrocal, Pablo

    2014-01-01

    La Inteligencia Emocional se concibe como un conjunto de habilidades, tanto básicas como complejas, dirigidas a “unificar las emociones y el razonamiento”, esto es, usar las emociones para facilitar el razonamiento y los procesos de pensamiento, y usar nuestro razonamiento para pensar de forma inteligente acerca de nuestras emociones (Mayer y Salovey, 1997). En concreto, la IE se define como una habilidad mental que incluye “la capacidad para percibir, valorar y expresar las emociones con...

  7. Paisajes para un desarrollo sustentable y participativo

    Directory of Open Access Journals (Sweden)

    Rafael Mata Olmo

    2014-11-01

    Para terminar, el texto recoge una experiencia de proyecto territorial de paisaje, la del Plan Insular de Menorca (Islas Baleares, España, aprobado en 2003. Se sintetizan sus determinaciones sobre la protección de determinados terrenos por sus altos valores paisajísticos, sus directrices para que las políticas sectoriales (turismo, agricultura, infraestructuras, etc. incorporen criterios paisajísticos, y sus iniciativas para la gestión y mejora del paisaje y para el fomento del acceso público a su contemplación y disfrute.

  8. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  9. Entre velos: Maya para contrabajo

    Directory of Open Access Journals (Sweden)

    Rosa María Rodríguez Hernández

    2014-01-01

    Full Text Available Maya para contrabajo se materializa a partir de una imagen de Pepe Romero, cuyo texto interpreta a La decadencia de la mentira de Oscar Wilde. La estructura de Maya es binaria, especular y asimétrica; su poética obedece al juego verdad/mentira que subyace en la obra artística y en la vivencia del artista. Maya trae a la memoria las voces de los Upanishad, Schopenhauer, Shakespeare y Beethoven, influencias éstas en la obra de Wagner y, todas ellas, en la de Eliot. Los aspectos gestuales y visuales de Maya entrelazan con la danza de Pina Bausch y con la retórica (hypotiposis.

  10. Una minga para el posdesarrollo

    Directory of Open Access Journals (Sweden)

    Arturo Escobar

    2011-01-01

    Full Text Available El artículo sintetiza algunas conclusiones a las que han llegado movimientos sociales y académicos en las últimas dos décadas al reflexionar sobre la globalización y sus implicaciones; el modelo dominante, basado en las nociones de "desarrollo" y "modernidad", ha entrado en crisis. Por lo tanto, se hace necesario avanzar en una transición cultural que se pueda comprender como un cambio de época y no sólo como una época de cambios. Para llevar a cabo esta transformación, se deben resolver las con-tradicciones existentes entre el neodesarrollismo y el postdesarrollo, por supuesto, a favor de éste último.

  11. para su puesta en marcha

    Directory of Open Access Journals (Sweden)

    Sergio Franco Maass

    2004-01-01

    Full Text Available Los sistemas de información geográfica (SIG tienen una gran aplicación en la gestión municipal; permiten cumplir con dos objetivos fundamentales: el registro de información territorial y el análisis de problemas territoriales específicos. Con el fin de determinar la viabilidad de este tipo de tecnologías en el ámbito municipal, se enfrentó el problema de la localización de instalaciones para la disposición final de residuos sólidos urbanos en el municipio de Toluca, Estado de México. Se identifican ciertos aspectos que limitan la práctica de los SIG: la diversidad entre los municipios, los problemas administrativos, las deficiencias de la información y la carencia de recursos humanos, técnicos y financieros.

  12. Study of environmental pollution around the thermoelectric power plants of Electricity Federal Commission (CFE)

    International Nuclear Information System (INIS)

    The environmental aspects that have been considered inside the development of research projects in the Electrical Research Institute they can be classified of the next manner: a) Those that are related with the contamination of terrestrial atmosphere. b) Those that are related with the impact, identification and characterization of the most important processes which intervene in the deterioration of water quality. c) Those that are related with processes and systems for the utilization of solid wastes and the diminution of their contaminant effects of soil and subsoil. d) Those that are ones related with the effects what the electrical installations cause to the living beings by audible noises and the effects of electromagnetic fields. (Author)

  13. The para-HK/QK correspondence

    CERN Document Server

    Dyckmanns, Malte

    2016-01-01

    We generalise the hyper-Kahler/quaternionic Kahler (HK/QK) correspondence to include para-geometries, and present a new concise proof that the target manifold of the HK/QK correspondence is quaternionic Kahler. As an application, we construct one-parameter deformations of the temporal and Euclidean supergravity c-map metrics and show that they are para-quaternionic Kahler.

  14. Trabalhar para estudar/estudar para trabalhar: realidade e possibilidades

    Directory of Open Access Journals (Sweden)

    Janes Teresinha fraga Siqueira

    2011-01-01

    Full Text Available O trabalho que apresentamos é parte da pesquisa, ainda não concluída, com os estudantes das licenciaturas e da pedagogia da Universidade de Santa Cruz do Sul- UNISC-RS-Brasil. Este está inserido na linha de pesquisa: educação, trabalho e emancipação do mestrado em educação desta Universidade. Queremos compreender, à luz do materialismo histórico e dialético e das categorias da crítica da economia política, os significados atribuídos pelos estudantes universitários ao fenômeno trabalho e estudo. É uma pesquisa preferentemente qualitativa de natureza dialética. Para Marx, a essência da realidade humana reside no trabalho, mas a fonte de toda a riqueza está na natureza. Logo trabalho, natureza e sociedade estão em relação dialética. Trabalho, portanto, é a ideia central articuladora, e natureza e sociedade devem ser estudadas em conexão com o trabalho. Marx trata o trabalho, no modo de produção capitalista, como um impedimento ao desenvolvimento humano. Propõe omesmo como um ato de criação e auto-expressão humana que não deve ter um valor. A compreensão dessa premissa é necessária para que os trabalhadores possam significar e ressignificar o trabalho para além da ideologia dominante. Algumas categorias aparecem como relevantes para a análise: condições de trabalho e de estudo, necessidade de formação, predominância do trabalho sobre o estudo, dificuldade deconciliar tempo de estudo e de trabalho. Na relação com o objeto de estudo, ressaltaremos a crise estrutural do capital, a desregulamentação das leis do trabalho e sua flexibilização e as contradições entre trabalho e estudo bem como quais possibilidades emancipatórias são visualizadas ou sonhadas pelos trabalhadores estudantes.Resume Ce travail constitue une partie de la recherche entreprise avec les étudiants du cours de pédagogie de l´Universidade de Santa Cruz do Sul – UNISC – RS – Brésil. Il est intégré dans le champ de

  15. Recursos para un aprendizaje significativo

    Directory of Open Access Journals (Sweden)

    Juan LARA GUERRERO

    2009-11-01

    Full Text Available RESUMEN: Partimos del supuesto de que una de las cuestiones que más preocupa al profesorado en su práctica educativa radica en que el aprendizaje de sus alumnos sea significativo. Somos conscientes de que, para conseguir este tipo de aprendizaje, es necesario introducir una serie de cambios en la dinámica de la clase. Comenzamos diferenciando el aprendizaje maquinal del significativo. Continuamos aclarando una confusión muy extendida entre muchos educadores, que creen que el aprendizaje por recepción es repetitivo y que el efectuado por descubrimiento es forzosamente significativo. Posteriormente, planteamos una serie de interrogantes para aclarar algunas cuestiones que le pueden ser útiles a los educadores en su práctica cotidiana. Terminamos presentando la estrategia de organización, que cuenta con dos instrumentos, a nuestro juicio muy eficaces, para ayudar a los estudiantes, a aprender de manera significativa: los mapas conceptuales y la técnica heurística V.ABSTRACT: We start from the assumption that one of the questions that most worry the teaching staff in its educational practice consists in that its pupils' learning is significant. We are aware that, to obtain this kind of learning, it is necessary to introduce a series of changes in the classroom dynamics. We begin by making a distinction between mechanical and significant learning. We continué making clear a very extended confusión amongst many teachers, who believe that learning by reception is repetitive and that the one done by serendipity is necessarily significant. Afterwards, we créate a series of questions to clarify with some answers that can be useful to teachers in their everyday practice. We finish showing the organization strategy, which has two instruments, that in our opinión are very effective, to help students learning in a significant way: conceptual maps and the V heuristic technique.RÉSUMÉ: Nous partons de la supposition de qu'une des questions que

  16. Una red para la gente

    Directory of Open Access Journals (Sweden)

    Raúl Trejo Delarbre

    2004-02-01

    Full Text Available La próxima Cumbre Mundial de la Sociedad de la Información ha revitalizado, en numerosos países, el debate acerca de las nuevas tecnologías de la comunicación y los usos que pueden tener. Lamentablemente en México hemos estado casi del todo ajenos a esa intensa, extensa y en otras latitudes fructífera discusión. Ni los especialistas interesados en estos temas, ni la sociedad que es a la postre beneficiaria o damnificada según sea el empleo de tales tecnologías, ni los organismos del Estado a cargo de tales asuntos, han propiciado la reflexión colectiva que nos podría permitir tanto afinar las posiciones de nuestro país rumbo a la cumbre de Ginebra y Túnez como deliberar, en ese contexto, acerca de lo mucho que nos falta para tener un país auténticamente imbricado en la construcción de una auténtica Sociedad de la Información.

  17. Residencia para familias - Anglet (Francia

    Directory of Open Access Journals (Sweden)

    Hébrard, J. R.

    1971-11-01

    Full Text Available This residential hotel has 806 beds, which can be increased to 1,100 by adding some double beds. Its size and colour blends well with the picturesque surrounding, known as «Chambre d'Amour». The hotel involves 120 large apartments, and 50 smaller one, as well as 25 rooms for the staff, and flats for the manager and other senior officials. There is a hall, large living room, bar, rooms for playing games, nursery, and an additional hostel with 40 flats and staff rooms. The design is of a linear, continuous style, emphasizing its horizontal extension, though contrast is provided by a higher block, housing the vertical circulation facilities.Con un total de 806 plazas hoteleras, ampliables a 1.100 (si se utilizan literas, este conjunto, por su volumen y color se integra en el pintoresco paisaje del paraje conocido por «Chambre d'Amour». Comprende: 120 apartamentos; 50 más pequeños; 25 habitaciones para empleados; los apartamentos del director, gobernanta y recepcionistas; las zonas de vida en común: hall, salón, bar, sala de juegos y guardería; un albergue con 40 apartamentos; y las dependencias de la administración. Presenta un volumen lineal y continuo, modelando una composición de ritmo horizontal predominante, a la que le imprime gran variedad el cuerpo vertical de hormigón visto que contiene las circulaciones verticales.

  18. Inferencia bayesiana para algunas leyes de Lanchester

    OpenAIRE

    Wiper, Michael P.; Pettit, L. I.; Young, K. D. S.

    2000-01-01

    Lanchester (1916) introdujo una serie de ecuaciones o leyes determinísticas para modelar los números de bajas en un combate sin refuerzos. Un inconveniente de estos modelos es que no son útiles ni para la inferencia ni para la predicción, ya que el resultado de una batalla viene determinado por los parámetros del sistema y los tamaños iniciales de cada ejército. Se han propuesto varias versiones estocásticas de las ecuaciones de Lanchester. En este artículo, se resumen algunos de estos modelo...

  19. Estereoscopio com tela holografica para ver tomografias

    CERN Document Server

    Lunazzi, J J; Magalhaes, D S F

    2010-01-01

    A estereoscopia eh uma tecnica que permite a observacao de imagens tridimensionais, mas estah sempre associada com o uso de algum equipamento especial para visualizacao, como oculos bicolores ou polarizados. Para o uso em aplicacoes medicas o emprego de tais equipamentos pode inviabilizar sua utilizacao durante procedimentos cirurgicos, por exemplo. Neste trabalho apresentamos um novo tipo de estereoscopio que utiliza uma tela holografica para geracao de imagens tridimensionais sem o uso de qualquer equipamento adicional. Apresentamos a descricao do equipamento utilizado e resultados das imagens visualizadas.

  20. Test para la profilaxis de la prematuridad

    OpenAIRE

    Cruz Laguna, Gladys María

    2008-01-01

    La prematuridad constituye un problema mundial de salud, la comunidad científica busca predictores para disminuir su incidencia. La investigación persiguió obtener una escala de puntuación que modele las características cervicales y permita diagnosticar la condición de riesgo de las gestantes para extender el período de gestación y lograr nacimientos al término. Se realizó un cuasiexperimento en gestantes con factores de riesgo para la prematuridad del municipio Holguín. La muestra fue confor...

  1. Biocomercio: una alternativa para el desarrollo sostenible

    OpenAIRE

    Murillo R., Carlos; Arias Ramírez, Rafael

    2008-01-01

    El desarrollo sostenible en países ricos en biodiversidad dependerá de la capacidad de los gobiernos de implementar los arreglos institucionales necesarios para conciliar la preservación de los recursos naturales con el uso de los mismos para la producción de bienes y servicios que puedan potenciar el crecimiento económico y un mayor bienestar para las comunidades locales donde estos recursos se encuentren. Este es el objetivo de la Iniciativa de Biocomercio que ha venido impulsando la Confer...

  2. Domótica para viviendas construidas

    OpenAIRE

    Beaskoetxea Gartzia, Unai

    2011-01-01

    El objeto de este proyecto fin de carrera es mostrar las distintas tecnologías disponibles para la domótica actual, y cómo se podría aplicarlas en una vivienda ya construida, incidiendo en el uso de la tecnología ZigBee, aunque también se combinará con el uso de KNX, RF, etc. Este proyecto presentará 3 niveles de domótica: un primer nivel para personas sin discapacidad, un segundo nivel para personas de edad avanzada, y un tercer nivel adaptado a personas con discapacidad. Se indicará...

  3. Los videojuegos: conectar alumnos para aprender

    OpenAIRE

    José Antonio Valderrama Ramos

    2012-01-01

    Este artículo explora la utilidad que presentan los videojuegos comerciales actuales para educar a los jugadores y ayudarlos a adquirir habilidades necesarias para desempeñarse mejor en nuestra sociedad. Aborda el problema de la educación formal, la cual no está respondiendo a la situación de complejidad de nuestro entorno y usa el paradigma del pensamiento complejo y siete saberes para la educación propuestas por Edgar Morin. También, describe algunas ideas que le pueden ser de utilidad a do...

  4. Una arquitectura unificada para el razonamiento borroso

    OpenAIRE

    Rafael Bello Pérez; Carlos Morell Pérez

    2011-01-01

    Se presenta una arquitectura para desarrollar de forma unificada tanto el razonamiento basado en reglas como el basado en casos considerando rasgos borrosos. El modelo permite usar varios de los procedimientos desarrollados para el razonamiento borroso basado en reglas en el razonamiento borroso basado en casos. Además, se proponen varias funciones de semejanza y funciones de comparación de rasgos para realizar la recuperación de casos con rasgos borrosos. Se muestra la aplicación del modelo ...

  5. Asistente para consultas espaciales en Hive

    OpenAIRE

    Maldonado Muñoz, José Emilio

    2015-01-01

    El trabajo descrito y desarrollado a lo largo de esta memoria tiene como objetivo principal establecer un esquema de decisiones básicas para realizar consultas sobre datos espaciales en Hadoop/Hive. Dicho esquema servirá de asistente y soporte para usuarios nuevos en Hive, que teniendo nociones mínimamente básicas sobre el lenguaje de consultas estándar SQL, quieran trabajar en un ámbito Big Data sobre datos espaciales. En definitiva, este trabajo sirve para facilitar y asistir la primera tom...

  6. Nuevos registros de clorofitas marinas para Cuba

    OpenAIRE

    A. Moreira; Fujii, M.T.; Suárez, A. M.; Wynne, M.J.

    2013-01-01

    A partir de muestras colectadas en la bahía de Cienfuegos y de Santa Lucía (Pinar del Río), se identificaron dos nuevos registros de macroalgas marinas (clorofitas) para Cuba: Cladophora blomquistii C. Hoek y Udotea fibrosa D. S. Littler & M. M. Littler. C. blomquistii se registra por primera vez para la región del Caribe ya que se había consignado solo para lagunas costeras de la Florida, y la parte noreste del golfo de México. Se ofrecen además comentarios sobre la taxonomía, ...

  7. pipetas usadas para I. A.

    Directory of Open Access Journals (Sweden)

    J. Castañeda

    2004-01-01

    Full Text Available La vagina y cerviz de las cerdas son estimuladas físicamente durante la inseminación. Este contacto puede afectar características reproductivas tales como el transporte espermático y el proceso de ovulación. En el presente trabajo se evaluaron desde el punto de vista económico y reproductivo, tres tipos de pipetas utilizadas para I. A. de cerdas de diferente material y forma. Se utilizaron 120 animales multíparos asignados de acuerdo a su orden de entrada al celo, en forma sucesiva a uno de tres grupos experimentales: 1 I. A. mediante pipeta reusable de hule tipo Melrose ( Medata, 2 I. A. con pipeta desechable de punta plástica en espiral y 3 I. A. con pipeta desechable con punta de poliestireno redonda (Medi chimica. No se encontró diferencia (P>0.05 entre los porcentajes de gestación, parición y promedio de lechones nacidos vivos por parto, en el tiempo de aplicación del semen, ni en el volumen del mismo, arrojado por las cerdas en los 10 min. posteriores a la I. A. Los valores promedio fueron de: 91.7%, 86.7%, 10.4 ± 2.8, 7.8 ± 2.6 min. y 10.4 ± 11.3 ml, respectivamente. El análisis de regresión, no mostró significancia en cuanto a paridad en ninguna de las variables estudiadas (P>0.05. Se concluye que las pipetas evaluadas no difieren en su efecto sobre el desarrollo reproductivo de la piara. Sin embargo, la pipeta reusable tipo Melrose ofrece ventaja económica bajo las condiciones del presente estudio

  8. Hypersurfaces with Isotropic Para-Blaschke Tensor

    Institute of Scientific and Technical Information of China (English)

    Jian Bo FANG; Kun ZHANG

    2014-01-01

    Let Mn be an n-dimensional submanifold without umbilical points in the (n+1)-dimen-sional unit sphere Sn+1. Four basic invariants of Mn under the Moebius transformation group of Sn+1 are a1-form Φ called moebius form, a symmetric (0, 2) tensor A called Blaschke tensor, a symmetric (0, 2) tensor B called Moebius second fundamental form and a positive definite (0, 2) tensor g called Moebius metric. A symmetric (0, 2) tensor D = A+μB called para-Blaschke tensor, where μ is constant, is also an Moebius invariant. We call the para-Blaschke tensor is isotropic if there exists a function λ such that D = λg. One of the basic questions in Moebius geometry is to classify the hypersurfaces with isotropic para-Blaschke tensor. When λ is not constant, all hypersurfaces with isotropic para-Blaschke tensor are explicitly expressed in this paper.

  9. Tableros para actividades plásticas

    OpenAIRE

    Alcante, Ariana; Debenedeto, Martín; Defeo, Emiliano; Truchi, Julieta; Wild, Diego

    2014-01-01

    Las características de este proyecto se desprenden de una necesidad real del Departamento de Plástica de la FBA: equipar algunas aulas para actividades plásticas con tableros o con atriles que puedan utilizarse en forma vertical, horizontal y, eventualmente, que sirvan para exponer trabajos. Además, tenían que tener un bajo costo de producción. (Párrafo extraído del texto a modo de resumen)

  10. Un almuerzo para llevar saludable (Packing Smart)

    Centers for Disease Control (CDC) Podcasts

    2011-08-22

    En este podcast para niños, los chicos de Kidtastics hablan sobre almuerzos creativos para llevarse a la escuela, que ayuden a mantenerse con energía el resto del día.  Created: 8/22/2011 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 1/3/2012.

  11. Kehidupan Sosial Para Homeless di Jepang

    OpenAIRE

    Handayani, Savitri

    2015-01-01

    Homuresu berasal dari bahasa Inggris yaitu homeless yang artinya tidak memiliki rumah. Tapi masyarakat Jepang dahulu menyebutnya furosha yang berarti gelandangan atau tunawisma. Pertumbuhan homeless pertama kali meningkat pada tahun 1960-an setelah perang dunia II. Homeless muncul akibat resesi ekonomi yang melanda Jepang. Para homeless tersebut berasal dari kaum buruh yoseba, para pekerja reguler dan non reguler. Yoseba adalah sebutan untuk tempat jasa bantuan untuk menunggu lowongan pekerja...

  12. Neurocisticercosis: Afiches para Capacitación

    Directory of Open Access Journals (Sweden)

    MARCELO ROJAS C

    2007-02-01

    Full Text Available En el sistema universitario (me atrevo a decir, de todo el mundo, es poco el contenido educativo relativo a la Transferencia tecnológica para efectos de la capacitación de la sociedad sobre problemas de salud (claros ejemplos desafiantes para los veterinarios son la hidatidosis y cisticercosis y otros; manejados en términos de cambios de conducta. Los términos de control y prevención están dados en un lenguaje académico, muy abstracto y obviamente intrascedente en la comunidad. Al punto que que las recomendaciones que manejan los Profesionales, resultan imprácticos en el ámbito social. Cada vez que voy a Provincias (interior del país y tengo la oportunidad de hablar sobre el control de las citadas metocestodiadis: mis auditorios quedan impactado y entendiendo la gravedad del Problema, y la tarea para solucionarlo. Los Técnicos Agropecuarios, los de las ONGs, los mismos Profesionales del Ministerio de Agricultura (SENASA, quedan impresionados del mensaje y contenido de los Afiches. Muchísimas veces me las han pedido (los afiches, pero les ofrecí publicarlos; porque considero que tiene gran creatividad y propiedad intelectual. He visto muchísimas imágenes de Capacitación; que en lugar de simplificar el mensaje, los complican. Es pues, una herramienta de trabajo para los capacitadores, para Veterinarios jóvenes e inexpertos, para la gente que está en contacto directo con el problema (pobladores; pero también lo será para tantos nuevos Profesores universitarios, sin experiencia de campo. Puede que impresione negativamente el lenguaje de los afiches; pero casualmente está hecho en el lenguaje popular que conoce la comunidad rural. La publicación persigue entregar a usarios capacitadores de una herramienta para publicitarlos masivamente.

  13. Fatores de risco para nascimento de crianças pequenas para idade gestacional

    OpenAIRE

    Zambonato Ana Maria Krusser; Pinheiro Ricardo Tavares; Horta Bernardo Lessa; Tomasi Elaine

    2004-01-01

    OBJETIVO: Determinar os fatores de risco para o nascimento de crianças pequenas para a idade gestacional. MÉTODOS: Nos meses de outubro a dezembro de 1996, cinco maternidades de Pelotas, RS, foram visitadas diariamente para entrevistar puérperas. O peso ao nascer foi obtido do registro dos berçários. A idade gestacional foi calculada a partir da data da última menstruação. Considerou-se como pequena para a idade gestacional (PIG) aquelas crianças cujo peso ao nascer, de acordo com o sexo e a ...

  14. Framework para implementar pruebas de usabilidad flexibles para aplicaciones móviles

    OpenAIRE

    Enriquez, Juan G.; Casas, Sandra

    2014-01-01

    Al realizar pruebas de usabilidad en aplicaciones móviles, dos de los factores a considerar son el contexto móvil de uso y la variabilidad del hardware de los dispositivos móviles. Este trabajo propone un framework para implementar pruebas de usabilidad que sean flexibles para los desarrolladores al encontrarse con diferente hardware, no intrusivas para la aplicación que se quiere probar y que recolecten, además de las métricas de usabilidad, información relacionada al contexto de uso. Para l...

  15. UM TRATADO PARA O AMOR

    Directory of Open Access Journals (Sweden)

    Maria José Caldeira do Amaral

    2015-07-01

    Full Text Available No Tratado do Amor Cortês - Tractatus de Amore - André Capelão deseja oferecer ao leitor a arte cortês de amar, a beleza do desejo erótico e a disciplina da paixão constitutiva dessa arte que é amar. O maior argumento dessa obra é efetivar o suspiro fundo que a dimensão amorosa infunde na alma do homem e da mulher aos quais foi concedida a virtude. Para esse autor, escriba da chancelaria real e talvez, não se sabe com certeza, um Ordo Sacratus, o amor é a raiz de toda cortesia, a fonte de todo bem. Nosso objetivo, então, é encontrar nessa suma amorosa construída nos enlaces da Literatura de Cavalaria Medieval, os desdobramentos essenciais dessa vida afetiva bela e virtuosa no enredo profundo do qual emerge o afeto, a fé e a contradição da experiência humana do sofrimento amoroso. Palavras Chave: Literatura Medieval. Amor Cortês, André Capelão, virtude, desejo. Abstract: With the treaty toward the love - Tractatus de Amore – André Capelão offers to the reader the courteous’ art for love, the erotic desire’s beauty and the  suffering discipline belong this love’s art  is. The best reason of this literary composition is to achieve the depth sigh that the loving dimension infuses into the lovers’s soul, the man and the woman wich this virtue was conceded. For this author, the royal chancery scribe and perhaps, no one knows for sure, a Sacratus Ordo, love is the root of all free, the source of all good. Our goal, then, is to find this sum loving built in interlacing of Medieval Knights literature, the essential developments of this beautiful and virtuous love life in the deep storyline which emerges affection, faith and the contradiction of the human experience of love suffering. Key words: Medieval Literature. Courteous Love. André Capelão. Virtue.

  16. Alimentos balanceados para perros en Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth Vargas

    2001-01-01

    Full Text Available Diagnóstico de la comercialización de alimentos balanceados para perros en Costa Rica. Para ampliar los reportes oficiales de la comercialización de alimentos para perros se creó una base de datos que incluyó cantidad, costo, empaque y formulación durante el período 1998 a agosto del 2000. De 1995 a 1998 y de 1996 a 1999 la producción nacional incrementó un 90,4% y la importación un 42,56% respectivamente, ocupando los alimentos nacionales un 72% del tonelaje y un 70% del valor en dólares americanos. No fue posible determinar cuál es el empaque más comercializado, pero si que los alimentos extrusados son los que ocupan el primer lugar y que los alimentos recomendados para cachorros y adultos son los que más se comercializan. La ausencia de datos en las declaraciones sugiere la necesidad de incrementar el control en las mismas en caso de requerirse un estudio de mercado, ya que contrariamente a esta situación el mayor número de garantías inscritas corresponden separadamente para las fases de cachorros y adultos. Merece también atención que las garantías indican mayores porcentajes de proteína cruda que los recomendados por la AAFCO y que al menos 36 fórmulas son recomendadas para estados sanitarios específicos (p.e. para perros con problemas de alergias, cálculos renales, pérdidas de pelo, etc. sin que oficialmente se encuentre registrada ninguna fórmula medicada

  17. Rational use of energy and cogeneration in Argentina; Uso racional de la energia y la cogeneracion en Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Sosa, M.I. [Universidad Nacional de La Plata (GECCU/UNLP), Buenos Aires (Argentina). Fac. de Ingenieria. Sistemas de Generacion de Energia, Cogeneracion, Ciclos Combinados, Uso Racional de la Energia], E-mail: misosa@ing.unlp.edu.ar

    2009-07-01

    In this paper we discuss the energy situation in Argentina and indicates possibilities for the implementation of cogeneration projects in the industrial sector, which would include energy generated by a centralized system, without additional consumption of primary resources. We discuss the physical potential of cogeneration and regulatory barriers that do not assist in its implementation. Mentioned government measures on rational and efficient use of energy.

  18. Para-product operators and para-linearization on locally compact Vilenkin groups

    Institute of Scientific and Technical Information of China (English)

    苏维宜

    1995-01-01

    The concept of para-product operators over locally compact Vilenkin groups is established and the applications to the para-linearization in nonlinear problems are studied. This kind of operators plays a special role in dealing with those functions which do not have the classical derivatives.

  19. LITERATURA PARA JOVENS LEITORES: UMA PROPOSTA

    Directory of Open Access Journals (Sweden)

    Gizelle Kaminski Corso

    2011-08-01

    Full Text Available Percebendo que o público-alvo das adaptações de textos clássicos não é tão somente a criança e o adolescente – leitores jovens, aos quais supostamente destinam-se as literaturas “infantil” e “infantojuvenil”, proponho neste texto uma nova classificação para as adaptações literárias, vendo-as não mais apenas como “adaptações para a literatura infantojuvenil”, mas como “literatura para jovens leitores”. Como tais textos são também lidos por adultos, por propósitos diversos, reconheço que o conceito proposto abrange um número maior de leitores. Para tanto, faço um breve percurso histórico-crítico acerca do aparecimento das adaptações no cenário literário brasileiro com a finalidade de corroborar e justificar a pertinência da classificação sugerida para as adaptações.

  20. Instrumento para o gerenciamento de riscos ambientais

    Directory of Open Access Journals (Sweden)

    Thaiza Clemente Couto Bissacot

    2016-01-01

    Full Text Available RESUMO: Embora existam normas e metodologias padronizadas para a análise de riscos ambientais dentro de uma organização, os mecanismos e/ou instrumentos disponíveis estão sujeitos à subjetividade, não são automatizados, não estabelecem critérios técnicos e, de maneira geral, não apresentam mecanismos de priorização para a tomada de decisão. Com base nas lacunas observadas, a presente nota técnica apresenta as premissas de um Instrumento de Gestão para a Identificação e o Gerenciamento de Riscos Ambientais (IGIGRA. O dashboard consolidado pelo IGIGRA permitirá a visualização consolidada dos riscos ambientais do empreendimento, proporcionando comparações entre diferentes operações e períodos de avaliação, fornecendo base técnica para a priorização de ações e alocação de recursos para o controle dos riscos dentro da organização.

  1. La importancia de FOCALAE para Colombia

    Directory of Open Access Journals (Sweden)

    Pío García

    2011-11-01

    Full Text Available Las asociaciones regionales están condicionadas por la dinámica del poder global; no obstante, desempeñan un papel decisivo para afrontar el reto de establecer un orden mundial convenido y equitativo. El mecanismo idóneo de la relación transpacífica latinoamericana es FOCALAE, un foro de cooperación múltiple extendida al ámbito económico, social, cultural, educativo y deportivo. Los resultados de su primera década de existencia fueron magros, en razón, entre otros motivos, de la ausencia de proyectos atractivos para los países asiáticos y para América Latina, y de la fractura ideológica profunda que ha soportado esta última. Con el potencial inocultable para contribuir al bienestar de Asia Pacífico y de Latinoamérica por medio del intercambio extenso, el Foro tendrá que esperar tiempos más favorables para su despliegue, cuando ciertos liderazgos regionales, en los que el colombiano ha de estar presente, vuelvan a impulsar la concertación latinoamericana.

  2. Modelo para el análisis de una aptitud cognitiva para el aprendizaje

    Directory of Open Access Journals (Sweden)

    Clara Cecilia Uribe Hernández

    2009-01-01

    Full Text Available La investigación en el campo de las aptitudes cognitivas para el aprendizaje requiere una forma de abordarlas y definir sus características y componentes. A su vez, esta definición debe conducir al investigador a la creación de pruebas de medición que ayuden al análisis de este tipo de aptitudes y su relación con otras variables del aprendizaje. Para dar respuesta a esas necesidades, el objetivo de este artículo es proponer la creación de un modelo para el análisis de una aptitud cognitiva para el aprendizaje, cuya estructura conste de cuatro elementos principales. Dos de ellos relacionados con los enfoques y consideraciones para emprender su estudio; los otros dos, con la definición de la aptitud, a través de sus características y sus componentes.

  3. Los videojuegos: conectar alumnos para aprender

    Directory of Open Access Journals (Sweden)

    José Antonio Valderrama Ramos

    2012-01-01

    Full Text Available Este artículo explora la utilidad que presentan los videojuegos comerciales actuales para educar a los jugadores y ayudarlos a adquirir habilidades necesarias para desempeñarse mejor en nuestra sociedad. Aborda el problema de la educación formal, la cual no está respondiendo a la situación de complejidad de nuestro entorno y usa el paradigma del pensamiento complejo y siete saberes para la educación propuestas por Edgar Morin. También, describe algunas ideas que le pueden ser de utilidad a docentes interesados en usar videojuegos como herramientas pedagógicas en el salón de clases.

  4. Rutina AUTOLISP para el despiece de columnas

    Directory of Open Access Journals (Sweden)

    Lorena Cocunubo Carreño

    2014-06-01

    Full Text Available El proyecto de creación de una herramienta Autolisp para el dibujo automático de los despieces de vigas sometidas a flexión y a cortante se desarrolla en un ambiente de programación informática LISP. Se inicia con la programación en el Visual Lisp de AutoCAD del algoritmo que permite tomar información de anchos de luz, sección transversal y momentos resistentes la viga para que automáticamente ejecute los comandos y el resultado final sea un despiece detallado de los hierros por flexión junto con los estribos por cortante separados adecuadamente. Los resultados están sujetos a criterios de diseños de la NSR-10 para así garantizar la seguridad del diseño sísmico.

  5. Estrategias de mercado para el frijol centroamericano

    Directory of Open Access Journals (Sweden)

    Lourdes Mart\\u00EDnez

    2004-01-01

    Full Text Available Estrategias de mercado para el frijol centroamericano. En los últimos años, el sub-sector de frijol en Centro América ha sido testigo de varios cambios dinámicos. Si no se encuentran medidas para incrementar la competitividad regional de este sub-sector, los países centroamericanos experimentarán impactos negativos en las áreas sociales y económicas de considerable magnitud, especialmente ahora que Centro América necesita ajustar su economía a los nuevos requerimientos de mercados mas abiertos, como el Tratado Centroamericano de Libre Comercio con USA (TLC. Vendedores de frijoles a nivel intermediario y de consumo final, así como técnicos de oficinas gubernamentales dedicadas al mercadeo de frijoles en Centro América fueron entrevistados para documentar los cambios experimentados, identificar los obstáculos que frenan la viabilidad del sub-sector e identificar las oportunidades de incremento de mercados en el futuro para los productores y vendedores de frijol. Los resultados muestran que para que continúen siendo competitivos, los países centroamericanos deben incrementar la productividad a través del apoyo a las investigaciones para el mejoramiento de variedades de frijol, especialmente aquellas que los consumidores prefieren por características específicas (e.g. color. También es imprescindible el fortalecimiento de los programas de distribución de variedades mejoradas a los productores; las mejoras en la transmisión de información de mercado a los productores; el fortalecimiento de los contactos entre productores, comercializadores a nivel mayorista y supermercados; y una política más específica de apertura de mercados de exportación, especialmente con los Estados Unidos.

  6. Oxitocina: nuevas perspectivas para una droga antigua

    Directory of Open Access Journals (Sweden)

    Steven L. CLARK

    2010-12-01

    Full Text Available La oxitocina es el medicamento más comúnmente asociada con la prevención de complicaciones perinatales y recientemente fue incluida por el Instituto para la Administración Medicamentosa Segura (Institute for Safe Medication Practices - ISMP en una pequeña lista de medicamentos “con alto grado de riesgos”, lo que puede “necesitar salvaguardas especiales para reducir el riesgo de error”. Las recomendaciones actuales para administrar este medicamento son vagas en relación a la indicación, tiempo de uso, dosis y el monitoreo de los efectos maternos y fetales. Una revisión de los datos clínicos y farmacológicos disponibles sugiere que las orientaciones específicas y basadas en evidencias para administrar oxitocina durante el parto puede derivarse de datos disponibles. Si implementadas, estas prácticas pueden reducir la probabilidad de daños al paciente. Esto sugiere el foco de las orientaciones para la administración electiva limitada de oxitocina, considerar estrategias que disminuyan la necesidad de usar oxitocina, confiar en terapéuticas de bajas dosis de oxitocina, la adhesión a definiciones semicuantitativas específicas sobre parto adecuado e inadecuado, y la aceptación de que, una vez que la actividad uterina adecuada sea alcanzada, es generalmente preferible esperar más tiempo que aumentar la infusión de oxitocina. El uso de protocolos conservadores y específicos para monitorear los efectos de la oxitocina en la madre y en el bebé tiende no sólo a aumentar los resultados, mas también a reducir los conflictos entre miembros del equipo obstétrico. Implementar estas orientaciones parece ser apropiada en una cultura cada vez más focalizada en la seguridad del paciente.

  7. Controlador DNP3 para la CIAA

    OpenAIRE

    Tobar, Sebastián; Noguera, Joel; Taffernaberry, Juan Carlos; Mercado, Gustavo

    2016-01-01

    La CIAA [1] (Computadora Industrial Abierta Argentina) tiene las características necesarias para utilizarse como RTU (Remote Terminal Unit - Unidad Terminal Remota) en sistemas SCADA [2] (Supervisory Control And Data Acquisition – Supervisión Control y Adquisición de Datos). Sin embargo, una gran limitación para esta aplicación radica en que actualmente soporta un único protocolo de comunicación: Modbus. Si bien este protocolo es, probablemente, el más utilizado históricamente en la industria...

  8. Un modelo SETAR para el PIB colombiano

    OpenAIRE

    Vivas Lorena; Ramos Johanna; Hoyos Milena

    2010-01-01

    En este artículo se estudia el comportamiento de la tasa de crecimiento del PIB colombiano durante el período 1982-2008 a partir de un modelo SETAR (Self-Exciting Threshold Autoregressive), con base en la metodología propuesta por Tsay (1989) y Tong (1990) para la detección de no linealidades relacionadas con la existencia de regímenes cambiantes. Adicionalmente, se evalúa el desempeño de los pronósticos generados en relación a los obtenidos con un modelo autorregresivos lineal para diferente...

  9. Espacio urbano para el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Guillermo Malca Obregoso

    2004-01-01

    Full Text Available Este artículo ilustra una Metodología de Análisis-Propuesta Urbana Sostenible para la enseñanza-aprendizaje del diseño urbano-arquitectónico conciente de su entorno socio-cultural-ambiental. Se presenta como alternativa a los métodos convencionales de intervención urbana. Pretende, a partir de la visión dialéctica, entender los problemas originados por el crecimiento de las ciudades de modo INTEGRAL, sin segmentarlos para su estudio parcializado y parcelado.

  10. "mbigoo!", la red social para foodies.

    OpenAIRE

    García Pumar, Javier

    2016-01-01

    Este trabajo fin de grado consiste en la elaboración de la web de una red social para aficionados a la gastronomía, englobando todo el ciclo de procesos de creación y siguiendo los principios del diseño centrado en el usuario (DCU), para obtener un primer prototipo con unas funcionalidades mínimas, que sea flexible y ampliable en el futuro, y que represente una opción de negocio. A partir de analizar las tendencias actuales, surge la gastronomía como un campo en plena ebullición, ...

  11. Coherencia curricular y oportunidades para aprender Ciencias

    OpenAIRE

    Marcela Ruiz Zúñiga; Alejandra Meneses Arévalo; Maximiliano Montenegro Maggio

    2014-01-01

    Se determinó la coherencia curricular entre oportunidades de aprendizaje y habilidades científicas ofrecidas por un texto escolar chileno y por las actividades de aula en 5º grado asociadas al contenido "Fuerza". Se realizó un análisis discursivo de la unidad didáctica del texto y de las actividades con el fin de construir matrices de contenido para tópicos y habilidades; la medición de coherencia curricular se realizó a través del índice de Porter para la coherencia. Los resultados muestran ...

  12. Valores de referência para carboxiemoglobina

    Directory of Open Access Journals (Sweden)

    Siqueira Maria Elisa P. B. de

    1997-01-01

    Full Text Available INTRODUÇÃO: Os valores de referência de indicadores biológicos são utilizados como parâmetros para interpretação de resultados de valores obtidos em indivíduos expostos ocupacionalmente aos agentes químicos. O Grupo Brasileiro para Estabelecimento dos Valores de Referência tem se dedicado a estas determinações objetivando estabelecer valores de referência para os diferentes bioindicadores em diversas regiões do País. Determinaram-se os valores de referência para a carboxiemoglobina (COHb no Sul de Minas Gerais. MATERIAL E MÉTODO: A COHb foi analisada pelo método espectrofométrico, otimizado no laboratório de análises toxicológicas. Em todas as amostras também foram realizadas análises de alguns parâmetros bioquímicos e hematológicos para atestar o estado de saúde da população, constituída de 200 voluntários não-fumantes e não-expostos, por motivo profissional, ao monóxido de carbono. Cada indivíduo respondeu um questionário para levantamento de dados relevantes à interpretação dos resultados. Os valores de referência foram expressos em termos da média ± desvio-padrão, intervalo de confiança 95% e valor de referência superior. A distribuição estatística dos resultados obtidos foi realizada para possibilitar sua comparação com grupos de trabalhadores, preferentemente à avaliação individual. RESULTADOS E CONCLUSÕES: O valor médio ± desvio-padrão para a carboxiemoglobina foi de 1,0 % ± 0,75; o intervalo de confiança 95%, entre 0,9 e 1,1 % e o valor de referência superior, de 2,5%. Através do teste t de Student (p < 0,05 não foi detectada diferença nos valores de acordo com o sexo, idade ou uso de bebidas alcoólicas. Os valores de referência encontrados foram similares aos reportados em outros países.

  13. Valores de referência para carboxiemoglobina

    Directory of Open Access Journals (Sweden)

    Maria Elisa P. B. de Siqueira

    1997-12-01

    Full Text Available INTRODUÇÃO: Os valores de referência de indicadores biológicos são utilizados como parâmetros para interpretação de resultados de valores obtidos em indivíduos expostos ocupacionalmente aos agentes químicos. O Grupo Brasileiro para Estabelecimento dos Valores de Referência tem se dedicado a estas determinações objetivando estabelecer valores de referência para os diferentes bioindicadores em diversas regiões do País. Determinaram-se os valores de referência para a carboxiemoglobina (COHb no Sul de Minas Gerais. MATERIAL E MÉTODO: A COHb foi analisada pelo método espectrofométrico, otimizado no laboratório de análises toxicológicas. Em todas as amostras também foram realizadas análises de alguns parâmetros bioquímicos e hematológicos para atestar o estado de saúde da população, constituída de 200 voluntários não-fumantes e não-expostos, por motivo profissional, ao monóxido de carbono. Cada indivíduo respondeu um questionário para levantamento de dados relevantes à interpretação dos resultados. Os valores de referência foram expressos em termos da média ± desvio-padrão, intervalo de confiança 95% e valor de referência superior. A distribuição estatística dos resultados obtidos foi realizada para possibilitar sua comparação com grupos de trabalhadores, preferentemente à avaliação individual. RESULTADOS E CONCLUSÕES: O valor médio ± desvio-padrão para a carboxiemoglobina foi de 1,0 % ± 0,75; o intervalo de confiança 95%, entre 0,9 e 1,1 % e o valor de referência superior, de 2,5%. Através do teste t de Student (p < 0,05 não foi detectada diferença nos valores de acordo com o sexo, idade ou uso de bebidas alcoólicas. Os valores de referência encontrados foram similares aos reportados em outros países.

  14. Aprender ciencias en y para la comunidad

    OpenAIRE

    Roth, Wolff-Michael

    2002-01-01

    Durante algún tiempo, he afirmado que la educación científica necesita ser desinstitucionalizada para superar la profunda crisis que atraviesa actualmente. En este artículo describo formas en las cuales se puede pensar y poner en práctica esta desinstitucionalización en la enseñanza de las ciencias y en la práctica del diseño del currículo de ciencias. Se propone la teoría de la actividad como marco para conceptualizar diferentes sistemas de actividad y sus contradicciones. Proporciono ejempl...

  15. Espacio urbano para el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Guillermo Malca Obregoso

    2015-04-01

    Full Text Available Este artículo ilustra una Metodología de Análisis-Propuesta Urbana Sostenible para la enseñanza-aprendizaje del diseño urbano-arquitectónico conciente de su entorno socio-cultural-ambiental. Se presenta como alternativa a los métodos convencionales de intervención urbana. Pretende, a partir de la visión dialéctica, entender los problemas originados por el crecimiento de las ciudades de modo INTEGRAL, sin segmentarlos para su estudio parcializado y parcelado.

  16. T I C : Trayectos Interactivos para Compartir

    OpenAIRE

    Rodríguez Carracedo, María del Carmen

    2012-01-01

    Las tecnologías y sus acelerados desarrollos han tenido un considerable impacto social. La condición de nativos digitales –cada vez más presente- de nuestros alumnos, hace que espontáneamente convivan con esas herramientas y este mundo revolucionariamente cambiante. Sin embargo, no los convierte en innatos poseedores de habilidades para resolver conflictos cotidianos ni para el aprovechamiento apropiado de aquellas. Los sistemas educativos evolucionaron a un ritmo mucho más lento, pero ...

  17. Acessibilidade de museus europeus para deficientes visuais

    OpenAIRE

    Mesquita, Susana Maria Vasconcelos

    2011-01-01

    As pessoas portadoras de deficiência (física, auditiva, mental ou visual) têm as mesmas necessidades e desejos de participar e praticar turismo que o público dito normal. No entanto, esta tarefa, representa para este grupo um desafio acrescido, já que a nossa sociedade está pensada para a maioria das pessoas, que não são portadoras destas deficiências. Num mundo com imensos estímulos visuais existe necessidade de implementar estratégias que permitam às pessoas com deficiênci...

  18. Sistemas de labranza para suelos salinos

    OpenAIRE

    Hervé, Dominique; Mita, V.; Paz, B.

    2001-01-01

    Mejorar los sistemas de labranza para cultivar suelos salinos es un reto para el sur del Altiplano boliviano. Se comparo durante dos anos (1994-95 y 1995-96) el surcado en faja con discos, practicado por los campesinos de la provincia Villarroel, y el subsolado a 50 cm de profundidad solo o combinado con el surcado. Se buscaba asi romper la costra en suelos muy arcillosos y llevar las sales a mayor profundiad que los horizontes colonizados por las raices de los cultivos de quinua (raiz pivota...

  19. Neurocisticercosis: Afiches para Capacitación

    OpenAIRE

    MARCELO ROJAS C

    2007-01-01

    En el sistema universitario (me atrevo a decir, de todo el mundo), es poco el contenido educativo relativo a la Transferencia tecnológica para efectos de la capacitación de la sociedad sobre problemas de salud (claros ejemplos desafiantes para los veterinarios son la hidatidosis y cisticercosis) y otros; manejados en términos de cambios de conducta. Los términos de control y prevención están dados en un lenguaje académico, muy abstracto y obviamente intrascedente en la comunidad. Al punto que...

  20. Herramientas de software para OAI-PMH

    OpenAIRE

    Bueno-de-la-Fuente, Gema; Rodríguez-Mateos, David

    2007-01-01

    Tanto para poner en marcha proveedores de datos como proveedores de servicios o agregadores, es importante conocer cuáles son las alternativas de software entre las que elegir. Aunque en los capítulos anteriores se dan algunas indicaciones, se ha considerado oportuno dedicar el capítulo 8, “Herramientas de software para OAI-PMH”, a elaborar una descripción de las principales aplicaciones empleadas en la actualidad. Tras una primera introducción sobre la diferencia entre software libre, softwa...

  1. Indicadores de calidad para evaluar repositorios institucionales

    OpenAIRE

    Barrionuevo Almuzara, Leticia

    2010-01-01

    Se presentan una serie de indicadores útiles para garantizar la calidad de los repositorios institucionales en abierto. Evaluar o medir el valor de un producto, servicio, actividad u objeto es necesario para saber si éste está funcionando de acuerdo a unos criterios preestablecidos o por el contrario se deben corregir errores. Se puede hablar de una clara tendencia o moda de evaluación en los sistemas bibliotecarios, quizás por el carácter tan crítico de los clientes/usuarios, quienes desean ...

  2. Taller para padres en Centro CAES

    OpenAIRE

    Beltrán Franch, Enrique

    2015-01-01

    Treball final de Grau en Mestre o Mestra d'Educació Infantil. Codi: MI1040. Curs acadèmic 2014-2015 Este trabajo versa sobre las distintas fases que se han llevado a cabo para la realización en la realización de un taller para padres, organizado en seis sesiones, tratando diferentes temas (centrados en la diada de relación padres hijos y en proceso de socialización que en ella se lleva) en cada sesión. La finalidad de este trabajo era tanto concienciar a los padres en la gran r...

  3. IR & FX Linked Note para inversionistas colombianos

    OpenAIRE

    Restrepo Montoya, Julián Esteban

    2015-01-01

    Los Productos Estructurados son instrumentos financieros que son construidos para cumplir ciertas condiciones y objetivos de rentabilidad y riesgo que tenga su operador o inversionista -- Este documento presenta la construcción de un producto estructurado de tasas de interés y tasa de cambio (IR & FX por sus siglas en inglés) para inversionistas Colombianos, que maximiza la rentabilidad y garantiza la protección del capital -- La construcción de este instrumento se realiza a través de la inve...

  4. Share!: Sistema para compartir contenidos multimedia

    OpenAIRE

    Cimas Bravo, Eduardo

    2015-01-01

    Este trabajo consiste en un sistema informático destinado a la compartición de contenidos multimedia entre grupos restringidos de usuarios. Los contenidos pueden ser imágenes, vídeos y audios. Este sistema se compone de dos aplicaciones, una aplicación web y una aplicación móvil para dispositivos Android. La esencia del sistema es proporcionar un mecanismo para compartir rápidamente contenidos multimedia entre usuarios. Los contenidos pueden estar ya en sus dispositivos móviles o ser capturad...

  5. Propuestas para combatir la contabilidad creativa

    Directory of Open Access Journals (Sweden)

    Oriol Amat Salas

    2004-01-01

    Full Text Available Los escándalos contables han reavivado el interés en combatir la contabilidad creativa. Este artículo analiza la naturaleza de esta problemática y los aspectos de la normativa que la afectan. Incluye el ejemplo de una empresa real para visualizar los efectos que los maquillajes contables, amparados en la normativa contable española y en las Normas Internacionales de Contabilidad, pueden provocar en el resultado. Al final, se proponen medidas para mejorar la credibilidad de la información financiera.

  6. Propuestas para combatir la contabilidad creativa

    OpenAIRE

    Oriol Amat Salas; Ester Oliveras

    2004-01-01

    Los escándalos contables han reavivado el interés en combatir la contabilidad creativa. Este artículo analiza la naturaleza de esta problemática y los aspectos de la normativa que la afectan. Incluye el ejemplo de una empresa real para visualizar los efectos que los maquillajes contables, amparados en la normativa contable española y en las Normas Internacionales de Contabilidad, pueden provocar en el resultado. Al final, se proponen medidas para mejorar la credibil...

  7. Especializaci??n para la empleabilidad eficiente, anotaciones para el postgrado en trabajo social

    OpenAIRE

    Alonso Alonso, Rosario; Julve Negre, Milagros

    2006-01-01

    La especializaci??n ofrecida en los Postgrados de Trabajo Social deber??a de introducir nuevos principios de organizaci??n para situar a los profesionales en una posici??n competitiva para facilitar la movilidad laboral, caracter??stica espec??fica en el sector. Al mismo tiempo, orientarse por la eficacia y el ??xito en la intervenci??n profesional. Para ello es necesario introducir el concepto de "pr??cticas de calidad" e incluir contenidos que no s??lo formen en competencias Te??rico- t??cn...

  8. Proyecto de domótica para vivienda nueva y para vivienda existente

    OpenAIRE

    Ruzo Parragués, Martín

    2007-01-01

    Este proyecto consiste en el detalle de una instalación domótica de acuerdo a unas necesidades de usuario determinadas. El trabajo se divide en dos partes principales: la primera detalla una solución para esta instalación domótica en el caso que la vivienda escogida sea de nueva construcción. La segunda, en cambio, propone una solución para el caso que la misma vivienda esté ya construida. Para ambas soluciones se proponen tecnologías diferentes y se presentan sus características princi...

  9. Consumo de bebidas para una vida saludable: recomendaciones para la población mexicana

    OpenAIRE

    Juan A Rivera; Onofre Muñoz-Hernández; Martín Rosas-Peralta; Aguilar-Salinas, Carlos A; Willett, Walter C.; Popkin, Barry M.

    2008-01-01

    El secretario de Salud convocó al Comité de Expertos para la elaboración de las Recomendaciones sobre el consumo de bebidas para la población mexicana ; la finalidad fue desarrollar lineamientos basados en evidencia científica para los consumidores, los profesionales de la salud y el sector gubernamental. Las prevalencias de sobrepeso, obesidad y diabetes han aumentado con rapidez en México y las bebidas representan la quinta parte de la energía que consumen los mexicanos. La evidencia señal...

  10. Infraestructura de comunicaciones para algoritmos colaborativos

    OpenAIRE

    Sopena Ballesteros, Manuel

    2013-01-01

    Este proyecto intenta crear un sistema cliente/servidor de comunicaciones para distintas máquinas paralelas en C++ utilizando WCF como tecnología en el servidor. Aquest projecte intenta crear un sistema client/servidor de comunicacions per a diferents màquines paral·leles en C++ utilitzant WCF com tecnologia al servidor.

  11. Educación para la paz

    Directory of Open Access Journals (Sweden)

    Federico Mayor Zaragoza

    2003-01-01

    Full Text Available La educación para la paz ha experimentado un desarrollo importante en los últimos 20 años, y el 2000 ha sido declarado Año Internacional para la Cultura de Paz. Exige un esfuerzo de pariicipación y una capacidad crítica para facilitar el paso de una cultura de guerra a un cultura de paz. Se trata de ayudar a todos los ciudadanos a observar y reflexionar sobre el conjunto de la tierra y de quienes la habitan. De escuchar a los jóvenes y ser escuchado. La educación para la paz ha de ser considerada como contenido transversal de la educación. La situación actual, los conflictos interétnicos e interculturales , la exclusión y la marginalidad, las sociedades pobres y las ricas son cuestiones que reclaman una educación par la paz. De la cultura de imposición hemos de pasar a la cultura del diálogo y parti-cipación, solidaridad, compromiso, tolerancia y respeto. Es necesario construir otro mundo en el que podamos asegurar a nuestros descendientes el futuro. La paz es un comportamiento, es traducir a la práctica los principios de con-vivencia, de solidaridad, de fraternidad. Sólo así «vendrá el amanecer (y brilla-rá mucha luz en nuestro camino»

  12. Vendaje funcional para la ''mano abierta''

    OpenAIRE

    Rochina, Iván

    2013-01-01

    Se muestra la aplicación de un vendaje funcional para el tratamiento de las molestias ocasionadas por la distensión de los ligamentos propios de los huesos del carpo; Producción: SFPIE(www.uv.es/sfpie)|VLC Campus (www.vlc-campus.com)

  13. Tratamentos alternativos para o combate à Varroa

    OpenAIRE

    Vilas-Boas, Miguel

    2006-01-01

    Mais de 20 anos após a detecção em Portugal do ácaro da Varroa Jacobsoni, a sua coexistência com a abelha Apis Mellifera continua a ser um desafio constante para o apicultor provocando continuadamente baixas no efectivo apícola.

  14. PAISAJES PARA UN DESARROLLO SUSTENTABLE Y PARTICIPATIVO

    Directory of Open Access Journals (Sweden)

    RAFAEL MATA OLMO

    2014-01-01

    Full Text Available El texto se ocupa del renovado sentido del paisaje que, a partir de diversas tradiciones disciplinares contemporáneas, ha adoptado el Convenio del Paisaje, un tratado internacional promulgado por el Consejo de Europa en el año 2000. La primera parte trata del concepto adoptado por el citado Convenio, que entiende el paisaje como el carácter de cada territorio, percibido socialmente y resultado de la interacción de hechos y procesos naturales y/o humanos. La segunda aborda las bases metodológicas de la caracterización y valoración del paisaje, destacando los planteamientos del método británico de Landscape Character Assessment y algunos resultados empíricos de esta metodología. La tercera parte trata de las políticas de paisaje, incidiendo en las potencialidades de los instrumentos de planificación territorial y urbanística para incorporar objetivos, directrices y acciones dirigidos a la salvaguarda, gestión, recualificación y acceso público al paisaje. Para terminar, el texto recoge una experiencia de proyecto territorial de paisaje, la del Plan Insular de Menorca (Islas Baleares, España, aprobado en 2003. Se sintetizan sus determinaciones sobre la protección de determinados terrenos por sus altos valores paisajísticos, sus directrices para que las políticas sectoriales (turismo, agricultura, infraestructuras, etc. incorporen criterios paisajísticos, y sus iniciativas para la gestión y mejora del paisaje y para el fomento del acceso público a su contemplación y disfrute.

  15. Contenidos orientacionales para la preparación de los adolescentes para la convivencia intergeneracional

    Directory of Open Access Journals (Sweden)

    Dania Ondina Feria-González

    2012-01-01

    multigeneracionales donde conviven adolescentes y personas ancianas y longevas. Abordó características relacionadas con estos grupos etáreos y recomendaciones para la orientación de los adolescentes y sus familias para la convivencia con personas ancianas y longevas. Se planteó la necesidad de que la orientación para la convivencia con personas ancianas y longevas se lleve a cabo mediante la contextualización de situaciones reales de las familias en el proceso de orientación familiar en la secundaria básica para influir en la educación en valores en los adolescentes como la solidaridad, el humanismo y la dignidad.

  16. Programas universitarios para mayores: ¿educación para la reinserción?

    OpenAIRE

    Sánchez Martínez, Mariano

    2003-01-01

    Los Programas Universitarios para Mayores (PUM) pueden tener como una de sus finalidades la reinserción social de sus alumnos. Esta objetivo conecta abiertamente a los PUM con la estructura social, más amplia, en la que se lleva a cabo, y propone enfatizar, más que la adaptación, el cambio, la participacion y la recapacitación, para que los mayores puedan tener un mayor autocontrol sobre sus vidas personales y sociales.

  17. PineApp : Aplicación para Android para el aprendizaje del idioma chino

    OpenAIRE

    Pino Linares, Luis

    2013-01-01

    Desarrollo de una aplicación para Android que ofrece un método fácil para aprender chino mandarín desde el español. Desenvolupament d'una aplicació per a Android que ofereix un mètode fàcil per aprendre xinès mandarí des de l'espanyol.

  18. Centro para la Salud Mundial (CGH) del NCI

    Science.gov (United States)

    El Centro para la Salud Mundial (CGH) del NCI coordina actividades de investigación y trabaja con socios nacionales e internacionales para comprender y enfrentar la carga que representa el cáncer a nivel mundial.

  19. FINANCIAMIENTO ESTATAL PARA LOS PROCESOS ELECTORALES MUNICIPALES

    Directory of Open Access Journals (Sweden)

    Alejandro Robles Leal

    2012-01-01

    Full Text Available A partir de un breve repaso de las últimas reformas jurídicas al régimen electoral, tanto del Código Municipal como del Código Electoral, el artículo describe el nuevo sistema de financiamiento estatal que se ha dispuesto para apoyar económicamente a los partidos políticos que participan en los procesos electorales municipales y que, antes de la entrada en vigencia del nuevo Código Electoral, no existía. Haciendo énfasis en las características legales de ese nuevo sistema de financiamiento, a partir de las diferencias con el sistema de financiamiento estatal para los partidos políticos que participan en los procesos electorales nacionales, refiere la jurisprudencia del TSE en la materia, destacando que la primera resolución del Tribunal, que ordenó girar recursos del Estado, fue precisamente para un partido político inscrito en el nivel cantonal. Finalmente, partiendo de la tesis de que la ausencia de financiamiento estatal para los procesos electorales municipales constituyó una barrera para la profundización democrática costarricense, por lo que su inclusión representa un avance en el fortalecimiento de los derechos políticos de la ciudadanía, los autores concluyen con algunas recomendaciones de carácter legislativo, con el fin de fortalecer este régimen de financiamiento, principalmente por la vía de su sistematización y equiparación con el financiamiento para procesos electorales nacionales, con la expectativa de robustecer las plataformas partidarias y profundizar, así, nuestra cultura democrática en el nivel local. Se anexa cuadro con la lista de los partidos políticos a los que ya se ordenó girar el financiamiento indicado, que desglosa los montos totales y porcentuales, así como los montos que no pudieron ser liquidados y que regresan al erario.

  20. Alternativas fundamentales para cuantificar el riesgo operacional

    OpenAIRE

    Ermilson Velasquez Ceballos; Luis Ceferino Franco Arbeláez

    2010-01-01

    El presente artículo es uno de los resultados de un proyecto de investigación financiado por la Universidad EAFIT en el año 2009. En el contexto del riesgo operacional, se hace un desarrollo formal de los métodos de Simulación Montecarlo, el algoritmo de recursión de Panjer y la Aproximación Analítica de Böcker y Klüppelberg, que son tres de las técnicas más utilizados para cuantificar ese riesgo en entidades financieras en el ámbito mundial. Luego se desarrolla una aplicación para un caso pr...

  1. Criterios para proyecto de sifones en colectores

    Directory of Open Access Journals (Sweden)

    Galán Soraluce, Francisco

    1987-04-01

    Full Text Available Exposition of the criteria and ways to be developed, for the construction of siphons for large and little flow that can assure the cleanness of the horizontal lengths, carried out in Pamplona zone. These results can be reached fitting a reservoir at the entrance of the sewer to make periodical cleanliness and programming the working of the pipes.

    Se describen a continuación los criterios y el modo de desarrollarlos, utilizados en la Comarca de Pamplona para construir sifones para caudales grandes y pequeños, que tengan asegurada la limpieza de los tramos horizontales. Se consigue este resultado disponiendo un depósito junto a la cámara de entrada que asegura limpiezas periódicas, y programando el funcionamiento de las tuberías.

  2. GUÍAS PARA LOS AUTORES

    Directory of Open Access Journals (Sweden)

    EDGAR SERNA MONTOYA

    2009-06-01

    Full Text Available NORMAS PARA PUBLICACIÓN DE ARTÍCULOSLa revista Lámpsakos es una publicación semestral de la facultad de Ingenierías de la Fundación Universitaria Luis Amigó. Estádestinada a difundir, dentro y fuera del país, las realizaciones científicas, ingenieriles, tecnológicas y de innovación que se producen en las universidades y centros de investigación en el país y el exterior. Los aportes que se reciban para estudio de publicación deberán estar enmarcados en la normatividad fijada por la presente norma y aceptada por el Comité Editorial

  3. Educación para el consumo

    OpenAIRE

    Castillejo, J.L.; Colom, A.J.; P. Mª Alonso Pérez-Geta; Rodríguez Neira, T.; J. Sarramona; Touriñán, J. M.; G Vázquez

    2011-01-01

    El consumo es un fenómeno de gran peso en la vida actual de los países desarrollados y también de los que están en vías de desarrollo, sinónimo de felicidad y de estatus personal. Por todo ello el consumo merece ser objeto de la educación. En la educación para el consumo resulta clave la implicación familia- escuela, puesto que los padres marcan las primeras pautas en este terreno, junto al contexto social y los medios de comunicación. La educación para el consumo implica información, capacid...

  4. Technological properties of kaolin from Para

    International Nuclear Information System (INIS)

    The NE of the State of Para, is notable for its large reserves of kaolin for paper. Kaolin is a mineral composed of hydrated aluminum silicates such as kaolinite and halloysite. The exploitation of these reserves to generate products with higher commercial value, especially in the industries of adsorbents and catalysts, is what motivates the continuous study of technological properties of the Amazon kaolin's. Thus, this paper presents a technological characterization of a sample of kaolin from Para State by X-ray diffraction, SEM - scanning electron microscopy and infrared spectroscopy. The results of preliminary tests indicate that the sample consists for the most part by kaolinite present in low concentrations of quartz and anatase. (author)

  5. “Tudo feito para se perder”

    OpenAIRE

    Figueiredo, Maria Leonor

    2015-01-01

    Apesar de a obra de António Aragão ser muito vincada por um humor satírico e bastante cáustico, o romance Um buraco na boca traz um tom mais disfórico e marcado pela perda, numa vida que vai surgindo em fragmentos de tempos e memórias nem sempre ordenadas e, definitivamente, nem sempre com espaço para um riso sobre a ausência.

  6. Thermal conductivities of ortho and para hydrogen

    International Nuclear Information System (INIS)

    The thermal conductivity of molecular hydrogen has been calculated using a Lennard-Jones potential added to a quadrupole-quadrupole interaction term. Large differences between ortho and para hydrogen were obtained particularly in the range about 200 K. Results for 'normal' hydrogen, here taken as a simple sum of results for the two components, were found to agree very well with recommended values for experiments on normal hydrogen. (Auth.)

  7. ALGUNAS CARTAS DE CONTROL BIVARIADAS PARA ATRIBUTOS

    Directory of Open Access Journals (Sweden)

    CAROLINA OSPINA HINCAPIE

    2010-01-01

    Full Text Available Muchos procesos industriales son de naturaleza multivariada dado que la calidad de un producto depende de más de una variable. El control multivariado de procesos captura la relación en las variables asociadas al proceso, si se ignora esta correlación y se utilizan gráficos de control univariados para cada variable por separado se puede concluir erróneamente acerca del estado del proceso. En variables continuas correlacionadas se han realizado muchas investigaciones, sin embargo se encuentran pocos trabajos que traten sobre atributos correlacionados. En este trabajo se comparan tres cartas de control para variables aleatorias binomiales bivariadas, correlacionadas entre sí, las cuales miden atributos. Las cartas son: La carta de Hotelling basada en la aproximación de la distribución binomial multivariada a la distribución normal multivariada. La carta MNP la cual es una extensión de las cartas univariadas, y la carta que es una metodología no paramétrica basada en el índice de profundidad de Mahalanobis. La comparación se hace vía simulación utilizando como medida de comparación, la longitud promedio de racha (ARL. Dentro del trabajo se presenta un ejemplo aplicado de las metodologías para construir cartas de control para variables binomiales bivariadas en una empresa de telecomunicaciones. De los resultados se aprecia, en términos generales, que la carta MNP es la mejor tanto en control como fuera de control.

  8. El modelo Biasca para transformar la empresa

    Directory of Open Access Journals (Sweden)

    Rodolfo Eduardo Biasca

    2004-01-01

    Full Text Available Basado en su experiencia en el campo de la consultoría en América Latina, el autor propone un modelo para evaluar la transformación de las empresas, cuyos componentes básicos son: 1 evaluación del cambio que necesita la empresa competitiva, 2 mejoramiento cuantitativo, 3 mejoramiento incremental, 4 revolución o cambio discontinuo y 5 evolución o cambio continuo.

  9. Arquitectura Organizacional para Soluciones Empresariales de Software

    Directory of Open Access Journals (Sweden)

    Solangel Rodríguez Vázquez

    2013-09-01

    Full Text Available La arquitectura organizacional para soluciones empresariales de software es un modelo organizativo que tiene como objetivo contribuir a elevar la productividad de los procesos y el empleo adecuado de los recursos humanos de una organización productiva de software. Para la elaboración de la arquitectura se tuvo en cuenta los problemas en el flujo de trabajo actual, las deficiencias referentes a la distribución de roles, la inadecuada gestión del tiempo y la escasa utilización de componentes de software. Dicha arquitectura cuenta con una estructura formada por cinco entidades o componentes organizacionales las cuales son: la entidad Inteligencia, Gerencia de proyecto, Personas, Repositorio y Proceso. En cada una de ellas se organiza el trabajo a desarrollar a partir de procesos y actividades establecidas lo que ajusta el modelo a su objetivo fundamental para obtener productos con la calidad requerida. Estos procesos están concebidos para que sigan una línea de desarrollo que permita el buen funcionamiento entre las entidades. Es muy importante en este ámbito la comunicación, interacción e integración entre los componentes organizacionales ya que el trabajo de cada uno depende de los demás. Dicha arquitectura de factoría permite ser adaptado a cualquier organización o empresa teniendo en cuenta sus particularidades además de responsabilizar e identificar a los recursos humanos con su trabajo.

  10. La escuela para el siglo XXI

    Directory of Open Access Journals (Sweden)

    Juan Delval

    2013-01-01

    Full Text Available Centro Europeo de Derecho La escuela para el siglo XXI Currículo: doctor en Filosofía. Catedrático de Psicología Evolutiva y Educación en la Univer- sidad Autónoma de Madrid. Sus líneas de investigación versan sobre el desarrollo del pen- samiento infantil, especialmente en lo relativo a la lógica, a la formación del pensamiento científico y a la construcción de nociones sociales, así como a su aplicación a la formación de conocimientos en la escuela. Trabaja también sobre la historia de la psicoLa escuela debería ser un lugar privilegiado para proporcionar una formación que permita participar plenamente en la vida ciudadana y democrática, pero pode- mos percibir hoy que existe una contradicción entre el tipo de educación que se proporciona en las escuelas, y el modelo de sociedad al que formalmente se aspira. Lo que tendríamos que conseguir es constituir escuelas que sean demo- cráticas y que preparen a los individuos para actuar como auténticos ciudadanos, y no como súbditos. ¿Cómo se hace?, ¿cómo podemos llegar hacia una escuela que cumpla esas funciones?, ¿qué tendríamos que hacer en las escuelas para poder encaminarnos hacia la formación de individuos que tengan este tipo de características? Si optamos por fomentar la existencia de individuos felices y au- tónomos hay que comenzar por emprender una serie de reformas.

  11. Recogimientos para mujeres en Lima hasta 1650

    Directory of Open Access Journals (Sweden)

    Martínez Alcalde, Lidia

    2001-12-01

    Full Text Available Analysis of the different institutions that were established in Peru during the Modem Age for attendance of women, with references to the qualities and evolution of each one of them.

    Análisis de las diferentes instituciones que se crean en el Perú en la Edad Moderna para la asistencia de mujeres, especificando las características y evolución de cada una de ellas.

  12. Diagnóstico molecular para Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Ysabel Montoya

    1997-01-01

    Full Text Available El potencial diagnóstico de epitopes inmunodominantes seleccionados fue ensayado satisfactoriamente a fin de obtener una prueba serodiagnóstica alternativa para la Leishmaniasis Tegumentaria Americana. Dos proteínas recombinantes prometedoras de L. (v. peruviana referidas como T-26-U2/T26-U4 fueron reconocidas por sueros individuales de pacientes con Leishmaniasis Tegumentaria Americana usando Western Blot. La sensibilidad de la prueba fue de 86% con sueros permanentes con Leishmaniasis peruana.

  13. HACER PARA PENSAR: IDEAS, ESPACIOS Y HERRAMIENTAS

    Directory of Open Access Journals (Sweden)

    Claudia Urrea Giraldo

    2012-01-01

    Full Text Available Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico, como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y herramientas se pusieron a disposición de los y las participantes para la construcción de historias digitales, modelos y simulaciones. El objetivo final fue que los y las profesoras pudieran vivenciar, a través de una experiencia práctica, el ambiente de aprendizaje construccionista, las ideas y las herramientas, para que más adelante las pudieran extrapolar en sus propias disciplinas y cursos.

  14. Los consorcios exportadores: Estrategia para vender extralocalmente

    Directory of Open Access Journals (Sweden)

    Margot Cajigas Romero

    2006-01-01

    Full Text Available Bajo el título Los consorcios exportadores: Estrategia para vender extralocalmente,se expone cómo a través de una investigación exploratoria, realizada mediante la interacción de empresarios en una mesa de trabajo, cumplida con reuniones periódicas por más de un año, se consigue diseñar un sistema de unión entre empresas locales, para que vendan sus productos en mercados seleccionados de Colombia y algunas otrasnaciones. El comercio internacional no es unjuego de suma cero, es dable encontrar mercados externos dónde venderlos productos de economías en desarrollo, el primer mercado donde se debe competir es el propio mercado nacional y los empresarios aceptan organizarse para buscar vender en mercados seleccionados de Colombia y el mundo mediante la estrategia Coexco(Comercializadoras Extralocales de Colombia es el mensaje último del artículo.

  15. Cuestionarios Interactivos para Autoevaluación

    Directory of Open Access Journals (Sweden)

    Sánchez García, Juan Francisco

    2007-01-01

    Full Text Available La autoevaluación es un instrumento valioso para que el propio alumno pueda medir el grado de conocimientos adquiridos de la materia en cuestión, al tiempo sirve para adiestrarlo en el tipo de prueba que se utilizará posteriormente en el examen. Por otro lado, dado que en la adaptación al Espacio Europeo de Educación Superior (E3S tiene particular importancia la labor realizada por el propio alumno, los pruebas de autoevalución adquieren, si cabe, una mayor relevancia. Por todo ello, hemos elaborado unos test interactivos con hoja de calculo, para cubrir el doble propósito de evaluar los conocimientos alcanzados por nuestros alumnos, relativos tanto a la materia, como al manejo en sí de la propia herramienta informática de la hoja de cálculo. Se muestran ejemplos concretos relacionados con las matemáticas y la hoja de cálculo Excel.

  16. Cirurgia para controle de danos: estado atual

    Directory of Open Access Journals (Sweden)

    Rodrigo Camargo Leão Edelmuth

    2013-04-01

    Full Text Available A cirurgia de controle de danos é um conceito amplamente aceito atualmente entre os especialistas em trauma abdominal quando se trata de doentes gravemente traumatizados. Nestes pacientes a morte decorre, na maioria das vezes, da instalação da tríade letal (hipotermia, coagulopatia e acidose e não da incapacidade de reparar as graves lesões presentes. Nesta revisão, os autores abordam a tríade letal, em suas três fases, e enfatizam as medidas adotadas para preveni-las. Além de discutirem a indicação e o emprego da cirurgia para o controle de danos em seus vários estágios. A restauração dos padrões fisiológicos do doente na UTI, para que o mesmo possa ser submetido à operação definitiva e ao fechamento da cavidade abdominal, outro desafio no paciente traumatizado grave, também é discutida.

  17. EXPERIENCIA INTEGRADORA PARA EDUCACIÓN AMBIENTAL

    Directory of Open Access Journals (Sweden)

    Jorge F. Coronel

    2015-01-01

    Full Text Available En este trabajo se relacionó la práctica experimental de laboratorio co n el análisis de problemas ambientales. El objetivo de este trabajo es analizar una propuesta que vinculó el trabajo experimental con la situación del ambiente local para promover el cuidado de la naturaleza y su uso con sostenibilidad . Esta estrategia brindó un enfoque integrador aportando a los alumnos de profesorado una alternativa de aprendizaje con exper iencias sencillas para el estudio cualitativo de l ambiente local y motivar a l análisis de problemas asociad o s. Las experiencias permitieron caracterizar las muestras de suelo, agua y aire del lugar de residencia de los alumnos. La información experimental obtenida potenció la discusión de la situación ambiental actual. E l enfoque de enseñanza basado en problemas socio - científicos posibilit ó la visión interdisciplinar del tema , redimensionando valores y acciones para el cuidado ambiental y el desarrollo sustentable.

  18. A leitura: um passaporte para a vida

    Directory of Open Access Journals (Sweden)

    Armindo Teixeira Mesquita

    2011-06-01

    Full Text Available Nas sociedades actuais, a capacidade para usar material escrito é indispensável ao acesso a todo tipo de informação, tornando o uso da leitura cada vez mais necessário à participação real do cidadão em actividades produtivas e colectivas, porque ajuda a formar seres pensantes. O contacto com os livros deve ser iniciado o mais cedo possível, não só pelo manuseio, como também pela história contada ou pelos jogos rítmicos. Com efeito, na idade da infância, toda a energia do indivíduo é dirigida para a construção da sua identidade. Logo, as primeiras leituras entram no período da formação e da fundação, isto é, consignamos à leitura uma grande força de desenvolvimento pessoal. Os livros, para além de auxiliares na aprendizagem do mundo, formam o leitor no gosto. Formar o gosto e possibilitar escolhas são realidades fundamentais na vida adulta.

  19. Coherencia curricular y oportunidades para aprender Ciencias

    Directory of Open Access Journals (Sweden)

    Marcela Ruiz Zúñiga

    2014-12-01

    Full Text Available Se determinó la coherencia curricular entre oportunidades de aprendizaje y habilidades científicas ofrecidas por un texto escolar chileno y por las actividades de aula en 5º grado asociadas al contenido "Fuerza". Se realizó un análisis discursivo de la unidad didáctica del texto y de las actividades con el fin de construir matrices de contenido para tópicos y habilidades; la medición de coherencia curricular se realizó a través del índice de Porter para la coherencia. Los resultados muestran que el texto escolar promueve más observación (24.2% y menos ordenamiento de la información (0.95%. En las clases, predominó repetición de contenidos de manera oral y escrita (66.8% y menos análisis de hipótesis (1.6%. El índice de Porter entre el texto y el aula fue 0.360, entre el texto y el marco curricular fue 0.267. Se concluye que el texto y las clases ofrecen leves oportunidades para el desarrollo de las habilidades científicas.

  20. Objeto de aprendizaje para la formación docente orientado a desarrollar competencias para usar recursos educativos abiertos

    OpenAIRE

    Lugo López, Ahabael; Lozano Martínez, Fernando Gustavo; Ramírez Montoya, María Soledad

    2014-01-01

    1. Introducción; 2. Referente teórico; 2.1 Competencias docentes; 2.2 Definición y características de los Recursos Educativos Abiertos; 2.3 Competencias para usar recursos educativos abiertos para la práctica educativa; 2.4 Objetos de aprendizaje abiertos; 3. Marco metodológico; 3.1 Descripción del objeto de aprendizaje para desarrollar competencias para usar recursos educativos abiertos para la práctica educativa; 3.2 Competencias didácticas del objeto; 3.3 Componentes tecnológicos del objet...

  1. Procedimiento para el cierre de canteras de materiales para construcción en Cuba

    Directory of Open Access Journals (Sweden)

    Julio Montero-Matos

    2016-03-01

    Full Text Available Con el propósito de facilitar a los concesionarios de canteras de materiales para la construcción una herramienta metodológica para efectuar el cierre de estas y garantizar una minería sostenible se propuso un procedimiento en seis etapas a partir del diagnóstico realizado en 22 canteras, ubicadas en tres regiones mineras cubanas. El procedimiento busca disminuir los impactos ambientales provocados por la explotación de las canteras y ofrecer a la industria un estándar para lograr uniformidad en la planificación y ejecución del cierre con un costo mínimo.

  2. Metodología para el desarrollo de Hidrolizados Proteicos para Medios de Cultivo en Cuba.

    Directory of Open Access Journals (Sweden)

    Raisa Zhurbenko

    2005-01-01

    La metodología incluyó elementos científico-técnicos, de Buenas Prácticas de Laboratorio y de Manufactura y las normas ISO 9000 del 2000, entre otros. Se desarrollaron 12 bases nutritivas por nuevos métodos, que cumplen con los requisitos de calidad exigidos para estos productos. La composición físico-química, de minerales y aminoácidos, así como su reactividad biológica posibilitaron su empleo en más de 20 medios de cultivo diferentes para el control de calidad sanitaria de los alimentos. Más de 15 toneladas se han obtenido para el mantenimiento del Sistema de Vigilancia Epidemiológica del país.

  3. La estrategia educativa 2020 o las limitaciones del Banco Mundial para promover el "aprendizaje para todos"

    Directory of Open Access Journals (Sweden)

    Antoni Verger

    2011-12-01

    Full Text Available LA NUEVA Estrategia Educativa 2020 del Banco Mundial establece las prioridades de reforma educativa en países en vías de desarrollo para la década siguiente. El título explícito de la estrategia, Aprendizaje para Todos, es un claro reconocimiento de que, más allá de políticas centradas en el acceso, se debe hacer algo más para asegurar que la educación derive en experiencias positivas de aprendizaje. Sin embargo, como este artículo sostiene, las opciones de políticas explícitas y latentes en la Estrategia 2020 no son las más adecuadas para lograr el Aprendizaje para Todos. El artículo desarrolla tres tipos de argumentos al respecto. El primero se refiere al fuerte apego del Banco a un conocimiento disciplinario y un enfoque metodológico que es insuficiente para entender lo que aprenden los niños en la escuela y por qué. El segundo argumento se refiere al sesgo pro-mercado de la Estrategia por lo que respecta a la reforma del sector público y a nuevas formas de oferta educativa. En tercer lugar, el artículo señala las principales ausencias de la Estrategia, con especial atención a las omisiones relacionadas con la compleja relación entre educación y pobreza.

  4. Esquema para el soporte de clases audiovisuales para la herramienta PEDCO

    OpenAIRE

    Zanellato, Claudio; Grosclaude, Eduardo; Balladini, Javier; Sanchez, Laura

    2009-01-01

    En el marco del proyecto de investigación “Software para Aprendizaje y Trabajo Colaborativos” del Departamento de Ciencias de la Computación, se está trabajando desde el año 2002 en implantación de plataformas educativas que sirvan como soporte de contenido y comunicación tanto para la modalidad de enseñanza presencial como a distancia. Luego de definir los requerimientos, se implementó la Plataforma de Educación a Distancia del Comahue - PEDCO. Desde entonces, está funcionando y cada vez ...

  5. Un criterio para seleccionar operadores genéticos para resolver CSP

    OpenAIRE

    Riff Rojas, María Cristina

    1998-01-01

    Nuestro interés es definir algoritmos evolucionistas para la resolución de problemas de satisfacción de restricciones (CSP), los cuales tomen en cuenta tanto las ventajas de los métodos tradicionales de resolución de CSP, así como las características propias de este tipo de problemas. En este contexto, se propone en el presente artículo un criterio para poder evaluar la performance de los operadores gen'eticos dentro de algoritmos evolucionistas que resuelven CSP.

  6. Hacer para pensar: ideas, espacios y herramientas

    Directory of Open Access Journals (Sweden)

    Miranda Garnier, Ximena

    2012-02-01

    Full Text Available Resumen: Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico,como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y herramientas se pusieron a disposición de los y las participantes para la construcción de historias digitales, modelos y simulaciones. El objetivo final fue que los y las profesoras pudieran vivenciar, a través de una experiencia práctica, el ambiente de aprendizaje construccionista, las ideas y las herramientas, para que más adelante las pudieran extrapolar en sus propias disciplinas y cursos.Abstract: With this essay we intend to share a learning experience designed for and developed with an interdisciplinary group of faculty at the University of Costa Rica. Scratch programming language and Pico Boards supported this opportunity to experience a constructionist environment, where powerful ideas, spaces and tools were available for participants to design and construct their own digital stories, models and simulations. The final goal was that participants would experience, through a practical experience, the constructionist learning environment and the tools available, so that they could, in the future, extrapolate the knowledge they constructed in their own disciplines and classes.

  7. Metodologia analitica para la determinacion de oxiesteroles

    OpenAIRE

    Guardiola Ibarz, Francesc; Codony Salcedo, Rafael; Rafecas Martínez, Magdalena; Boatella Riera, Josep

    1994-01-01

    El presente trabajo recoge los principales aspectos relacionados con el análisis de los derivados oxidados del colesterol. Este problema analítico es relativamente reciente y muchas cuestiones relacionadas con el mismo son controvertidas. Prueba de ello es la existencia de un número elevado de metodologías, que exigen aún, en muchos casos, una mejora y validación. Por ello, se ha creído interesante una discusión de los principales sistemas propuestos para su determinación (cromatografía de ga...

  8. CXML: intérprete para XML

    OpenAIRE

    Concha Medina, Edgard José; Corro, Gonzalo Gabriel; Leiva, Mario

    2014-01-01

    El lenguaje XML, de creación relativamente reciente, está siendo muy utilizado en aplicaciones web y en las comunicaciones entre servidores web, y adquiriere importancia en el área de las bases de datos, no sólo como soporte para la transferencia de datos sino como formato de almacenamiento. Ya que el lenguaje XML es un estándar internacional y dado su importancia, en el año académico 2013 se solicitó a los alumnos de la asignatura Lenguajes de Programación y Compiladores de la Licenciatur...

  9. PARA EVITAR LA CONTAMINACIÓN AMBIENTAL

    Directory of Open Access Journals (Sweden)

    F Pachón

    2005-01-01

    Full Text Available El presente artículo se enmarca dentro de la caracterización del sistema de producción bovina del municipio de Utica (Cundinamarca y dentro de los problemas más importantes que lo afectan. Como resultado, el estudio identificó la escasez de alimento de buena calidad en épocas secas como la principal limitante del productor bovino del municipio. Aprovechando una ventaja presente en la zona, como es la elaboración de panela (proceso a través del cual resultan algunos subproductos, como bagazo y melote, que pueden ser utilizados como alternativa alimenticia para los bovinos en cualquier época del año, se planteó un experimento en el que se elaboraron bloques multinutricionales con base en dichos subproductos. El experimento se adelantó en una finca de un productor y se utilizaron 57 novillos cebús con edades entre los 11 y los 24 meses y pesos entre los 124 y los 463 kilogramos. Los animales se dividieron dos grupos que se mantuvieron en pasturas no manejadas. Al grupo experimental se le ofrecieron adicionalmente bloques multinutricionales. Los animales fueron examinados para comprobar su estado fisiológico, con el fin de determinar posibles inconvenientes sanitarios que pudieran afectar el ensayo. Se realizaron pesajes para medir las ganancias de peso en los dos grupos. Los resultados mostraron promedios de ganancias diarias de peso similares a Pr < 5%, donde fueron ligeramente superiores las del grupo alimentado con los bloques multinutricionales (0,848 vs. 0,769 kg animal/día. Los aportes más importantes del experimento fueron, primero, brindar una opción para que el productor pueda alimentar a sus animales en épocas de escasez y evitar que tenga que venderlos a bajos precios. El segundo aporte fue abrir la posibilidad de usar los productos de la elaboración de la panela, que en muchas ocasiones se convierten en desechos que no son usados y que contaminan las fuentes de agua, de una forma económicamente viable.

  10. Educar para a literacia : perspectivas e desafios

    OpenAIRE

    Azevedo, Fernando José Fraga de, coord.

    2011-01-01

    Comunicação proferida na abertura do "VII Encontro de Educação : Numeracia e Literacia em Educação" Esta conferência aborda as principais perspectivas e desafios com que nos confrontamos quando abordamos o conceito de literacia. Assume-se que a aprendizagem da literacia é um direito da pessoa e que o conceito incorpora, no seu espectro semântico, processos de transformação social e política, muito para além da mera aprendizagem e domínio das técnicas de leitura e de escrita.

  11. Fontes para o estudo da arte medieval

    OpenAIRE

    Fraga Sampedro, Mª Dolores

    2013-01-01

    A materia Fontes documentais e literarias para a Historia da Arte, posúe o carácter de obrigatoria e ten que ser cursada no segundo ano (2º curso), en concreto no segundo cuadrimestre. Está integrada no módulo Coñecementos sistemáticos e integrados do feito artístico. Esta materia está estreitamente relacionada con Literatura e Arte no mundo antigo e medieval de primeiro curso, Fundamentos teóricos da historia da Arte de primeiro curso, Métodos de Análise e Interpretación do Fenómen...

  12. Macros y atajos para el traductor

    OpenAIRE

    José Luis Heredero

    2007-01-01

    Sin necesidad de recurrir a los productos comerciales de ayuda a la traducción que se han ido generalizando en muchas grandes empresas y organizaciones, el traductor independiente puede ver considerablemente facilitado su trabajo si sabe explotar las muchas posibilidades que brindan Visual Basic y otros lenguajes poco conocidos de dominio público. Se presentan aquí varias macros de Word y pequeñas aplicaciones desarrolladas en los últimos años para acelerar tanto las búsquedas de términos —ba...

  13. Fomento de responsabilidad procreativa para adolescentes

    OpenAIRE

    Vanegas de Ahogado Blanca Cecilia

    2010-01-01

    Se está desarrollando una línea de investigación-Docencia-Extensión que pretende, con medidas de promoción y prevención primaria, fomentar en los adolescentes un manejo responsable de su sexualidad, para contribuir en la disminución del embarazo indeseado y del aborto provocado. El trabajo se inició con un programa de atención individual y de pareja en una importante universidad colombiana; continuó con un programa de educación a grupos, utilizando técnica participativa con juegos de...

  14. Redes sociales para educomunicadores : recursos y experiencias

    OpenAIRE

    Universitat Autònoma de Barcelona. Máster en Comunicación y Educación (online)

    2013-01-01

    Las redes sociales han sido universalmente acogidas entre los usuarios de internet como una manera comprometerse en eventos, grupos sociales y temas de interés. Estos usuarios han encontrado en las redes un espacio para compartir información, socializar y, en muchos casos, construir verdaderas redes de cooperación y colaboración, un uso que puede ampliarse aún más en la medida en que madure la alfabetización mediática de sus participantes. Este informe muestra las principales redes sociales, ...

  15. Cuatro preguntas para iniciarse en cambio organizacional

    OpenAIRE

    Carlos Acosta

    2008-01-01

    El presente artículo llega a un concepto sobre el cambio organizacional a partir de las respuestas que ofrece a cuatro preguntas: ¿Qué es lo que cambia en las organizaciones?, ¿Por qué cambian las organizaciones?, ¿Cómo cambian las organizaciones? y -entonces- ¿Qué es el cambio organizacional? Para lograr el propósito se toma como objeto a las organizaciones empresariales y se centra en las dimensiones donde se localizan los cambios, explora lo que algunos autores dicen sobre el cambio, revis...

  16. Condiciones para el desarrollo del practicum

    OpenAIRE

    Miguel Zabalza Beraza

    2011-01-01

    El art??culo analiza las condiciones consideradas fundamentales para el desarrollo de buenos programas de practicum y pr??cticas en empresas. Son cuatro las condiciones que plantea: 1) doctrinales; 2) curriculares; 3) organizativas; y 4) personales. De la conjunci??n de una adecuada articulaci??n del practicum en los cuatro ejes, se derivar?? la mejor o peor definici??n de su sentido y de sus aportaciones a la formaci??n de los futuros profesionales. Advierte de posibles peligr...

  17. Proyecto educativo para una escuela rural

    OpenAIRE

    Galve-Pina, Ana María

    2014-01-01

    La propuesta que se desarrolla a continuación tiene la intención de dar una solución educativa a un colegio agrupado en el entorno rural. Ha sido diseñada para trabajar con niños de Educación Infantil de una clase en la que conviven alumnos de distintas edades y diversas procedencias, buscando una educación adaptada a sus diferentes características. Tanto las actividades como la metodología, así como las medidas de evaluación, objetivos propuestos y competencias a conseguir, en...

  18. Claves para la agenda del desarrollo

    OpenAIRE

    Octavio Rodríguez

    2011-01-01

    El presente artículo parte de las concepciones de Celso Furtado respecto de la renovación de la agenda del desarrollo para América Latina. El autor analiza con especial interés y cuidado diversos conceptos, como los de desarrollo, identidad cultural, crecimiento autocentrado, inserción externa, cooperación internacional y asimetrías entre países. Insertos en una visión global de los sistemas culturales, esos conceptos constituyen elementos esenciales en una agenda del desarrollo, habida cu...

  19. Frutos do paraíso

    OpenAIRE

    Daisy Wajnberg

    2008-01-01

    O livro do poeta, tradutor e ensaísta Haroldo de Campos, Éden: um tríptico bíblico, publicado postumamente, aborda e transcria as passagens bíblicas da expulsão do Paraíso, a da torre de Babel e o Cântico dos Cânticos em sua íntegra. Palavras-chave Bíblia, literatura, tradução, poética, transcriação Abstract Éden: um tríptico bíblico is the last book by Haroldo de Campos, Brazilian poet and translator, published after ...

  20. Para Bombay phenotype--a case report.

    Science.gov (United States)

    Mathai, J; Sulochana, P V; Sathyabhama, S

    1997-10-01

    Bombay phenotype is peculiar in that red cells are not agglutinated by antisera A, B or H; while serum contains anti A, B and H. Existence of modifying genes at independent loci with variable expression of ABO genes is postulated. We report here a case of partial suppression where antigens could be detected by elution tests and unlike classical Bombay type, normal amount of appropriate blood group substances were present in saliva. This case of para Bombay phenotype was detected as a result of discrepancy in cell and serum group ng. This highlights the importance of both forward and reverse grouping in ABO testing.

  1. Razonamiento algebraico elemental: propuestas para el aula

    Directory of Open Access Journals (Sweden)

    Walter F. Castro G

    2014-09-01

    Full Text Available En este artículo se aborda el problema de la enseñanza de álgebra en la escuela primaria. Se discute lo que se entiende como “early álgebra” y se presentan varios enfoques sobre la introducción del álgebra en la escuela elemental. En correspondencia con los enfoques, se discuten tanto algunas tareas de razonamiento algebraico elemental que pueden ser implantadas en el aula, como algunas de las características algebraicas atribuidas. Finalmente, se presenta una propuesta para asignar niveles o grados de algebrización a algunas tareas.

  2. Convénceme para leer

    OpenAIRE

    Hernanz Vicente, Marina

    2014-01-01

    La animación a la lectura debe fomentarse desde los primeros años de vida del niño, en el ámbito familiar y promoverla en el ámbito escolar de forma sistematizada. En el ámbito educativo, que es el que compete a este trabajo, debemos tener en cuenta el progreso de los alumnos en la lectura y la importancia de una motivación adecuada. Es importante que los alumnos desarrollen un gusto por la lectura, un gusto que se verá reflejado en la cantidad de libros que lean y en su capacidad para com...

  3. Desarrollo de motores stirling para aplicaciones solares

    OpenAIRE

    García Menéndez, David

    2013-01-01

    Los sistemas de conversión termosolar basados en motores Stirling figuran entre las líneas de investigación actuales que pretenden contribuir al uso racional de la energía y al desarrollo sostenible. La presente Tesis Doctoral tiene como objetivo proporcionar criterios de análisis, diseño, fabricación y ensayo útiles para el desarrollo de motores Stirling alimentados con energía solar, a diferentes niveles de salto térmico. La metodología empleada está basada principalmente en técnicas...

  4. Factorización para invidentes

    OpenAIRE

    Ramirez, Natalia; García, Carolina; Gutiérrez, Claudia

    2008-01-01

    Planteamos la utilización de la Áreas Mágicas, un material didáctico para la factorización de polinomios que consta de figuras geométricas (cuadrados y rectángulos) de ciertas dimensiones que, dispuestas de la forma correcta, proporcionan al educando la opción de deducir las expresiones utilizadas en los llamados “casos de factorización” sin recurrir a la memorización. Esto facilitaría un aprendizaje significativo de dicha temática sin caer en la rutina de solucionar un gran...

  5. Los ritmos como terapia para la impulsividad

    Directory of Open Access Journals (Sweden)

    Mónica Triviño

    2012-10-01

    Full Text Available Investigaciones recientes muestran que el uso de patrones rítmicos facilita la respuesta óptima en el tiempo, por lo que el entrenamiento mediante ritmos podría proponerse como terapia novedosa ante problemas como la impulsividad. Esto podría beneficiar a pacientes con daño prefrontal o personas con trastorno por déficit de atención e hiperactividad (TDAH, que suelen mostrar conductas impulsivas, así como dificultad para estimar el paso del tiempo.

  6. Herramienta para implementar LEL y escenarios (TILS)

    OpenAIRE

    Gil, Gustavo Daniel

    2002-01-01

    Esta tesis se divide en seis grandes partes: Introducción, Estado del Arte: Ingeniería de requerimientos, Léxico Extendido del Lenguaje, Escenarios, Funcionalidad y Arquitectura de la Herramienta, Utilización de la Herramienta y Conclusiones. ESTADO DEL ARTE: incluye el capítulo 2, llamado INGENIERÍA DE REQUERIMIENTOS , en donde se analizan algunos modelos para el análisis de requerimientos, áreas de problemas y técnicas de elicitación. Los capítulo 3 y 4, LA INGENIERÍA DE SOFTWARE en los ...

  7. Hacer para pensar: ideas, espacios y herramientas

    OpenAIRE

    Miranda Garnier, Ximena; Badilla Saxe, Eleonora; Urrea Giraldo, Claudia; Barrantes Acuña, Danny

    2012-01-01

    Resumen: Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico,como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y he...

  8. Yoga para crianças

    Directory of Open Access Journals (Sweden)

    Maria Ester Massola

    2012-06-01

    Full Text Available As crianças nascem em uma época de grandes mudanças, tudo parece instantâneo. No mundo externo tudo se transforma rapidamente, mas em nosso mundo interior, o ritmo é outro. Necessitamos desenvolver a observação e o olhar interno, para nos relacionarmos de forma mais equilibrada e saudável com nós mesmos e com os outros. Ensinar crianças e adolescentes a relaxar, a meditar, a gostar de permanecer um pouco em silêncio, a cuidar tanto de si como dos outros, a acalmar o corpo e a mente é sem dúvida uma tarefa fundamental e imprescindível em nossa sociedade.  A prática de Yoga tem se mostrado uma maneira nova e eficiente para auxiliar no desenvolvimento físico e mental desta faixa etária.Vários trabalhos científicos têm sido publicados e sugerem que ensinar Yoga às crianças e aos jovens é uma atividade que traz benefícios à saúde tanto física como mental. Aparece também como uma forma promissora de terapia complementar, porém é recomendado que mais pesquisas sejam feitas para comprovar de forma mais clara e objetiva seus benefícios e aplicações. Na prática, observa-se nas crianças grande interesse, alegria e facilidade em aprender esta milenar arte indiana para integração de corpo e mente. Ouvir uma criança dizer: “Que silêncio gostoso...” ou “Parece que estou nas nuvens!” indicam que práticas contemplativas como Yoga são muito bem vindas na formação desta nova geração.

  9. Retroníquia: Reconhecer para Tratar

    OpenAIRE

    Cabete, J; de Lencastre, A.

    2013-01-01

    Introdução: Retroníquia é o termo proposto por alguns autores para definir o processo caracterizado por onicocriptose proximal e consequente inflamação crónica da prega ungueal proximal (PUP), provavelmente de etiologia traumática. Os autores descrevem dois casos desta entidade clínica recentemente descrita. Casos clínicos: Caso 1: Jovem de 18 anos é observada por sinais inflamatórios do hálux esquerdo com 5 meses de evolução, em relação com trauma pelo calçado. ...

  10. Estrategias para un aprendizaje significativo-constructivista

    OpenAIRE

    Lara Guerrero, Juan

    1997-01-01

    Los docentes suelen preocuparse casi exclusivamente del qué y cómo enseñar; pero, generalmente, suelen desentenderse del aprendizaje de los alumnos al considerar que es competencia y responsabilidad de ellos. Hoy se pide un enfoque alternativo, en el cual se preste atención también al proceso de aprendizaje, porque es tan importante lo que se aprende como el modo en que se aprende. Se trata de orientarlos en el proceso de aprendizaje (cómo aprender) para que sean capaces de aprender...

  11. Para um perfil do idoso-andarilho

    Directory of Open Access Journals (Sweden)

    Claudia Lysia de Oliveira Araújo

    2012-01-01

    Full Text Available O termo envelhecimento é frequentemente empregado para descrever as mudanças morfofuncionais que ocorrem ao longo da vida humana, após a maturação sexual e que, progressivamente, comprometem a capacidade de resposta dos indivíduos ao estresse ambiental e à manutenção da homeostasia. Na condição de pessoas em envelhecimento avançado e de vida fragilizada, são encontrados muitos idosos-andarilhos por estradas e ruas das cidades brasileiras. Definimos aqui andarilho como a pessoa que vive fora do lar, em um cotidiano muito simples, miserável até, afastado de relações familiares e sociais mais próximas, distanciados do sentido de uma vida dita normal. A falta deste sentido de vida, a que se alia o preconceito da sociedade, têm sido fatores que levam à estigmatização desses idosos abandonados, fazendo-os a acreditar que a rua é o único lugar que lhes resta para viver. O objetivo deste estudo foi conhecer os motivos que conduzem um idoso a se tornar andarilho, tendo sido realizado nos albergues das cidades do Vale do Paraíba, no Estado de São Paulo. O universo desta experiência foram alguns idosos sem moradia, independentemente de gênero. Identificamos, neste estudo, os idosos encontrados não por seus nomes reais, mas por meio da denominação dada a pedras preciosas. Eles relataram ter profissão, embora vivam sós, perambulando pelas ruas das citadas regiões urbanas. Quanto aos problemas de saúde, os idosos aqui entrevistados referiram alguma patologia, ainda que nenhum deles fizesse tratamento ou visitasse médico regularmente, por não disporem de documentos. Os relatos desses idosos-andarilhos apontam para uma condição de sobrevivência fragilizada, comprometida por se tornarem muito vulneráveis, susceptíveis a agressões externas, o que agudiza cada vez mais sua exclusão familiar e social. Por fim, verifica-se que eles ainda sonham em voltar ao lar e recomeçar a vida ao lado da própria família.

  12. Accesibilidad digital para usuarios con limitaciones visuales

    OpenAIRE

    Toledo, Gabriela Alejandra

    2012-01-01

    Trabajo presentado para la obtención del titulo de Magister en Tecnología Informática aplicada a la Educación. Suscribe los siguientes principios: * La Educación permanente es un Derecho Humano Universal. * Las TIC son herramientas de apoyo, potenciales colaboradoras en el desarrollo y mejora de las habilidades cognitivas. * La cognición de los sujetos se potencia cuando los entornos de aprendizaje resultan “amigables”, accesibles y usables. * Los fundamentos del Diseño par...

  13. Notas para los Colaboradores del Index Botanicorum

    Directory of Open Access Journals (Sweden)

    Verdoorn Frans

    1946-12-01

    Full Text Available EL INDEX BOTANICORUM: -Al discutir la necesidad de un diccionario biográfico de los botánicos del mundo y de todos los tiempos. JAMES BRITTEN (J. Bot. 39: 394. 1901 afirma: “Este formaría un compendio manual y útil no solamente de biografías botánicas sino de investigación botánica y sería de valor incalculable para el historiador y el estudiante” En el siguiente artículo se habla de las pautas que deben seguir los colaboradores del Index Botanicarum al escribir en dicho diccionario.

  14. Para no olvidar el comentario de texto.

    Directory of Open Access Journals (Sweden)

    Rúben López.

    2004-03-01

    Full Text Available ¿Qué es comentar?El Diccionario de la Real Academia Española enuncia que la noción de “comentario” tiene tres sentidos: 1 Escrito que sirve de explicación de una obra, para que se entienda más fácilmente. 2 Juicio, parecer, mención o consideración que se hace, oralmente o por escrito, acerca de una persona o cosa. 3 Título que se da a algunas historias escritas en estilo conciso.

  15. Investigar para que Siga la Fiesta

    OpenAIRE

    Andrés Darío

    2014-01-01

    Las universidades deberían incentivar más las investigaciones relacionadas con los servicios públicos, con el uso de referentes como la regulación actual, con el fin de cuestionarla y mejorarla. Lejos de un afán de negocio, el objetivo sería garantizar su sostenibilidad por varias generaciones y ojalá por siempre. Esta debería ser reconocida como la principal responsabilidad de las universidades, investigar para que siga la fiesta.

  16. Pensar la naturaleza: la naturaleza para “nosotros” y para los “otros”

    OpenAIRE

    Regina Ricco

    2013-01-01

    Mientras que la separación occidental naturaleza/cultura convierte a la primera en objeto de exploración al definirla negativamente como parte de la realidad que existe independientemente de lo humano, para otros pueblos supone un conjunto de interacciones donde el hombre es un elemento más

  17. Cinco paradigmas para abordar lo real

    Directory of Open Access Journals (Sweden)

    Eva Pasek de Pinto

    2006-01-01

    Full Text Available Considerando la crisis de la investigación social, el propósito del estudio fue configurar un fundamento paradigmático para la investigación en ciencias sociales. Partiendo de dos cuerpos teóricos: Mardones, (1991; y Padrón, (1994, 1998, por medio de la deducción y del análisis se obtuvieron cuatro paradigmas de investigación que, integrados, permitieron obtener un quinto paradigma. Así, como resultado del estudio se presentan cinco paradigmas posibles para abordar la realidad: el empírico- inductivo; el racionalista deductivo; el fenomenológico vivencial, el reflexivo crítico y el holístico o de la complejidad. A lo largo del estudio, cada uno de ellos se analiza en cuatro aspectos paradigmáticos: el Ontológico, el Epistemológico, el Axiológico y el Metodológico.

  18. Adolfo Celi, um olhar para dois mundos

    Directory of Open Access Journals (Sweden)

    Alessandra Vanucci

    2002-11-01

    Full Text Available O ensaio resgata a vivência brasileira de Adolfo Celi, ator e diretor italiano ativo em cinema e teatro (1922-1986, inserido no laboratório paulista da renovação, na década de 1950. Sua atuação impôs, no palco, o legado texto-cêntrico de Sílvio d'Amico e a utopia do ator plástico de Copeau e, na tela, a estética neo-realista associada a uma atuação fortemente marcada pelo ideário teatral moderno. As intuições, a herança, as oportunidades e as invenções perdidas desta experiência transcultural sugerem um quadro de realização somente parcial do projeto modernizador. Ao entrar na década de 60, é a sensação de ter esgotado um ciclo existencial que fornece a Celi um válido álibi para o retorno. Álibi (1969, seu terceiro e último filme como diretor, realizado na Itália com Gassmann e Lucignani, é um testemunho de vida e memórias, de raiva e de saudade do Brasil; e um precioso guia para entender sua extraordinária ‘aventura americana’.

  19. Allergic contact dermatitis to para-phenylenediamine.

    Science.gov (United States)

    Jenkins, David; Chow, Elizabeth T

    2015-02-01

    Exposure to hair dye is the most frequent route of sensitisation to para-phenylenediamine (PPD), a common contact allergen. International studies have examined the profile of PPD, but Australian-sourced information is lacking. Patients are often dissatisfied with advice to stop dyeing their hair. This study examines patients' characteristics, patch test results and outcomes of PPD allergy from a single Australian centre, through a retrospective analysis of patch test data from 2006 to 2013 at the Liverpool Hospital Dermatology Department. It reviews the science of hair dye allergy, examines alternative hair dyes and investigates strategies for hair dyeing. Of 584 patients, 11 were allergic to PPD. Our PPD allergy prevalence rate of 2% is at the lower end of international reported rates. About half these patients also react to para-toluenediamine (PTD). Affected patients experience a significant lifestyle disturbance. In all, 78% tried alternative hair dyes after the patch test diagnosis and more than half continued to dye their hair. Alternative non-PPD hair dyes are available but the marketplace can be confusing. Although some patients are able to tolerate alternative hair dyes, caution is needed as the risk of developing an allergy to other hair dye ingredients, especially PTD, is high. PMID:25302475

  20. FUNDAMENTOS COGNITIVOS PARA O ENSINO DA LEITURA

    Directory of Open Access Journals (Sweden)

    Lucilene Bender de Sousa

    2010-01-01

    Full Text Available Neste artigo, revisamos alguns fundamentos teóricos para o ensino da leitura baseados em recentes estudos das neurociências e ciências cognitivas. A leitura, enquanto processo cognitivo, deve ser compreendida em todos os seus níveis de processamento para que o ensino possa identificar e atender às necessidades do aluno. Primeiramente, abordamos o processamento da leitura do nível mais básico, a decodificação, ao nível mais avançado, a compreensão. Em seguida, exploramos funções cognitivas que não são exclusivas da leitura, a memória, a emoção e a aprendizagem. Por fim, propomos uma visão integrada desses processos, considerando a intrínseca relação entre língua, cognição e cultura, a qual permeia todas as nossas atividades, destacando o papel da cultura e da educação no desenvolvimento cognitivo.

  1. EDUCACIÓN PARA EL CONSUMO

    Directory of Open Access Journals (Sweden)

    J. L. Castillejo

    2011-01-01

    Full Text Available El consumo es un fenómeno de gran peso en la vida actual de los países desarrollados y también de los que están en vías de desarrollo, sinónimo de felicidad y de estatus personal. Por todo ello el consumo merece ser objeto de la educación. En la educación para el consumo resulta clave la implicación familia- escuela, puesto que los padres marcan las primeras pautas en este terreno, junto al contexto social y los medios de comunicación. La educación para el consumo implica información, capacidad de análisis crítica de las situaciones y sensibilidad respecto a las consecuencias del consumo desmedido, que pone en peligro la supervivencia misma del planeta. El consumo se enfrenta así con la escala de valores que la educación debe defender.

  2. El humor como herramienta para lograr aprendizajes

    Directory of Open Access Journals (Sweden)

    Hilda Torres de Sánchez

    2003-09-01

    Full Text Available Una tendencia mundial se ha originado: el uso del humor como herramienta para lograr aprendizajes y mejorar el ambiente donde la persona se encuentre. En el área educativa hay pruebas que demuestran su utilidad y que efectivamente origina cambios positivos, medidos en las evaluaciones, tanto en los estudiantes como en participantes de sesiones de facilitación. El objetivo del experimento realizado fue: Determinar el comportamiento a través de la calificaciones en la primera prueba, del efecto del uso del humor en el dictado de clases utilizando diferentes herramientas como: chistes, anécdotas, analogías en los contenidos. A través de un estudio experimental con un grupo de control realizado en dos aulas de clases con 35 alumnos cada uno, al grupo experimental se le aplicó diferentes recursos humorísticos como herramientas de aprendizaje. Se analizaron las calificaciones en la primera prueba a través de porcentajes de aprobados y aplazados, observándose que el grupo experimental arrojó los mayores porcentajes de aprobados. Tales resultados confirman que el humor como herramienta, si induce a un desempeño excelente en alumnos, lo que lleva a implementar acciones de adiestramiento para los facilitadores, así como el surgimiento de investigaciones más profundas sobre el uso del humor en la educación.

  3. Alternativas fundamentales para cuantificar el riesgo operacional

    Directory of Open Access Journals (Sweden)

    Ermilson Velasquez Ceballos

    2010-04-01

    Full Text Available El presente artículo es uno de los resultados de un proyecto de investigación financiado por la Universidad EAFIT en el año 2009. En el contexto del riesgo operacional, se hace un desarrollo formal de los métodos de Simulación Montecarlo, el algoritmo de recursión de Panjer y la Aproximación Analítica de Böcker y Klüppelberg, que son tres de las técnicas más utilizados para cuantificar ese riesgo en entidades financieras en el ámbito mundial. Luego se desarrolla una aplicación para un caso práctico, aplicando los tres métodos, y se obtienen conclusiones sobre su desempeño relativo. ABSTRACTThis article is one of the outcomes of a research project financed by Universidad EAFIT in the year 2009. In the operational risk context, a formal development of Montecarlo simulation methods, Panjer recursion algorithm, as well as Böcker and Klüppelberg analytical approximation is done, which are three of the most used techniques in order to quantify this risk in financial institutions worldwide. Subsequently an application for a practical case is developed by applying the three methods, and conclusions about its relative performance are obtained.

  4. para cemento pórtland I

    Directory of Open Access Journals (Sweden)

    OLGA ISABEL RESTREPO BAENA

    2007-01-01

    Full Text Available En esta investigación se usaron minerales de origen colombiano tal y como son producidos en sus respectivas minas. Se experimentó con la fluorita (Santander, el feldespato (Antioquia y el manganeso (Antioquia en cantidades del 0,0%, 0,2%, 0,5%, 1,0%, 1,5% y 2,0%. Se aplicaron varias técnicas como difracción de rayos X, fluorescencia de rayos x, microscopía electrónica de barrido y microscopía óptica para caracterizar los materiales utilizados y análisis térmico diferencial para determinar la temperatura de clinkerización y se evaluó mineralógicamente el clínker obtenido. Se encontró que el mejor resultado se logró con la adición de 0,5% de la fluorita al permitir la mayor formación de alita y la disminución en el contenido de cal libre. El feldespato y el manganeso (braunita utilizados no tuvieron un comportamiento apropiado.

  5. Un modelo SETAR para el PIB colombiano

    Directory of Open Access Journals (Sweden)

    Vivas Lorena

    2010-08-01

    Full Text Available En este artículo se estudia el comportamiento de la tasa de crecimiento del PIB colombiano entre 1982-2008 a partir de un modelo SETAR (Self-Exciting Threshold Autoregressive, empleando la metodología propuesta por Tsay (1989 y Tong (1990 para la detección de no linealidades relacionadas con la existencia de regímenes cambiantes. Adicionalmente, se comparan los pronósticos generados con los obtenidos en un modelo autorregresivo lineal para diferentes horizontes de predicción, empleando funciones de pérdida simétricas. Los resultados muestran evidencia empírica de que existe no linealidad de umbral en la serie asociada a las altas o bajas tasas de crecimiento registradas por su rezago anual (permaneciendo más tiempo en el régimen de tasas de crecimiento más elevadas y que el desempeño de los pronósticos del modelo SETAR parece no mejorar con respecto al modelo base.

  6. Reflexiones para proyectar viviendas del siglo XXI

    Directory of Open Access Journals (Sweden)

    Josep María Montaner

    2010-07-01

    Full Text Available El artículo plantea formular una revisión de los criterios de diseño de la vivienda colectiva para el siglo XXI reflejado, fundamentalmente, en que hoy en día existe la conciencia de un cambio social. El texto valora una serie de cuestiones clave: ¿responde la vivienda a la diversidad de la sociedad? ¿Contribuye a mejorar la calidad de la ciudad y el territorio? ¿Se hace un uso razonable de las tecnologías disponibles? ¿Responde a unos objetivos de sostenibilidad? Los parámetros para el diseño de la vivienda en la propuesta planteada parten de la definición de unos criterios básicos que se complementan con una serie de diagramas sobre las relaciones idóneas entre ámbitos de la vivienda y espacios del edificio. Se genera un sistema de valoración integral, formado por 14 + 1 variables imprescindibles, que permite proyectar y evaluar proyectos. En conclusión, la calidad de la vivienda se resuelve tanto en la correcta resolución de su interior, como en su contacto con el espacio público del barrio, mediante una diversidad de gradientes que pasen de lo urbano a lo privado.

  7. Sistema integral para viviendas unifamiliares -SIVIM-

    Directory of Open Access Journals (Sweden)

    Drágula, Josef

    1984-07-01

    Full Text Available The Integral System for Multi-family Housing —SIVIM— is a proposition combining a structural solution and a functional one. In the first, techniques developed in civil construction for reinforced concrete technology are incorporated in the production of buildings. The second one proposes a spatial solution appropriate to the users’ requirements. Thus, with this proposition, the aims of constructing mass, low-cost housing are maintained in countries with tropical climatesEl Sistema Integral para Viviendas Multifamiliares —SIVIM— es una proposición que combina una solución estructural y una solución funcional. En la primera, se incorporan técnicas desarrolladas en la construcción civil, para la tecnología del hormigón armado, a la producción de edificaciones. La segunda, propone una solución espacial apropiada a los requerimientos de los usuarios. Se mantiene así con esta proposición, las metas de la construcción masiva y del bajo costo de la vivienda en países de clima tropical

  8. Tratamiento acortado estrictamente supervisado para tuberculosis pulmonar

    Directory of Open Access Journals (Sweden)

    Alvarez-Gordillo Guadalupe del Carmen

    1998-01-01

    Full Text Available Objetivo. Evaluar la posibilidad de aplicar el tratamiento acortado estrictamente supervisado (TAES en el Programa de Control de la Tuberculosis en Chiapas, México. Material y métodos. Se evaluó la eficacia y la eficiencia del tratamiento en una cohorte de pacientes con tuberculosis pulmonar confirmada por baciloscopía, que ingresaron a tratamiento con esquemas de autoadministración semisupervisión y estricta supervisión, de enero a junio de 1996. Resultados. La eficacia fue de 90.9. 97.7 y 100% para los esquemas de tratamiento autoadministrado, semisupervisado y TAES, respectivamente, mientras que la eficiencia fue de 68.1. 77.6 y 88.5% en el mismo orden. Conclusiones. Para la salud pública el TAES demostró ser la actividad más importante en el control de la tuberculosis, al elevar las tasas de curación y disminuir, por lo tanto, las fuentes de transmisión de la enfermedad.

  9. Yúmari / Tutuburi: danzar para no morir

    Directory of Open Access Journals (Sweden)

    Ángel Acuña Delgado

    2010-01-01

    Full Text Available Los rarámuri, habitantes de la sierra Tarahumara, al norte de México, tienen en su diversidad dancística una de sus más genuinas formas de expresión y comunicación, danza orientada tanto hacia el culto divino como hacia las relaciones humanas. Apoyado en los datos obtenidos durante los once meses de trabajo de campo entre 2001 y 2005 en varias comunidades rarámuris de la Alta y Baja Tarahumara, centraremos aquí la atención en el yúmari / tutuburi, ritual festivo a la vez que modalidad de danza desarrollada en su transcurso. Tras las referencias históricas iniciales, se describe a continuación el proceso festivo en general y la danza en particular identificada como yúmari / tutuburi; para situarnos finalmente en torno al sentido, tanto en un plano funcional como estructural. Con todo ello destacaremos la importancia que esta manifestación cultural posee para seguir siendo rarámuri dentro del contexto actual.

  10. Centro para reuniones, en Karpfenberg, Estiria (Austria

    Directory of Open Access Journals (Sweden)

    Windbrechtinger, W.

    1965-03-01

    Full Text Available The building bas two wings. One of them has two storeys, and a semibasement, and is used as offices. The other wing has a single floor level, and constitutes the Meeting Hall. On entering there is a kind of forecourt, and behind the meeting hall there is a further court, which on special occasions could also be utilized for large meetings. Amusement rooms for television and card and other games are provided in the semibasement: also a photographic laboratory, games stores, washing and boiler room. The ground floor contains the municipal library, a number of offices (an insurance company, the workers' chamber, and the association of nature's friends and rooms for the meetings of political organisations. On the second floor the syndicates have their offices, which include board room, a teaching room, three rooms for guests, the doorman's living quarters, and the necessary services. Finally, the meeting hall section involves a vestibule, the hall itself with accommodation for 300 people, a stage, cafeteria, kitchen, and other auxiliary facilities. The design of this building is rational and straightforward, and is pleasantly in keeping with the surrounding buildings and landscape.El edificio consta de dos alas: una, con dos plantas—destinadas a oficinas—y semisótano; y otra, de una sola planta, en la que está situada la sala de reuniones. Visto el conjunto desde la entrada, aparece una especie de patio delantero, dejando, detrás de la sala, un segundo patio, susceptible de ser utilizado en casos especiales, tales como grandes reuniones, etc. El semisótano agrupa las salas de esparcimiento—juego, televisión, trabajos para entretenimiento—, laboratorio fotográfico y cámara oscura, locales para guardar los utensilios de deporte, aseos, almacén y cuarto de la calefacción. La planta baja contiene la biblioteca municipal, varias oficinas— de una sociedad de seguros, de la cámara de trabajadores, de la asociación de amigos de la

  11. Lectums: red social para amantes de la lectura

    OpenAIRE

    Hernández Trueba, Alexandre

    2011-01-01

    “Lectums, red social para amantes de la lectura” es un proyecto de fin de carrera con el que se pretende hacer un prototipo para Lectums, una red social dedicada a gente a la que le gusta la lectura y quiere compartir su afición y sus gustos literarios. Para ello se necesita crear una parte pública en la que los usuari...

  12. Nueva especie de Loxostethus (Coleoptera: Tenebrionidae: Diaperini) para Cuba

    OpenAIRE

    Garrido, Orlando H.; Gutierrez, Esteban

    2010-01-01

    El género Loxostethus fue descrito por Triplehorn (1962), describiendo las especies fasciatus y opacifrons para Cuba, jamaicensis para Jamaica, y unicolor para Puerto Rico. Todas fueron halladas en hongos, y si bien no han sido reportadas de la Isla de Santo Domingo no es de extrañar que eventualmente aparezcan. Zayas (1989) describió L. quadrimaculata para Trinidad, Cuba-sin embargo, esta última especie cae dentro de la variación individual de L. fasciatus de acuerdo a la descripción de Trip...

  13. PROPUESTA METODOLÓGICA PARA EL MAPEO DE COMUNIDADES ARRECIFALES

    OpenAIRE

    Carlos F. Candelaria -Silva; Norma A. Corado-Nava; J. Manuel Oseguera-Cruz; Emmanuel Teyssier-Teutli; Brian Urbano-Alonso; Magali Honey-Escandón; Andrés Ocampo-Palacios; Silvia Hinojosa-Álvarez; Alejandra Martínez-Melo

    2006-01-01

    La cartografía de arrecifes coralinos se ha constituido en una valiosa herramienta para conocer diversos fenómenos y procesos biológicos que ocurren en estas comunidades, relacionados con su dimensión espacial. Los mapas se han empleado para representar la conformación topográfica de la formación arrecifal, los patrones de distribución de los corales y otras especies, como referentes para estudios de sucesión y para propósitos aplicados relacionados con programas de conservación y desarrollo ...

  14. Puente mixto para ferrocarril y carretera

    Directory of Open Access Journals (Sweden)

    Harris, P. C.

    1963-10-01

    Full Text Available This new bridge, known as the West Branch, spans the course of a river, and has a double function and two superimposed decks. One of these carries the road, and the other lower one, the railway line. It has been constructed by the Dept. of Public Works of California. The structure consists of four main spans resting on reinforced concrete piles, of great height. Four rectangular holes run down their centres. The decks consist of a continuous metal framework, made up of heavy elements, some of them weighing up to 56 tons each, was assembled in the workshop in separate sections. These were then transported to the site, to be integrated within the whole structure. In the final assembly high tensile steel bolts were employed. As the piles are very high, they are of varying cross section, according to the height. The concreting was done by means of sliding formwork, and this was sufficiently wide to ensure that the concrete was at least four hours old when the formwork passed beyond its level. To carry out these operations an auxiliary tower was built up. which supported the framework carrying the concreting tub and its pouring mechanism. From this main tub the concrete was poured into others, which placed it into the various parts of the formwork. The operation of the concrete elevator, whose motive power was provided by of the plant at ground level, was controlled by telephone between the operator of the power plant and the person responsible for distributing the concrete on the top platform. To provide the finish of the surfaces left by the sliding formwork, another platform was installed, working at a level below the lower edge of the formwork, and a similar arrangement was adopted with respect to the inner formwork for the four hollows running inside the piles.El nuevo puente, llamado West Branch, que salva el profundo cauce de un río, tiene una doble finalidad y dos tableros superpuestos: uno para carretera en la parte superior y otro para una

  15. Nave para Volkswagen en Ravenna, Italia

    Directory of Open Access Journals (Sweden)

    Epaminonda, Ceccarelli

    1965-09-01

    Full Text Available This factory hall is meant to house an exhibition, workshops, stores and offices of the Italian subsidiary of the Volkswagen firm. It is sited in an urbanized, but not yet built up, area. Its ground area is 54 by 38 m. Part of the frontage, about 36 m, is set back 8 m with respect to the remaining 18 m; the latter correspond to the part of the building occupied by the exhibition hall. As the ground is weak, it has been necessary to use piles to support the foundations. The structure is metallic, and the enclosing walls and roof consist of prefabricated panels and metals sheets. The roof contains a special chamber, where the air conditioning ducts and other services are housed. Great care has been taken over the colour patterns, both inside and outside. The type of structure and use of prefabricated panels has greatly lowered the overall cost of the building. All the foundation elements have been suitable waterproofed.Esta nave industrial está destinada a albergar los servicios de exposición, talleres, depósito y oficinas para la empresa concesionaria, en Italia, de la marca de automóviles Volkswagen. Se halla situada en una zona urbanizada, pero sin edificar, y tiene 54x38 m en planta. Parte de la fachada principal—unos 36 m—está retranqueada 8 m respecto de la alineación; los 18 m restantes corresponden al salón de exposiciones. Como el terreno es de escasa capacidad de sustentación, ha sido necesario el empleo de pilotes en los puntos de apoyo. La estructura resistente es metálica y se ha cerrado y cubierto con paneles prefabricados y placas metálicas. Los forjados de cubierta tienen una cámara que permite la colocación de conductos para el acondicionamiento. Se han cuidado mucho los colores para la estructura vista y paramentos interiores. La disposición de la estructura y el empleo de paneles prefabricados han permitido obtener costos muy favorables. Todas las partes de la infraestructura han sido debidamente

  16. EKSPLOITASI EKONOMI DAN SEKSUAL PARA PENARI LENGGER

    Directory of Open Access Journals (Sweden)

    Eka Septianingsih

    2013-04-01

    Full Text Available Awalnya kesenian lengger digunakan dalam upacara-upacara ritual di pedesaan serta upacara-upacara yang berkaitan dengan kesuburan. Saat ini kesenian lengger lebih mengarah pada fungsi hiburan dan komersial. Hal ini membuat penari lengger rentan terhadap eksploitasi baik secara ekonomi maupun seksual. Pertanyaan penelitian ini adalah bagaimana bentuk pertunjukan lengger; bagaimana tanggapan masyarakat terhadap keberadaan penari lengger;  bagaimana bentuk eksploitasi yang dialami oleh penari lengger; dan apa respon penari lengger tentang tindakan eksploitasi itu. Metode penelitian yang digunakan adalah kualitatif, dengan analisis data interpretatif. Lokasi penelitian di desa Selanegara, Sumpiuh, Banyumas. Hasil penelitian menunjukkan bahwa ada beberapa unsur yang terkait dengan bentuk pertunjukan lengger, yaitu: pemain, gerak, iringan musik, tata rias dan busana, serta tempat pementasan. Citra negatif penari lengger biasanya diasosiakan dengan gerakan tari yang erotis sehingga dapat memancing pelecehan, seperti diraba, dicolek, dipeluk dan dicium oleh para pengibing. Bentuk eksploitasi ekonomi terjadi karena tuntutan ekonomi sehingga mendorong para penari mengeksploitasi tubuhnya untuk mendapatkan uang.  Perlakuan tidak senonoh dari penonton merupakan bagian dari resiko profesi yang harus dijalani. Fenomena ini diharapkan dapat mendorong masyarakat dan pemerintah untuk melindungi para pelaku kesenian dari tindakan eksploitasi.Originally lengger is performed in ceremonies and rituals in rural ceremonies associated with fertility. Currently the performance of lengger has more entertainment and commercial functions. This makes the dancers vulnerable to exploitation lengger both economically and sexually. The objectiveof this study is to explore the form of lengger show, forms of exploitation experienced by dancers lengger, and the responses of the lengger dancer towards exploitation. Research methods used are qualitative approach, with

  17. Cuidados Paliativos Neonatais e Pediátricos para Portugal- Um desafio para o século XXI

    OpenAIRE

    MENDES, Joana; Justo da Silva, Lincoln; Santos, Maria João

    2013-01-01

    Cuidados Paliativos Neonatais e Pediátricos para Portugal- Um desafio para o século XXINeonatal and Pediatric Palliative Care for Portugal- a challenge for the XXI centuryResumoDesde 2004, os Cuidados Paliativos tem merecido uma atenção crescente no Programa Nacional de Saúde em Portugal. Ainda assim, os programas para as crianças e suas famílias, contemplando as suas necessidades específicas, continuam escassos, fragmentados e inconsistentes, disponíveis maioritariamente para doentes do foro...

  18. Raman Spectroscopy of the Eutectic in the Mixed Crystal of the Para-Dibromobenzene with the Para-Chloronitrobenzene

    CERN Document Server

    Korshunov, M A

    2001-01-01

    The mixed crystal of a para-dibromobenzene with a para-chloronitrobenzene is investigated at concentration of components from 0% up to 60% of a para-chloronitrobenzene by the method of Low-Frequency Raman spectroscopy. It is shown, that in range of concentrations from 25% up to 50% of a para-chloronitrobenzene the spectrum of the mixed crystal would consist of the sum of spectrums a and b phases which relation of intensities depends on concentration of components. It is also found, that the single crystal in this range has rod frame.

  19. Morelos A-2010, nueva variedad de arroz para siembra directa para el centro de México

    OpenAIRE

    Jorge Salcedo Aceves; Edwin Javier Barrios Gómez

    2012-01-01

    En la zona central de México se siembra el arroz (Oryza sativa L.) en trasplante y directa bajo riego; la mayoría de las variedades se han liberado para trasplante; sin embargo, al usarlas para siembra directa tienen el problema del acame. En 1998 se inicio el mejoramiento del arroz por inducción de mutaciones con el objetivo de obtener una variedad para siembra directa. Para esto, se irradiaron 200 gramos de semilla de la variedad Morelos A-92, en la fuente Gammacell 220 del Instituto Nacion...

  20. Fomento de responsabilidad procreativa para adolescentes

    Directory of Open Access Journals (Sweden)

    Vanegas de Ahogado Blanca Cecilia

    1995-12-01

    Full Text Available

    Se está desarrollando una línea de investigación-Docencia-Extensión que pretende, con medidas de promoción y prevención primaria, fomentar en los adolescentes un manejo responsable de su sexualidad, para contribuir en la disminución del embarazo indeseado y del aborto provocado. El trabajo se inició con un programa de atención individual y de pareja en una importante universidad colombiana; continuó con un programa de educación a grupos, utilizando técnica participativa con juegos de salón, diseñados por las investigadoras, y ha tenido aplicabilidad con estudiantes de nivel secundario, universitario, de postgrado y profesionales en educación continua. Ha sido apoyado por cuatro investigaciones.

  1. La escuela para el siglo XXI

    OpenAIRE

    Juan Delval

    2013-01-01

    Centro Europeo de Derecho La escuela para el siglo XXI Currículo: doctor en Filosofía. Catedrático de Psicología Evolutiva y Educación en la Univer- sidad Autónoma de Madrid. Sus líneas de investigación versan sobre el desarrollo del pen- samiento infantil, especialmente en lo relativo a la lógica, a la formación del pensamiento científico y a la construcción de nociones sociales, así como a su aplicación a la formación de conocimientos en la escuela. Trabaja también sobre la historia de la p...

  2. Una reforma constitucional para la periferia europea

    Directory of Open Access Journals (Sweden)

    Gerardo Pissarello

    2011-01-01

    Full Text Available La intempestiva reforma del artículo 135 de la Constitución española puede leerse como una expresión más de la erosión en Europa de los elementos garantistas del constitucionalismo de posguerra. Tanto por su contenido como por el procedimiento empleado para acometerla, su aprobación aparece reñida con principios constitucionales básicos, como el democrático, el del Estado social o el de la autonomía territorial. Asimismo, supone un golpe a la legitimidad global de la Constitución cuya reversibilidad no será sencilla.

  3. Frutos do paraíso

    Directory of Open Access Journals (Sweden)

    Daisy Wajnberg

    2008-11-01

    Full Text Available O livro do poeta, tradutor e ensaísta Haroldo de Campos, Éden: um tríptico bíblico, publicado postumamente, aborda e transcria as passagens bíblicas da expulsão do Paraíso, a da torre de Babel e o Cântico dos Cânticos em sua íntegra. Palavras-chave Bíblia, literatura, tradução, poética, transcriação Abstract Éden: um tríptico bíblico is the last book by Haroldo de Campos, Brazilian poet and translator, published after his death. The author focuses on and trans-creates the biblical episodes of the expulsion from Paradise, of the Tower of Babel and the Song of Songs. Key words Bible, literature, translation, poetics, transcreation

  4. Un sistema de saneamiento para Madrid

    Directory of Open Access Journals (Sweden)

    Sánchez, Félix Cristóbal

    1986-03-01

    Full Text Available The Full Sanitation Plan for Madrid is the final action of a series undertaken for several years with the purpose to reach the completion of the sanitation system of the town. With the whole of these actions it could be said that the basic substructure has acquired enough level to deserve de real needs of the town.El Plan de Saneamiento Integral de Madrid representaba la culminación de una serie de acciones emprendidas, durante varios años, para conseguir que la ciudad completase su sistema de saneamiento. Con este conjunto de acciones comprendidas en el Plan puede decirse que esta infraestructura básica ha adquirido un nivel suficiente, capaz de prestar un servicio acorde con las auténticas necesidades de la Villa.

  5. Consejos y propuestas para un envejecimiento satisfactorio

    Directory of Open Access Journals (Sweden)

    María Guillermina Yanes García

    2011-08-01

    Full Text Available Se presenta un manual que aborda el tema de la ancianidad haciendo énfasis en orientaciones relacionadas fundamentalmente con aspectos que contribuyan al desarrollo de aquellas aristas del sujeto que enriquecen su espiritualidad y vida emocional, tales como habilidades comunicativas y de convivencia, mejoramiento de la imagen de sí mismo, autoestima y motivaciones, entre otros aspectos que de hecho intervienen en el equilibrio del proceso salud enfermedad. Incluye temáticas identificadas por los propios adultos mayores como constitutivas de sus problemas de salud, pero teniendo también en cuenta las acciones y soluciones propuestas ante dichas problemáticas, con el objetivo de abrir horizontes de crecimiento y desarrollo que permitan mejorar la capacidad de los adultos mayores para enfrentar los problemas de aceptar y adaptarse a lo que les toca vivir.

  6. Escuela para señoritas, Inglaterra

    Directory of Open Access Journals (Sweden)

    Stillman y Eastwlck-Field, Arquitectos

    1963-02-01

    Full Text Available The object was to design part of a new building which had been seriously damaged during the war, so that the old and new parts would blend into a pleasant whole, with a capacity for 600 girls. The new designs avoid the glass box style of school buildings, and glass walls have been adopted only on the ground floor, thus giving an impression of light and airiness to what used to be a partial basement. Classrooms have been designed in a simple manner, and give the impression of conventional rooms. Simple lines and materials have been chosen throughout. Strong contrasts in the external finish have been avoided, and colours provide a relaxing background to the intensive activities of the students. A constructional feature is the use of prefabricated concrete joists and supports. Outer walls consist of brick panels filling in the space between the visible concrete framework. Ceilings are of insulating boards, and the floors are covered with linoleum. Special attention has been devoted to the hall. In this case the roof is of white gypsum, and the only features are the grills covering the fluorescent lighting. The walls of this hall are of glass, and are covered with heavy velvet curtains. A balcony with hardwood posts adds a simple and friendly feature to the building. The furniture and drapery have been carefully chosen. Camden school has a rigid tradition of individualism and fine education, and the new building has succeeded in maintaining the exclusive quality of the older parts, as well as offering an overall impression of up to date construction.El problema consistía en proyectar un nuevo núcleo para un edificio que había sido seriamente bombardeado durante la guerra, de tal modo que las partes antiguas y nuevas formasen un conjunto agradable y con capacidad para más de 600 chicas. En la nueva construcción se ha evitado el carácter de «cajas de cristal» de las nuevas escuelas ordinarias y se han empleado muros de cristal solamente en la

  7. Abordaje transeptal para el reemplazo valvular mitral

    OpenAIRE

    Juan C. Medrano; Carlos A. Ingino; Carlos A. Rapallo; Carlos Barrero; Félix Ramírez; Arnaldo Milani; Miguel Rubio; Raúl A. Borracci

    2010-01-01

    IntroducciónA pesar de que es técnicamente más demandante, el acceso a la válvula mitral por vía transeptal permite una exposición mayor de sus valvas y del aparato subvalvular, en especial en aurículas pequeñas, en reoperaciones o cuando se combina con el tratamiento de la válvula tricuspídea.ObjetivosEvaluar las dificultades técnicas y las complicaciones asociadas con el abordaje transeptal para el reemplazo valvular mitral.Material y métodosEntre 2006 y 2009 se incluyeron 62 pacientes cons...

  8. Yoga para crianças

    OpenAIRE

    Maria Ester Massola

    2012-01-01

    As crianças nascem em uma época de grandes mudanças, tudo parece instantâneo. No mundo externo tudo se transforma rapidamente, mas em nosso mundo interior, o ritmo é outro. Necessitamos desenvolver a observação e o olhar interno, para nos relacionarmos de forma mais equilibrada e saudável com nós mesmos e com os outros. Ensinar crianças e adolescentes a relaxar, a meditar, a gostar de permanecer um pouco em silêncio, a cuidar tanto de si como dos outros, a acalmar o corpo e a mente é sem dúvi...

  9. Visualizador de ECG para a plataforma Android

    OpenAIRE

    Lopes, Gonçalo Filipe Ferreira

    2010-01-01

    O electrocardiograma é um dos principais tipos de exames complementares de diagnóstico não invasivos, nomeadamente em cenários de emergência médica. Esta ferramen.ta oferece-nos uma representação gráfica da actividade eléctrica do coração como forma de onda num período de tempo, fundamental para a compreensão do estado do coração. Com o desenvolvimento do computador de dimensões reduzidas e das comunicações wireless, o ser humano passou a poder deslocar-se com capacidade ...

  10. Garaje para la Universidad de California

    Directory of Open Access Journals (Sweden)

    Lin, T. Y.

    1964-06-01

    Full Text Available California University has constructed a two storey garage, with a prestressed concrete structure, at Berkeley. A particular feature of this building is that on the roof a soil layer, 0.45 cm in depth, has been laid, on which there is a grass lawn. The structure consists of a framework of beams, of 7.30 m span, in one direction, and 19 m in the other: this being the maximum separation of the columns in one elevation. Consequently the flooring is made of slabs spanning the shorter 7.30 m distance. The roof slab has been prestressed in two mutually perpendicular directions, hence it is practically impossible for it to develop cracks. This arrangement renders the slab watertight and implies a saving in the cost of applying waterproofing treatment. As the building is surrounded on three sides by three contention walls, advantage has been taken of this to transmit to these the horizontal thrusts due to windage and seismic forces. Most of the structural elements, excepting the flooring, have been prestressed and prefabricated at a workshop 80 Km. away from the site. Many of the constructional units have additional reinforcement, which can be post-tensioned after erection at the working site.La Universidad de California ha construido un garaje, de dos plantas, de hormigón pretensado, en Berkeley, que presenta la particularidad de utilizar la parte superior de su cubierta para colocar sobre ella una capa de tierra, de 0,45 metros de espesor, coronada por un manto de césped. La estructura resistente está constituida por un reticulado de vigas formando crujías de 7,30 m de luz y apoyos espaciados a 19 m. Por tanto, las losas que forman los forjados salvan una, luz de 7,30 m, mientras que las vigas forman pórticos de 19 m de luz máxima. La losa de cubierta se ha pretensado en dos direcciones normales entre sí y, como consecuencia de ello, al hallarse debidamente comprimida en el sentido de estas dos direcciones es prácticamente imposible la

  11. NUEVAS CITAS DE ASCLEPIADACEAE PARA ARGENTINA

    Directory of Open Access Journals (Sweden)

    Sergio A Cáceres Moral

    2010-11-01

    Full Text Available Dos especies no mencionadas anteriormente de la Argentina son tratadas e ilustradas: Oxypetalum molle Hook. et Arn. y Oxypetalum ineanum Fourn. Oxypetalum appendieulatum Mart. et Zucc., Oxypetalum confusum Malme, Oxypetalum jörgensenii Meyer, Oxypetalum microphyllum Hook. et Arn., Oxypetalum pannosum Decaisne, Oxypetalum stipatum Malme, Funastrum flavum (Decaisne Malme y Blepharodon lineare (Decaisne Decaisne se registran por primera vez para la flora de Corrientes ..

  12. Caso para diagnóstico

    Directory of Open Access Journals (Sweden)

    Souza Fernanda H. M. de

    2006-01-01

    Full Text Available Pseudoxantoma elástico perfurante periumbilical é distúrbio adquirido do tecido elástico, que acomete mulheres multíparas. Apresenta-se um caso dessa condição em mulher de 74 anos (G10, P10 mostrando placa amarelada de aspecto reticular com áreas constituídas por pápulas eritêmato-ceratósicas. A histologia demonstra derme reticular com fibras conjuntivas basofílicas e irregulares, além de área de hiperplasia epidérmica, com eliminação de fibras elásticas através de canal repleto de ceratina.

  13. Normas para colaboração

    Directory of Open Access Journals (Sweden)

    Helmut Renders

    2009-10-01

    Full Text Available A Caminhando é uma revista acadêmica publicada semestralmentepela Faculdade de Teologia da Universidade Metodista de São Paulo. Ela está aberta para pesquisadores/as e docentes/as da área da Teologia e das Ciências da Religião que possuam o grau de doutor ou mestre ou estejam prestes a obtê-lo.Apresentação de artigosO texto poderá ter no máximo 25.000 caracteres com espaços (digitadas em espaço duplo, fonte Times New Roman Times 12 ou equivalente, margem 2,5 cm incluindo-se notas e bibliografia. Os artigos submetidos à revista Caminhando deverão ser nacionalmente inéditos e não estar, no momento, sendo objeto de apreciação por quaisquer outros meios de publicação impressa. A página de rosto deverá conter o título do artigo,nome do autor, um resumo em português e, se for possível, também em inglês e espanhol (no máximo 250 caracteres com espaços. Como informações sobre o/a autor/a solicitamos a titulação, a ocupação e o e-mail do/ a autor/a. Os artigos serão encaminhados para um/a parecerista, com basenos quais o editor tomará a sua decisão. A remessa do artigo poderá ser feita via Internet para o e-mail helmut.renders@metodista.br, ou em CD enviado pelo correio para o endereço: Universidade Metodista – Faculdade de Teologia Helmut Renders, Editor da Revista Caminhando – Prédio Alfa – Sala 222 – Rua do Sacramento, 230 – 09640-000, São Bernardo do Campo/SP, Brasil.Normas para rodapé e referências bibliográficasAs citações devem ser inseridas no corpo do texto, seguindo as formas(Autor, ano ou (Autor, ano, página como no exemplo (WEBER, 1991, p. 95.Se houver, do mesmo autor, mais do que um título citado, deve-se acrescentar uma letra após a data, tal como no exemplo: (WEBER, 1991b, p. 32. As notas de rodapé estão reservadas para informações complementares.A bibliografia ou referências bibliográficas, quando houverem, devemser colocadas no final do texto e obedecer à norma NBR 6023

  14. Treinamento introdutório para enfermeiras dirigentes: possibilidades para gestão do SUS

    OpenAIRE

    Marisa Leal Correia Melo; Maria Ângela Alves do Nascimento

    2003-01-01

    Este artigo enfoca o Treinamento Introdutório como marco inicial do processo de capacitação para os integrantes do Sistema Único de Saúde. Toma como premissa que a prática gerencial requer a apreensão de um corpo de conhecimento presente nos micro e macro espaços de trabalho dos dirigentes. Ao articular o Treinamento Introdutório com a área de gerência, o considera estratégico para enfermeiras que assumem cargos de direção, ao constituir-se num espaço que pode oportunizar o desenvolvimento de...

  15. Actividades para el desarrollo del razonamiento matemático en estudiantes para profesor

    OpenAIRE

    Soler, María Nubia; Ávila, Juan; Fonseca, Jaime

    2009-01-01

    Este taller surge como una propuesta desde la investigación “Actividades matemáticas para el desarrollo de procesos lógicos: los procesos matemáticos de ordenar y razonar” realizada en la Universidad Pedagógica Nacional por el grupo de álgebra en la línea de investigación Currículo en matemáticas para la formación de profesores, durante los años 2007 y 2008. La intensión de este taller es que los asistentes puedan realizar algunas de las actividades planteadas en esta investigación de manera ...

  16. Algunas consideraciones para la reconstrucción del concepto de contabilidad para el presente siglo

    Directory of Open Access Journals (Sweden)

    Claudia Lucía Niño Galeano

    2003-06-01

    Full Text Available En este artículo se hace una reflexión sobre la posición de la contabilidad en el contexto actual, rescatando de manera general su evolución como disciplina y su transformación permanente. A partir de diversas definiciones sobre contabilidad se intenta resaltar los elementos que la determinan como disciplina y sus contenidos, los cuales deben responder o vincularse aún más con la realidad económica actual, caracterizada por la globalización y el impacto de los mercados financieros internacionales. En este contexto, la contabilidad debe ser flexible, tener la capacidad para responder en forma rápida a los cambios del entorno económico y tener las cualidades necesarias para informar objetivamente a los interesados.

  17. Composites de bagazo de baja densidad para partes y piezas moldeadas para la industria automotriz

    Directory of Open Access Journals (Sweden)

    Manuel Serantes

    2006-01-01

    Full Text Available Se desarrolló un composite a partir del bagazo de la caña de azúcar, con características similares a una muestra entregada por la firma FAIST GmbH& Co. K.G. de Alemania, para ser empleado en la elaboración de partes y piezas moldeadas para la industria automotriz. Se estudian diferentes grados de molida. A los composites obtenidos se le determinaron las propiedades físico-mecánicas. Se realizó un análisis visual de su aspecto físico. Se presentan los resultados obtenidos, así como conclusiones y recomendaciones.

  18. CRITERIOS PARA LA ELABORACIÓN DE MAPAS DE PROCESOS. PARTICULARIDADES PARA LOS SERVICIOS HOSPITALARIOS

    Directory of Open Access Journals (Sweden)

    Dianelys Nogueira Rivera

    2009-05-01

    Full Text Available

    Para responder a las necesidades de un entorno cambiante, se hace necesario  modificar el funcionamiento de las organizaciones, o sea, sus procesos. Ya no se piensa en diseños con una estructura inmutable con el paso de los años, sino permanentemente sometidos a revisiones, en virtud de que cada proceso de por sí es mejorable. Actualmente, las instituciones de salud luchan por incorporar herramientas y modelos de gestión como: Benchmarking, Gestión por Procesos o Reingeniería e intentan generalizar la revisión de los procesos como una práctica sistemática, que a la vez forme parte de la cultura médica. Como base para la mejora, es extendido el uso de los mapas de procesos que, a partir de varios enfoques, permiten la visualización y apreciación de las interrelaciones entre los procesos, y actividades para perfeccionar los resultados que los clientes desean. Este trabajo propone un procedimiento para la elaboración de mapas de procesos de servicios hospitalarios, a partir del análisis bibliográfico y la evaluación en la práctica social.

  19. The para-petroleum industry; L'industrie parapetroliere

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    The para-petroleum industry includes societies that realize studies and installations for the deposits exploitation. This document presents the situation of the para-petroleum industry in 2001, the world investment growth of the activity, the french societies financial results and an inventory of the main operations in the amalgamation domain. (A.L.B.)

  20. Jõhvis tuleb parasürrealistide näitus

    Index Scriptorium Estoniae

    2008-01-01

    Jõhvi kontserdimajas avatakse parasürrealistide rühmituse PARA näitus "Panoraam". Osalevad Ilmar Malin (maalid), Jüri Palm (maalid), Elo Järv (nahkskulptuurid), Vello Vinn (graafika), Leonhard Lapin (akvarellid), Enn Tegova (maalid), Ahti Seppet (puuskulptuurid), Raivo Kelomees (maalid), Kristiina Viin (joonistused ja maalid)

  1. Treinamento introdutório para enfermeiras dirigentes: possibilidades para gestão do SUS

    Directory of Open Access Journals (Sweden)

    Marisa Leal Correia Melo

    2003-12-01

    Full Text Available Este artigo enfoca o Treinamento Introdutório como marco inicial do processo de capacitação para os integrantes do Sistema Único de Saúde. Toma como premissa que a prática gerencial requer a apreensão de um corpo de conhecimento presente nos micro e macro espaços de trabalho dos dirigentes. Ao articular o Treinamento Introdutório com a área de gerência, o considera estratégico para enfermeiras que assumem cargos de direção, ao constituir-se num espaço que pode oportunizar o desenvolvimento de competência técnica, administrativa, ética e política para o exercício do cargo. No plano organizativo, o Treinamento Introdutório deve ser planejado e implementado de forma participativa e democrática, a fim de permitir ao dirigente uma compreensão ampliada do contexto em que está se inserindo.

  2. “Sexo pelo sexo” para homens e “sexo por amor” para mulheres

    Directory of Open Access Journals (Sweden)

    Luciana Zucco

    2012-04-01

    Full Text Available

     O presente trabalho analisa os discursos sobre sexo veiculados por revistas femininas e masculinas. Estudos anteriores constataram que aos avanços da condição feminina na sociedade ocidental somam-se modelos reificadores de uma ideologia normatizante das relações sexuais.  A hipótese é de que as revistas também reproduzem discursos diferenciados para homens e mulheres, reafirmando o sexismo cultural (MORAES, 2002. Foram analisadas as reportagens sobre sexo anunciadas nas capas de Nova e Men’s Health, em 2007, com base na análise de discurso (ORLANDI, 2001. Men’s Health  se dirige ao público masculino através de um discurso direto e objetivo, uma vez que sexo é culturalmente considerado “coisa de homem”.  Nova apresenta enunciados de promoção da autonomia sexual, revisitando velhos discursos. Apesar de os magazines apresentarem a lógica do sex machine  (CATONNÉ, 2001, as diferenças situam-se entre: ter prazer para conquistar e dar prazer
    para multiplicá-lo.

  3. UNA PROPUESTA EVALUATIVA PARA ACTIVIDADES DE EDUCACIÓN AMBIENTAL PARA LA SOSTENIBILIDAD

    Directory of Open Access Journals (Sweden)

    Rosa M. Medir Huerta

    2016-01-01

    Full Text Available El propósito de este artículo es presentar una propuesta evaluativa para ac - tividades de educación ambiental para la sostenibilidad en el ámbito escolar ofrecidas desde entidades externas a la escuela. Para ello, se realiza una eva - luación real de un programa educativo de una administración pública que se orienta al refuerzo del currículo de educación infantil, primaria y secundaria. El objetivo de la evaluación es diagnosticar la presencia, en las actividades estudiadas, de principios clave de la educación ambiental para la sosteni - bilidad identificados por el equipo de investigación a partir de referencias internacionales. La metodología es la investigación evaluativa de programas dentro del paradigma crítico de la investigación educativa y con herramientas de tipo cuantitativo. Se utiliza, básicamente, un cuestionario expresamente diseñado que valora la presencia y la ausencia de los principios establecidos de la educación ambiental para la sostenibilidad. Los resultados nos aportan nuevas informaciones acerca de las fortalezas y las debilidades del desarrollo de actividades de educación ambiental. Se llega a una valoración cuantificada de los principios definidos en tres grupos, según su necesidad de mejora, y se determina que los principios mejor tratados en las actividades son los que se relacionan con los contenidos disciplinares más clásicos, tratados con buenos y distintos métodos didácticos. En cambio, las debilidades detectadas se refieren a aspectos cruciales de la educación ambiental tales como experimentar nuevas sensaciones, aprender a buscar información, pensamiento crítico, sentimiento de pertenencia a un lugar, trabajo en colaboración, adquirir una visión global de la realidad, y reflexionar sobre la vida cotidiana y sobre el futuro deseado.

  4. Carriles para alta velocidad. Comportamiento en fatiga

    Directory of Open Access Journals (Sweden)

    Duart, J. M.

    2005-02-01

    Full Text Available In recent years, passanger train speed and freight train load have increased to enhance efficiency of rail road transportation. These trends have increased the severity of rail service conditions, calling for rails with greager wear resistance, strength and fatigue behavior. In the United States and Europe, track site weld rails are made entirely by alumino thermic process. This work describe the results of experimental study conducted on bending fatigue strength of plain rails and alumino thermic welded rails with preheating procedures (oxipropane and air-induced propane approved by railways authorities. Compliance with the required fatigue strength shall be ascertained by 4 point pulsating bending test in accordance with European standard by alumino thermic weld in rails. The Locati method, based in the empirical Miner's law about the cumulative damage on a fatigue tested material, allows, once known the Wohler curve of the welding process in use to settle the fatigue tensile limit at 50% with only one test. The values obtained at 2.10 cycles for plain rails (Sf = 353 MPa, oxipropane preheated aluminothermic weld rails (Sf = 225 MPa, and propane-air induced aluminothermic weld rails (Sf = 210 MPa are very similar to those resulting from test method stated in the European Standard. From our point of view and due to its ease, speediness and savings, this is the most suitable test to check the quality and compare the aluminothermic processes in use.

    En los últimos años la eficiencia de los FECC, tanto para el transporte de viajeros como de mercancías, ha experimentado un desarrollo espectacular. Ello, ha sido posible gracias, entre otros factores, a la fabricación de carriles con resistencia al desgaste, carga de rotura y resistencia a fatiga mejoradas. La soldadura de los carriles, en Europa y U.S.A. se realiza "in situ" por aluminotermia con precalentamiento de los carriles con oxipropano o propano

  5. Palladium-mediated conversion of para-aminoarylboronic esters into para-aminoaryl- 11C-methanes

    DEFF Research Database (Denmark)

    Andersen, Valdemar Lykke; Herth, Matthias Manfred; Lehel, Szabolcs;

    2013-01-01

    Cross-couplings are an alternative to conventional 11C-methylations which are generally employed in PET tracer synthesis. Therefore, we set out to develop a general procedure for the synthesis of para-11CH3 labeled aromatic amines from the corresponding para-aminoarylboronic esters in the presence...

  6. Fontes: dois contextos expositivos para a incomensurabilidade

    Directory of Open Access Journals (Sweden)

    Elisa de Sousa Martinez

    2008-11-01

    Full Text Available O significado da obra de arte é construí­do na relação que esta estabelece com o contexto em que é exposta e com as obras com as quais constitui um percurso perceptivo, sensí­vel e cognitivo. Utilizam-se os princí­pios teóricos da semiótica discursiva para construir uma análise na qual, ao mesmo tempo em que é considerada a localização imanente do ponto de partida de um percurso de geração de sentido, na estrutura da obra Fontes, de Cildo Meireles, exposta em dois eventos artí­sticos diferentes, identificam-se figuras e temas que participam de uma rede que a interliga a outros textos e seus respectivos potenciais significativos. As escolhas dos curadores inserem a obra em contextos situacionais no quais o seu sentido é apreendido e, também, contribui para a produção de sentido de um texto que o engloba. Palavras-chave arte contemporânea, instalação, semiótica visual Abstract The meaning of a work of art is produced by the relationship established within the context of the exhibition, as well as with the other works with which it builds the one sensitive and cognitive course. Based on the Semiotics of A.J. Greimas we present an analysis of Cildo Meirele's Fontes, a work exhibited in two different events, revealing its common figures and themes. We consider not only the immanent structure of the meaning in an artistic text, but also its connection to other texts and the potential meanings that emerge from them. The choices made by a curator have the potential to insert the artwork in a situational context in which its meaning is captured and this contributes to the global perception of the text/exhibition in which it is presented. Key words contemporary art, installation art, visual semiotics

  7. Macros y atajos para el traductor

    Directory of Open Access Journals (Sweden)

    José Luis Heredero

    2007-06-01

    Full Text Available Sin necesidad de recurrir a los productos comerciales de ayuda a la traducción que se han ido generalizando en muchas grandes empresas y organizaciones, el traductor independiente puede ver considerablemente facilitado su trabajo si sabe explotar las muchas posibilidades que brindan Visual Basic y otros lenguajes poco conocidos de dominio público. Se presentan aquí varias macros de Word y pequeñas aplicaciones desarrolladas en los últimos años para acelerar tanto las búsquedas de términos —basadas fundamentalmente en el uso de Access, dtSearch y Google— como el manejo de los textos, con las instrucciones necesarias para descargar e instalar el material de forma gratuita. Se hace referencia además a otros productos similares que pueden hallarse en la web y que responden al mismo planteamiento de fondo aquí expuesto, que privilegia la simplicidad, la intercambiabilidad y la adaptación a las verdaderas necesidades del usuario, en contraposición a la creciente «featuritis» de los productos que compiten en el mercado. --------------------------------------------------- Macros and shortcuts for translators. Freelance translators can facilitate their work considerably if they know how to take advantage of the many possibilities offered by Visual Basic and other less well-known programming languages in the public domain, without resorting to commercially available translation aids that have become commonplace in many large companies and organizations. This article describes a number of Word macros and applets developed in recent years to accelerate both term searching —based mainly in the use of Access, dtSearch and Google— and text management, and provides instructions for downloading and installing the freeware. I also mention similar products available on the Internet which are based on the same fundamental principles noted in this article, i.e., the precedence of simplicity, interchangeability, and adaptability to the user

  8. Aprendizaje y conocimiento para innovar y emprender

    Directory of Open Access Journals (Sweden)

    López de Silanes, José Luis

    2011-12-01

    Full Text Available Learning and the creation of knowledge are closely related to improved competitiveness and the creation of wealth in a country, because they help to boost innovation and the development of more productive activities with higher added value by taking advantages of the opportunities offered by the new technologies. Spain, which has made a significant effort during the last 30 years and has managed not only to position itself in ninth place among the countries with the highest scientific production, but also among the major world economies, has lost momentum in recent years, which is why it needs to improve its competitive capacity. In order to achieve this, an appropriate environment must be generated through promoting the innovative capacity of all the institutions involved and improving the quality of education, as well as the conditions required for facilitating the free movement of knowledge. In this context, the Spanish university still has an important task before it in terms of improving optimization of the use made of its educational resources and scientific production, as well as the continuous updating of knowledge and promotion of the entrepreneurial ability of young university students, with the assistance of society as a whole.

    El aprendizaje y la creación de conocimiento están estrechamente relacionados con la mejora de la competitividad y la creación de riqueza de un país, porque contribuyen a potenciar la innovación y el desarrollo de actividades más productivas y de mayor valor añadido aprovechando las oportunidades que brindan las nuevas tecnologías. España, que ha realizado un importante esfuerzo durante los últimos 30 años, y ha logrado situarse entre las principales economías del mundo, ha perdido posiciones en los últimos años, por lo que necesita mejorar su capacidad competitiva. Para lograrlo, es necesario generar un entorno adecuado mediante el fomento de la capacidad innovadora de todas las

  9. Para além da linhagem

    Directory of Open Access Journals (Sweden)

    Maria Joana GOMES

    2011-03-01

    Full Text Available A subida de Urraca I (1109-1126 ao trono do reino de Leão e Castela como sucessora de Afonso VI (1072-1109 representou, como atestam vários testemunhos escritos, um acontecimento problemático para os seus contemporâneos. Consoante a posição que assumem perante este facto, os textos historiográficos peninsulares não deixaram de fornecer argumentos e justificações que favoreciam ou que, pelo contrário, atacavam o papel da filha de Afonso VI. Partindo da análise do catálogo das mulheres de Afonso VI em dois desses textos -O Chronicon Regum Legionensium e o Liber Regum Villarensis-, este artigo procura problematizar não apenas o lugar de Urraca no quadro genealógico das mulheres e da descendência de Afonso VI, mas também avaliar de que modo estas relações genealógicas são apresentadas por cada um destes textos, para legitimar ou denegrir a rainha de Leão e Castela e, através dela, a dinastia a que esta pertence.Comme on le constate à travers plusieurs témoignages écrits, l’accession au trône de León et Castille d’Urraque (1109-1126, succédantà Alphonse VI (1072-1109, fut perçue par ses contemporains comme un fait de nature problématique. Selon la position qu’ils adoptent, les textes historiographiques hispaniques fournissent autant d’arguments et de justifications favorables ou hostiles au rôle politique de la fille d’Alphonse VI. À partir de l'analyse de la liste des femmes d’Alphonse VI dans le Chronicon regum Legionensium de Pélage d’Oviedo et du Liber regum Villarensis, cet article s’intéresse non seulement à la place d’Urraque dans la généalogie des femmes et de la descendance d’Alphonse VI mais tente aussi de montrer comment ces relations généalogiques sont présentées dans chacun de ces textes afin de légitimer ou discréditer la reine de Léon et Castille et, à travers elle, sa propre dynastie.

  10. Aditivos para hormigones, morteros y pastas

    Directory of Open Access Journals (Sweden)

    Gaspar Tebar, Demetrio

    1984-09-01

    Full Text Available This article comments on the increasing importance of the use of admixtures for concrete, mortars and grouts as well as the specific effects they produce, thus requiring a suitable Spanish Normative, whose performance was taken in charge by a Working Group of the Technical Commission n.° 83 from the IRANOR, created for this purpose. This article is first of a series which intends to give an account of the works, on the Normative of those additives, the Working Group is carrying out.

    En el presente artículo se comenta la importancia que ha adquirido el empleo de los aditivos para hormigones, morteros y pastas, así como las modificaciones y efectos específicos que producen, lo que ha motivado la necesidad de contar con una normativa española apropiada, cuya realización se encomendó a un Grupo de Trabajo, creado al efecto, de la Comisión Técnica n.º 83 del IRANOR. Este artículo es el primero de una serie en la que se pretende dar cuenta de los trabajos que sobre normativa de los mencionados aditivos se viene realizando por dicho Grupo de Trabajo.

  11. Residencia para ancianos. Waiblingen - Alemania Federal

    Directory of Open Access Journals (Sweden)

    Kammerer, H.

    1972-05-01

    Full Text Available The action of Caritas makes it possible for the elderly to carry on their normal lives within a community adapted to their habits and necessities, enabling them at the same time to retain their independence and privacy. This building, with all the progress the present moment allows, satisfies the outlined plan perfectly lt is built partly of unfaced and partly of prefabricated concrete. It includes all facilities, 74 single rooms, 12 double rooms and 3 apartments. The nuns' area, with a capacity for 22 sisters, works independly but with adequate communication.La actuación de Caritas hace posible que personas de edad avanzada puedan realizar su vida normal en una comunidad adaptada a sus costumbres y necesidades, al mismo tiempo que conservar su independencia y su intimidad personal. Este edificio, con todos los adelantos que proporciona el momento actual, cumple perfectamente el plan descrito. Parte es de hormigón visto y parte prefabricado. La residencia comprende todos los servicios, 74 habitaciones individuales, 12 dobles y 3 apartamentos. La zona de religiosas, capaz para 22 hermanas, funciona independiente, pero con la adecuada correlación.

  12. para celdas de combustible de etanol

    Directory of Open Access Journals (Sweden)

    CARLOS MONSALVE GIL

    2008-01-01

    Full Text Available En este trabajo se elaboraron dos membranas nanocompuestas de Nafion®- TiO2 con 2 y 4% del cerámico por el método del “recasting”. El análisis de composición del microscopio de barrido electrónico (SEMEDS mostró una estructura de dos capas, una enriquecida en cerámico y otra con menos cantidad, pero con dispersión uniforme. Se midió la velocidad de permeación de etanol y la absorción de solventes en estas membranas a diferentes temperaturas y concentraciones y los resultados fueron comparados con los obtenidos para la membrana de Nafion® sin modificar. Los resultados experimentales mostraron un incremento de la permeación y de la absorción de solvente con la concentración de etanol y la temperatura. La absorción de agua también mostró un incremento en las membranas compuestas lo cual puede permitir operar a mayores temperaturas y menores humedades relativas y aumentar el desempeño de la celda de combustible.

  13. Guía para autores

    Directory of Open Access Journals (Sweden)

    John Harold Estrada Montoya

    2015-08-01

    Full Text Available La Revista Acta Odontológica Colombiana, es una publicación electrónica seriada, semestral y arbitrada, editada desde la Facultad de Odontología de la Universidad Nacional de Colombia, dirigida a académicos, investigadores y profesionales interesados los temas actuales y los resultados de la actividad científica e investigativa en odontología. Filosofía y política editorial La Revista Acta Odontológica Colombiana tiene como objetivo publicar resultados o avances de investigación promotores del desarrollo de conocimientos académicos, técnicos, científicos y éticos para la odontología y la salud bucal, relacionados con aspectos de la práctica clínica, salud pública, bioética, educación, ciencias básicas, biotecnología, materiales dentales y de laboratorio. Asimismo tiene como propósito consolidar el intercambio de saberes, experiencias e investigadores en el área de la salud, en general, y de la odontología, en particular, a nivel nacional e internacional. 

  14. Kara para aklamayla mücadele

    OpenAIRE

    Aydınşakir, Esen

    2008-01-01

    Kara para aklayıcılar devletin, toplum düzeni içinde koyduğu yasaları hiçe sayarak toplum düzenini bozmakta, devlete ve vatandaşlara zarar vermektedir. Kara paranın varlığı ekonomik göstergeleri çarpıtmakta, ülke içindeki rekabet ve devlet bütçesini olumsuz yönde etkilemekte, kayıt dışı ekonominin büyümesine neden olmakta, beklenmedik anlarda ülkeye giriş-çıkış yaptığı için döviz kurunda ve fiyatlarda istikrarın yakalanmasının zorlaşması gibi devlete ve topluma birçok zararı vardır. Bu nedenl...

  15. Biblioteca y residencia para estudiantes - Viena (Austria

    Directory of Open Access Journals (Sweden)

    Lippert, G.

    1972-02-01

    Full Text Available The recently completed Municipal Library of Vienna, includes the lending of books, reading rooms, information services, children's library, municipal library and lecture rooms. The hostel Adolf Schärf «Vindobona» is a tall building, of 33 m height, which in addition to many rooms for the communal life of students, has 54 double bedrooms, and 147 single rooms, equipped with standards of comfort comparable to those of an hotel, since the hostel is used by students in winter, and as an hotel in the summer.El conjunto terminado Casa del Libro-Biblioteca Municipal de Viena alberga los servicios de autoalquiler, salas de lectura, información, biblioteca infantil, biblioteca municipal, salas de conferencias, etc. La Residencia Hogar Adolf Schärf «Vindobona» es una torre de 33 m de altura que, además de los numerosos locales para el desarrollo de la vida en común de los estudiantes, alberga 54 habitaciones con dos camas, y 147 sencillas, equipadas todas ellas a escala hotelera, dado que el hogar es explotado por los mismos estudiantes como tal hotel durante las vacaciones.

  16. Testes de racionalidade para loterias no Brasil

    Directory of Open Access Journals (Sweden)

    Marcos A. M. Lima

    2006-06-01

    Full Text Available O artigo investiga a prevalência de expectativas racionais no caso de duas loterias brasileiras (Quina e Mega-Sena. A estratégia de teste se relaciona com uma condição de ortogonalidade entre o erro condicional de previsão e o conjunto de informação. Especificamente, o resíduo de uma equação para o preço líquido de um bilhete de loteria deveria ser não correlacionado com as vendas. Os resultados favoreceram a hipótese de expectativas racionais somente no caso da Mega-Sena que é sujeita a ampla cobertura da mídia. Claramente a Quina está associada a um perfil distinto de apostadores.The paper investigates the prevalence of rational expectations in the case of two Brazilian lotteries (Quina and Mega-Sena. The testing strategy relates to an orthogonality condition between the conditional forecast error and the information set. Specifically, the residual of a equation for net price of a lottery ticket should be uncorrelated with sales The results favoured the rational expectations hypothesis only in the case of the Mega-Sena that is subject to broad media coverage. Clearly the Quina lottery is associated with a diferent profile of betters.

  17. Bolonia, una oportunidad para el derecho deportivo

    Directory of Open Access Journals (Sweden)

    Francisco de la Torre Olid

    2011-01-01

    Full Text Available El nuevo panorama universitario, adaptado al Plan de Bolonia, ha exigido una revisión de estudios de larga tradición como son los de Derecho y este momento ha permitido implantar unos nuevos planes en los que el Derecho del deporte tiene un espacio. Este estudio razona sobre la importancia de esta materia por la consideración de su contenido interdisciplinar, que ejercita en la visión unitaria del Ordenamiento, y por la realidad tan universal que acota, que hace necesario su conocimiento por el jurista, que es un profesional llamado a intervenir en la sociedad e implicarse en lo que ésta se proyecte. Se muestra una experiencia para dibujar, desde la UCAM, un itinerario procedimental y una realidad universitaria que puede inspirar otras iniciativas académicas, con el compromiso con el Derecho deportivo que familiariza con el deporte y contribuye a su fomento; además de exigir estar a resultas de la actualización de un Derecho que, al ser novedoso en su relevancia jurídica, se ha de seguir completando y consolidando.

  18. Una arquitectura basada en software libre para archivos web

    Directory of Open Access Journals (Sweden)

    Mercy H. Ospina Torres

    2013-04-01

    Full Text Available Los archivos web son sistemas de información que se han venido desarrollando desde finales de los años 90 para llevar a cabo la preservación histórica del patrimonio web como parte del patrimonio digital de la humanidad. Tales archivos han tenido que afrontar ciertos desafíos propios de los recursos web, como son el tamaño de la web y su naturaleza cambiante, las tecnologías asociadas a la web, la web superficial y la web profunda, la organización de la web en dominios, entre otros. Debido a ello, se ha hecho necesario proponer arquitecturas, técnicas, herramientas y estándares para las diferentes funcionalidades de un archivo web que permitan afrontar de manera eficaz dichos desafíos. Este trabajo tiene como objetivo establecer una arquitectura basada en software libre para un prototipo de archivo web. Para ello se hace una revisión detallada del dominio de archivo web, de sus funciones y de los enfoques usados hasta el momento para llevarlas a cabo. Se presenta un estudio comparativo entre diferentes iniciativas de preservación web a nivel mundial y se establecen los componentes para un sistema para la preservación web basada en software libre.

  19. Matthew Lipman y Paulo Freire: Conceptos para la libertad

    Directory of Open Access Journals (Sweden)

    Stella Accorinti

    2002-01-01

    Full Text Available M. Lipman y P. Freire son dos pensadores comprometidos con las prácticas de la libertad. Para ellos libertad es libertad para aprender a pensar y a ser en comunidades de diálogo, de indagación, de investigación. Es el proyecto que lleva a los seres humanos al conocimiento de sí mismos y al re-conocimiento de los otros. Sin libertad no hay posibilidades existenciales para nuestra humanización. En este trabajo se estudian las propuestas que ambos filósofos proponen para una educación y una pedagogía del aprender a ser libres. Para esto se requiere, según Lipman, desarrollar un pensamiento mutidimensional (creativo, flexible, amplio, abierto, lleno de recursos, complejo, estimulante, que se opone al pensamiento simplificador. Pensar también es filosofar, eso justifica por qué para Lipman se debe hacer filosofía para niñ@s. Por su parte, Freire entiende que el derecho a una educación en libertad es lo que permite resistir y superar cualquier tipo de opresión.

  20. Desarrollo de un simulador de un SAR para misiones espaciales

    OpenAIRE

    Flores de la Cruz, Adrián

    2014-01-01

    El descubrimiento, de los sistemas SAR (Synthetic Aperture Radar o Radares de apertura sintética), lógicamente, tuvo lugar con posterioridad al desarrollo y operación de sistemas básicos de radar más sencillos como fueron los terrestres (para detección de blancos en movimiento) y los embarcados en aeronaves (para mapeo del terreno). En la actualidad, los modernos sistemas radar (tipo SAR), ya son embarcados en satélites (artificiales) para aplicaciones de observación, tanto de la Tierra co...

  1. Sistema Inteligente para el álgebra lineal

    OpenAIRE

    Casas, Laura; Pérez, Olga; Docampo, Lisandra; Mota, Yailé; Coello, Lenniet; González, Isabel; Martín, Ángela

    2013-01-01

    El trabajo describe la concepción del Sistema Inteligente para el Algebra Lineal (SIAL), el cual fue creado por los autores de la investigación. Sus fundamentos teóricos están relacionados con las técnicas de Inteligencia Artificial para clasificar, utilizando el clasificador k-vecinos más cercanos K-NN (Caballero, 2010), así como los cinco problemas tipos del Álgebra Lineal (Yordi, 2004). El SIAL se creó con el objetivo de apoyar al estudiante durante su estudio independiente para brindarle ...

  2. Un aprendiz estratégico para una nueva sociedad

    OpenAIRE

    Bernardo GARGALLO LÓPEZ

    2012-01-01

    Nuevos tiempos precisan de nuevos aprendices. En una escuela inmersa en la sociedad de la información, que queremos que sea del conocimiento, hace falta desarrollar nuevas actitudes y habilidades para el aprendizaje. El estudiante ha de aprender a desarrollar su autonomía y responsabilidad en un mundo abierto en que hay sobreabundancia de información y estímulos. Para ello hace falta que el estudiante llegue a ser “aprendiz estratégico”, una persona autónoma que quiere aprender para crecer, p...

  3. Una red de sensores para las Smart Cities

    OpenAIRE

    Paz Teixeira, José Olavo da

    2015-01-01

    El objetivo del trabajo fin de Master consiste en el estudio de redes de sensores inalámbricos para las Smart Cities. En particular, se implementa una red inalámbrica (tecnología ZIGBEE como protocolo de comunicación inalámbrica con micrófonos como sensores, para recolectar niveles de ruido. Hemos elegido el Arduino como plataforma de cálculo para controlar cada nodo, y XBee como módulos de comunicación inalámbrico. La red sensorial cuenta con tres nodos sensores que capturan el ruido y lo en...

  4. Entorno virtual educativo para cursos de EaD

    OpenAIRE

    Dans, Marta Isabel; Gómez, Ana María

    2007-01-01

    El proyecto actual denominado “Entorno virtual Educativo para cursos de EaD” forma parte del programa “Innovación Educativa en la Facultad de Ciencias Económicas”. Los objetivos que se prevén alcanzar son: a) definir la plataforma virtual para los cursos de educación a distancia que se ajuste a las necesidades de la Facultad de Ciencias Económicas (FCE) de la UNPSJB. b) continuar con la aplicación de las distintas metodologías generadas en proyectos anteriores para creación de materiale...

  5. Métricas para medir la calidad de portales web

    OpenAIRE

    Laritza Santos Álvarez

    2011-01-01

    El trabajo define un conjunto de métricas web para evaluar  la calidad de los portales desarrollados en  la Universidad de las Ciencias Informáticas (UCI). Para esto fue necesario desarrollar investigación acerca de la aplicación de métricas web en la universidad, mediante la aplicación de una encuesta a un conjunto de líderes de proyectos demostrando con los resultados obtenidos la necesidad de conocer y aplicar métricas para medir los diferentes factores de calidad presentes en los portales...

  6. Una propuesta de aprendizaje universitario con TIC para recursantes

    OpenAIRE

    Aveleyra, Ema Elena; Dadamia, Danilo; Racero, Diego

    2014-01-01

    En el Laboratorio de Entornos Virtuales de Aprendizaje (LEVA) de la Facultad de Ingeniería de la Universidad de Buenos Aires (FIUBA) se desarrolla, desde el año 2006, un proyecto de investigación y desarrollo para incluir las TIC en la formación profesional, con el propósito de mejorar y personalizar la enseñanza. En el marco de la investigación-acción se implementa un curso semipresencial para recursantes en la asignatura Física I. Con dicho curso, el primero para el grado implementado en la...

  7. MODELO HOLÍSTICO PARA LA GESTION DEL CONOCIMIENTO

    OpenAIRE

    Estelio Angulo; Miguel Negrón

    2008-01-01

    La investigación tiene como objetivo lograr un Modelo para la Gestión del Conocimiento aplicado en las organizaciones que consideren la inteligencia de sus empleados como un activo intangible. Se aplica una metodología analítica explicativa para estudiar los modelos propuestos por algunos autores para propone un nuevo modelo de gestión del conocimiento. El Modelo que se propone tiene el siguiente sistema: Socialización, Creación. Difusión y Aplicación.

  8. Motor de inteligencia artificial para un juego de Mus

    OpenAIRE

    Barrera Juez, Julio Carlos; Romero de Tejada Muntaner, Guillermo

    2008-01-01

    Mediante este trabajo emulamos un jugador humano mediante un motor de inteligencia artificial, capaz de jugar al mus e intentar ganar a cualquier jugador. Para ello nos basaremos en un estudio teórico del juego para establecer las probabilidades de cada una de las jugadas. Esto nos permitirá establecer una estrategia de juego para cada tipo de motor de inteligencia artificial. Debido a la complejidad del estudio teórico hemos realizado un estudio estadístico que complementa y amplía el ...

  9. Plano de Marketing para a iSURF Academy

    OpenAIRE

    Antunes, Ana Maria Pereira

    2015-01-01

    Mestrado em Marketing O presente trabalho tem por objetivo a elaboração de um plano de marketing para a iSURF Academy. Sendo uma microempresa, criada em 2012, sem um plano de marketing, este projeto tem como finalidade planear um conjunto de ações de forma a ajudar a escola a melhorar os 7 P?s do marketing mix. Para atingir este objetivo, privilegiou-se a research como metodologia de investigação. Para informação mais detalhada sobre a escola fizeram-se entrevistas semiestruturadas aos ...

  10. Proyecto de Instalaciones de Telecomunicaciones para Edificio de Viviendas

    OpenAIRE

    LÓPEZ OLIVER, ENRIQUE

    2016-01-01

    [ES] En este proyecto se realizara un diseno y despliegue de red para proporcionar servicios de telefonia, television y/o datos en un edificio consistorial. Se hara uso de la normativa de ICT (RD 346/2011) para la realizacion del trabajo fin de grado. Se trabajara con AUTOCAD en el tratamiento y elaboracion de los planos del proyecto. López Oliver, E. (2015). Proyecto de Instalaciones de Telecomunicaciones para Edificio de Viviendas. http://hdl.handle.net/10251/62837. TFGM

  11. Interfaces amigables para la gestión de procesos

    OpenAIRE

    Osácar Landa, Leticia

    2010-01-01

    El objetivo principal de este proyecto se centra en el desarrollo de una interfaz gráfica intuitiva para el usuario, mediante la cual se gestionarán diferentes tipos de procesos que veremos plasmados en una pantalla. El proyecto ha sido estructurado en 3 etapas: Etapa 1: Dado que parte de las herramientas que hemos utilizado para la programación de la aplicación no eran conocidas (WPF, XAML, C#), hemos tenido que leer varios manuales y tutoriales para aprender a manejar las mismas. ...

  12. PERFIL PARA REPRESENTAR UNA ARQUITECTURA DE COMPONENTES EN UML

    Directory of Open Access Journals (Sweden)

    Fernando Orejas Valdés

    2006-04-01

    Full Text Available

    El lenguaje unificado de modelado (Unified Modeling Language, UML es un lenguaje de modelado estándar para problemas generales, sin embargo, es necesario extenderlo para dominios específicos como puede ser el caso de determinadas arquitecturas. Aquí se presenta una extensión mediante un perfil para una arquitectura de componentes y conectores genéricos.

  13. Carretilla para transporte de bombonas de gases B50

    OpenAIRE

    Arias Moldón, Carlos

    2008-01-01

    En este proyecto se ha realizado el diseño y posteriores cálculos, de una alternativa a las actuales carretillas utilizadas para transporte de las bombonas de gases del tipo B50, especialmente para el ámbito hospitalario, con la intención de reducir esfuerzos del operario durante la manipulación de la bombona, y a su vez, reducir los ruidos generados al efectuarse más suave que con la carretilla actual. Se han barajado varias ideas para lograr tal efecto, basadas en la reducció...

  14. Software para generación de cuestionarios

    OpenAIRE

    Banco Interamericano de Desarrollo (BID); Departamento Administrativo Nacional de Estadística (DANE)

    2008-01-01

    La presentación muestra el sistema informático completo y los procesos utilizados por el Departamento Administrativo Nacional de Estadística de Colombia para el relevamiento y procesamiento de datos y para la generación de información. Luego, se describe en detalle y a través de capturas de pantalla las características y funcionalidades del software para la gestión de los datos (GEA) que permite generar cuestionarios automatizados.

  15. Diagnóstico y plan de mejoramiento para Clonhadas

    OpenAIRE

    2012-01-01

    En este trabajo, se realizó un diagnóstico organizacional para la empresa Clonhadas, haciendo uso del Modelo de Modernización para la Gestión de organizaciones M.M.G.O., analizando cada uno de los componentes del mismo, determinando potencialidades y problemas, los cuales se han ordenado de acuerdo con su prioridad de solución (alta, media o baja). Adicionalmente se presenta el análisis del entorno en el cual opera la empresa, aplicando para este análisis el Modelo de las Cinco Fuerzas de Po...

  16. Herramienta para la estratificación de municipios en zonas de riesgo para la salud

    OpenAIRE

    López Caviedes, Marco Antonio

    2004-01-01

    El programa "Atención Integral" de los Servicios de Salud de Hidalgo (SSH) está enfocado a reducir los niveles de enfermedad de las diferentes localidades que integran al Estado de Hidalgo, con un presupuesto autorizado limitado. Para realizar este trabajo, se determinaron cuáles de los 84 municipios que conforman el Estado de Hidalgo presentan los mayores índices de rezago en atención a la salud, carencia de recursos y marginalidad. Obteniendo una estructuración (agrupamiento) en cuatro zona...

  17. Sanatorio para la infancia, en Munich

    Directory of Open Access Journals (Sweden)

    Haind, Friedrich F.

    1964-10-01

    Full Text Available The main objects to be met in the design this Children's Building were to provide suitable control and protection of the children, adequate working conditions for the nurses, and develop a pleasant family environment. This clinic is an extension of that run by the Sisters of Saint Benedict in Lechnerstrasse, Munich. It consists of two blocks, of 4 and 5 floor levels. It has a semibasement, housing the services, and some spare rooms and other facilities, described in the enclosed plans. The ground floor provides room for 25 beds, for the older boys. On the second floor there are 30 beds for those recently born, whilst the third floor has space for 30 beds for prematurely born babies. The nurses live in the attic, where there are 15 bedrooms, each with two beds, a kitchen and suitable auxiliary facilities. Much thought has been given to the design of details, the general distribution and circulation system has been planned with much care, and the overall functional efficiency of the building as a children's clinic has been kept a paramount factor. All this makes this building an outstanding one among those of this type.Los objetivos principales perseguidos aquí son: conseguir una eficaz vigilancia y protección de los niños; organizar los puestos de trabajo de las enfermeras para que resulten prácticos y agradables, y crear un ambiente familiar La clínica construida —como ampliación de las instalaciones que las Hermanas de San Benito poseen en la calle Lachner, en Munich— comprende dos cuerpos de edificio unidos, de 4 y 5 plantas de altura, respectivamente, y está distribuida del siguiente modo: el semisótano aloja, además de la zona de servicios, una serie de dependencias, que vienen descritas en la respectiva documentación gráfica. La planta baja alberga 25 camas; está destinada a los niños mayores y colegiales; la planta primera, con 30 camas, a los recién nacidos, y la planta segunda, con 30 camas, a la sección de prematuros

  18. Deporte para la guerra, versus deporte para la paz. Reflexiones sobre el carácter educativo del deporte

    OpenAIRE

    Zagalaz Sánchez, María Luisa; Romero Granados, Santiago

    2002-01-01

    En este artículo se trata de suscitar el debate entre el deporte para la guerra o deporte para la paz, entre el deporte competitivo y el deporte educativo, entre el deporte extraescolar y el deporte escolar, entre el deporte de espectador y el deporte de acción. Basándonos en el sistema educativo español que declara como fines de la educación, entre otros, la formación para la paz, la cooperación y la solidaridad entre los pueblos, lo cual creemos posible a través d...

  19. Máquina para la producción de tiras adhesivas para la protección de heridas

    OpenAIRE

    Vives Bosch, Cinto

    2004-01-01

    Las tiras adhesivas continuas para la protección de heridas representan entre un 40% y 43% de la producción total de apositos para la protección de heridas. El resto de las ventas esta formado por los strips individuales. Así pues, se ha creído oportuno introducir unas mejoras en este tipo de máquina. En este proyecto se presenta las diferentes modificaciones de una máquina para la producción de tiras adhesivas. Dichos cambios se realizaran con el fin de obtener una mayor seguridad y ca...

  20. Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales

    OpenAIRE

    Cobo, Pedro; Varela-Nieto, Isabel; Murillo-Cuesta, Silvia; Cediel, Rafael

    2008-01-01

    Procedimiento para diseñar una cámara acústica reverberante para ensayos auditivos con animales. El objeto principal de la presente invención es procedimiento para diseñar una cámara acústica reverberante de dimensiones (L1, L2, L3) cuyo campo acústico sea homogéneo espacial y espectralmente; las operaciones del procedimiento son: elegir una de las dimensiones L3; obtener las funciones (valor medio del campo acústico) y (desviación cuadrática media del campo acústico);...

  1. Guide for evaluation of a new operation cycle of the CNLV; Guia para la evaluacion de un nuevo ciclo de operacion de la CNLV

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez V, J.A.; Vargas E, S. [IPN, ESFM, Av. IPN s/n Col. Lindavista, 07738, Mexico D.F. (Mexico)]. e-mail: govaj666@hotmail.com

    2007-07-01

    The fuel reload of the Laguna Verde Nucleo electric Central (CNLV), it is carried out with a frequency of 12 or 18 months. This reload implies modifications to the core configuration, reason for the one which the Federal Commission of Electricity (CFE), it should demonstrate to the National Commission of Nuclear Safety and Safeguards (CNSNS) that the new configuration of the core is safe during the whole operation cycle and therefore it doesn't represent any risk for the safety of the facilities, of the personnel, of the public in general, as well as for the environment, fulfilling this way the established requirements of safety in the regulator frame imposed by the CNSNS to the CNLV. The form in that the CFE demonstrates to the CNSNS that the new configuration of the core is safe, is by means of a safety analysis carried out by the fuel supplier, the General Electric company (GE). In this work a guide that describes in a structured way the steps to continue on the part of the personnel of the Department of Evaluation (DE) of the Nuclear Safety Management (GSN) of the CNSNS to evaluate a new operation cycle of the CNLV is presented. This Guide is applicable to the two units of the CNLV and as an exercise of application of the same one, it is carried out the evaluation of the Cycle 9 of the Unit 2 of the CNLV, which had been evaluated previously by the personnel of the DE. (Author)

  2. UTILIZANDO O MÉTODO TODIM PARA AVALIAR AS MELHORES EMPRESAS PARA TRABALHAR

    Directory of Open Access Journals (Sweden)

    Renato Teixeira da Silva

    2011-06-01

    Full Text Available Este artigo expõe uma nova proposta de ordenação das 5 melhores empresas para trabalhar em termos de qualidade do ambiente de trabalho e qualidade na gestão de pessoas utilizando-se do método TODIM como suporte científico para tal. A ordenação inicial, proposta pela revista Você/SA Exame, utiliza como método classificador o índice de felicidade no trabalho, uma soma ponderada de índices resultantes da percepção dos funcionários, das práticas da empresa e da constatação feita por jornalistas em visitas às empresas. Este trabalho, que utiliza o método TODIM, considera esses itens como critérios de avaliação e realiza uma análise comparativa das alternativas. Ao final, é executada uma comparação entre as ordenações e uma análise de sensibilidade, analisando as especificidades de cada método de ordenação e a consistência de seus resultados.

  3. Para uma sociologia do carisma na atualidade: ensaio para leitura do carisma de Samora Machel.

    Directory of Open Access Journals (Sweden)

    Hélio Bento Maúngue

    2014-07-01

    Full Text Available http://dx.doi.org/10.5007/1806-5023.2014v11n1p91   O presente artigo é uma analisa sobre os usos e apropriações feitas da personalidade e qualidades carismáticas de Samora Machel. Pretendemos demonstrar que depois de morto o seu carisma prevalece e perdura no cotidiano, bem como que a relação emocional entre o líder e o povo continua. Apontamos que, nos dias atuais políticos, artistas, bem como cidadãos em geral fazem uso e apropriam-se, de modo racional e calculista, do carisma samoriano para obter benesses. Apontamos também que ainda hoje é Samora que as pessoas apelam e chamam para a resolução da grande maioria dos problemas da sociedade moçambicana. Assim, desencadeia-se um uso e apropriação político, socioeconômico e sociocultural do carisma samoriano. Tal uso e apropriação tornam o carisma um fenômeno objetivado e rotinizado.

  4. Diez consejos para prevenir infecciones durante el embarazo

    Centers for Disease Control (CDC) Podcasts

    2007-12-14

    Este podcast ofrece 10 consejos para prevenir infecciones durante el embarazo.  Created: 12/14/2007 by National Center for Birth Defects and Developmental Disabilities (NCBDDD).   Date Released: 2/27/2008.

  5. Preparando um ambiente de desenvolvimento para a plataforma android

    Directory of Open Access Journals (Sweden)

    Felipe Pires de Oliveira

    2015-12-01

    Full Text Available Este artigo descreve as etapas para a criação de um ambiente de desenvolvimento para a plataforma Android. O artigo foi dividido em quatro partes: Primeiro uma introdução sobre o assunto. Na segunda seção são mostrados os passos necessários para a configuração do ambiente de desenvolvimento. Na terceira seção, é demonstrado como criar uma aplicação para dispositivo Android que calculo Índice de Massa Corporal (IMC. A quarta seção apresenta as considerações finais. A solução abordada tem como base a IDE Eclipse e o SDK do Android, bem como o Kit de Desenvolvimento Java da Oracle (JDK.

  6. Linux embebido en FPGA para sistemas de monitoreo industrial

    Directory of Open Access Journals (Sweden)

    José F. Carmona Martínez

    2013-03-01

    Full Text Available Actualmente la obtención en FPGA (Field Programmable Gate Array de módulos independientes para aplicaciones específicas de monitoreo industrial, ha hecho que su reutilización e integración sea compleja y que los tiempos de desarrollo y puesta a punto de los mismos sean considerablemente elevados. En este trabajo se propone una solución a este problema basada en embeber Linux en un FPGA, específicamente utilizando el kit Spartan3AN. Las herramientas de codiseño hardware/software utilizadas para lograr este objetivo han permitido tener resultados a corto plazo, que indican el enfoque para futuras investigaciones. De manera que se logró ejecutar aplicaciones de uso general para el control de ip-cores empotrados en hardware reconfigurable. La plataforma obtenida es estable y flexible a futuras implementaciones tanto de software como de hardware.

  7. Maquinaria ligera para estabilización de suelos

    Directory of Open Access Journals (Sweden)

    Chinchilla, M.

    1962-09-01

    Full Text Available El empleo de maquinaria pesada para trabajos de estabilización de suelos, tropieza a veces con dificultades, inherentes a las condiciones económicas, a limitaciones de movilidad, etc.

  8. Terceiro trimestre de gravidez: conhecimentos para o nascimento. Resultados preliminares.

    OpenAIRE

    Azevedo, Ana; Gomes, Maria José; Galvão, Ana Maria

    2013-01-01

    A gravidez é um período na vida da mulher em que esta se encontra ávida de saber, para se preparar física, psicológica e socialmente para o parto e para a maternidade. Esta é entendida pelos investigadores como uma fase de intensa aprendizagem. Os Enfermeiros Especialistas de Saúde Materna e Obstétrica em Portugal nos cursos de preparação para o nascimento acompanham a grávida e ministram-lhe a formação adequada que lhes permita vivenciar de forma equilibrada e saudável este período da sua...

  9. Registros nuevos de especies de Leucospidae (Hymenoptera: Chalcidoidea para Colombia

    Directory of Open Access Journals (Sweden)

    Arias Penna Diana Carolina

    2008-12-01

    Full Text Available Dos especies de Leucospis se reportan por primera vez para Colombia Leucospis aliena y Leucospis enderleini. Teniendo en cuenta estos nuevos registros, el número de especies de Leucospis reportadas para el país se eleva a 11. Además se reporta una nueva localidad en Colombia para Leucospis colombiana en el departamento del Magdalena y un registro adicional para Polistomorpha conura en el departamento del Amazonas. Los especímenes se encuentran depositados en la colección entomológica del Museo José Hernández Camacho del Instituto de Investigación de Recursos Biológicos Alexander von Humboldt (IAvH-E, Villa de Leyva (Boyacá, Colombia.

  10. Acceso a la educación para todos

    OpenAIRE

    Pinnock, Helen; Hodgkin, Marian

    2010-01-01

    A pesar de los problemas y barreras para los estudiantes desplazados con discapacidad y de la evidente necesidad de recursos humanos y financieros, la educación inclusiva en contextos de crisis es posible.

  11. Confianza y capital social: evidencia para México

    Directory of Open Access Journals (Sweden)

    Rubén Martínez-Cárdenas

    2015-01-01

    Full Text Available Desde la perspectiva económica la confianza entre los miembros de una sociedad está asociada al funcionamiento eficiente de los mercados, al reforzamiento de contratos y, en general, a la capacidad para generar desarrollo y bienestar. En este artículo exploramos empíricamente los determinantes de la confianza en México, en particular, aislamos la relación entre dos medidas de capital social, una para el individuo y otra para su entorno. Nuestros resultados muestran que la confianza aumenta con estas medidas de capital social y con ausencia de se - gregación es mayor en comunidades pequeñas, a mayor edad y para habitantes del centro-occidente, entre otras.

  12. Novo teste para diagnóstico das afasias

    Directory of Open Access Journals (Sweden)

    José G. Albernaz

    1953-06-01

    Full Text Available Um novo teste para diagnóstico e contrôle do tratamento das diferentes formas de afasia, especialmente adaptado para a língua portuguêsa, é apresentado e descrito em detalhe. O teste, que será de valor para clínicos e psicólogos interessados no tratamento e reabilitação de pacientes afásicos, se executa em cêrca de 30 minutos, interpreta-se fàcilmente e fornece os elementos necessários para o planejamento da reeducação da linguagem. Além disso, a repetição do teste de tempos em tempos indicará os progressos do paciente e sugerirá modificações do plano de tratamento no momento oportuno.

  13. Sobre o editor: notas para sua história

    Directory of Open Access Journals (Sweden)

    Anibal Bragança

    2005-12-01

    Full Text Available O artigo procura contribuir para a definição da função editor de livros impressos e oferece indicações básicas de sua história no Ocidente. Etimologia e conceitos.Tipologia histórica. Formação, desenvolvimento e crise da cultura impressa. Mudanças e novas oportunidades para a função editor na contemporaneidade.

  14. Para-petroleum industry: the new oil kings

    International Nuclear Information System (INIS)

    Thanks to a crude rate close to 140 US$ per barrel, the front-end of the para-petroleum industry (exploration and drilling/production) benefits from massive investments to meet the demand and develop new fields, in particular in hardly accessible areas (deep offshore, complex fields). However, with this inflation of projects and its snowball effect in all sectors, the lack of qualified manpower is today one of the main problems encountered by para-petroleum companies. (J.S.)

  15. Construccionismo: Objetos para pensar, entidades públicas y micromundos

    Directory of Open Access Journals (Sweden)

    Eleonora Badilla Saxe

    2004-01-01

    Full Text Available Este artículo presenta una perspectiva pedagógica de la teoría educativa denominada Construccionismo, propuesta por Seymour Papert sobre la base del Constructivismo de Jean Piaget. Papert considera las computadoras como semillas culturales que pueden ejercer una poderosa influencia en el pensamiento de las personas. En particular, se abordan tres de los conceptos clave para el Construccionismo: objetos para pensar, entidades públicas y micromundos

  16. Refactorings para mejorar procesos de negocio en aplicaciones web

    OpenAIRE

    Camelier Carvajal, Julia

    2013-01-01

    El objetivo principal perseguido en esta tesis consiste en proponer un catálogo de refactorings para mejorar aspectos como usabilidad, eficiencia y eficacia de los procesos de negocio de las aplicaciones web. Mientras otras publicaciones identifican posibilidades de mejorías en los modelos de las aplicaciones web, esta tesis se focaliza en identificar problemas relacionados exclusivamente con la ejecución de los procesos de negocio y sugerir cambios para optimizar la experiencia del usuario m...

  17. Los laberintos del miedo. Un recorrido para fin de siglo

    OpenAIRE

    Rossana Reguillo

    2000-01-01

    Desde la comunidad tribal hasta la megalópolis, a lo largo de la historia, los grupos sociales han buscado diferentes mecanismos para enfrentar la fragilidad y vencer el miedo. Desde los amuletos protectores, hasta la constitución del Estado, la Historia de la humanidad es la historia de la larga búsqueda para contrerrestar los efectos de las fuerzas que amenazan la permanencia, la estabilidad, la certeza de la vida.

  18. Profilaxia para tromboembolia venosa em uma unidade de tratamento intensivo

    Directory of Open Access Journals (Sweden)

    BARRETO SÉRGIO SALDANHA MENNA

    2000-01-01

    Full Text Available Objetivos: Identificar o nível de risco e a prática de profilaxia para TEV em pacientes hospitalizados em um centro de tratamento intensivo (CTI. Métodos: A amostra foi constituída por pacientes admitidos no CTI-HCPA entre dezembro de 1997 e fevereiro de 1998. Foram excluídos pacientes em tratamento com anticoagulantes ou que apresentavam contra-indicações para uso de heparina. Os critérios utilizados para determinação dos fatores de risco para TEV e sua estratificação em níveis de risco seguiram parâmetros estabelecidos em consensos internacionais. O estudo não foi de conhecimento do pessoal médico da unidade. Resultados: Foram analisados 180 pacientes, com média de idade de 58 anos (± 16,5. Os fatores de risco mais freqüentes foram: idade ³ 40 anos (85,0%, grande cirurgia (47,8%, infecção torácica ou abdominal (22,8%. Dois ou mais fatores de risco simultâneos estiveram presentes em 146 (81% casos. Na avaliação do risco para TEV, 142 (79% foram classificados como risco moderado/alto. Medidas profiláticas foram prescritas para 102 pacientes (57%, sendo a heparina utilizada em 60% dos casos de risco moderado ou alto. Evidenciou-se uma associação significativa entre o aumento do nível de risco e do número de fatores de risco com o aumento do uso de profilaxia (p < 0,05. Conclusão: Fatores de risco para TEV foram freqüentes na amostra estudada. No entanto, 40% dos pacientes com risco moderado/alto não receberam profilaxia farmacológica para TEV.

  19. Diseño de un andador para adultos

    OpenAIRE

    Rebollo Mugueta, Cristina

    2011-01-01

    Este proyecto fin de carrera tiene por objeto el estudio y diseño de un andador para adultos según las especificaciones establecidas por el cliente, con el fin de proporcionar una ayuda en la marcha a personas que presenten dificultades en su movilidad. Más concretamente, la actividad comercial se centrará en el diseño de un andador para adultos que pueda ser utilizado tanto en interiores como exteriores.

  20. Las nuevas normas españolas para cemento

    Directory of Open Access Journals (Sweden)

    Calleja, José

    1976-12-01

    Full Text Available Not availableSeñores: Es para mí un alto honor, que no es la primera vez que recibo de la fraternal amistad de ustedes los hermanos argentinos, el haber sido invitado por el Instituto Nacional de Tecnología Industrial (INTI con la colaboración del Instituto del Cemento Portland Argentino (ICPA, para departir sobre temas que profesionalmente nos interesan y preocupan.

  1. La resistencia social: una resistencia para la paz

    Directory of Open Access Journals (Sweden)

    Sally González Higuera

    2011-01-01

    Full Text Available Las iniciativas locales en el marco de la acción política de la resistencia social están encaminadas a solucionar contextos complejos, problemas puntuales y propios de una determinada comunidad. Así su cobertura sea reducida porque se limita a lo local, ha sido valioso su impacto en términos de bienestar. Pequeñas organizaciones locales han creado sus propios espacios para poder ac- tuar, a veces, en concordancia con las políticas públicas establecidas y otras de manera absolutamente creativa y autónoma. Así, la población se ha organizado para defender los derechos humanos, prevenir el reclutamiento o para buscar la resolución pacíęca de conĚictos. Exploran los alcances de la educación y la cultura para la paz y la manera de proteger a la infancia de un destino que no ofrezca opciones a la vida. Reconstruyen familias y comunidades enteras para que las víctimas retomen una vida independiente y económicamente viable, para que desvinculados de los grupos armados ilegales se reintegren a la legalidad, en ęn, realizan acciones concretas que, en pequeña escala, son esfuerzos tangibles de resistencia social. Es inmenso el universo de acciones especíęcas que salvan vidas, reparan daños, frenan las acciones violentas o fortalecen las acciones colectivas y el valor civil para sobreponerse a ellas. Todas son expresión del esfuerzo local para resol- ver una situación concreta pero, al mismo tiempo, tienen la capacidad de incidir en las políticas públicas locales, como ya lo han demostrado algunas comunidades que se abordaran en este documento.

  2. Os desafios para a saúde

    Directory of Open Access Journals (Sweden)

    José R. Carvalheiro

    1999-04-01

    Full Text Available O TRABALHO DÁ ênfase à natureza econômica da saúde num momento em que o setor terciário da economia é o que mais cresce e a área da saúde é de todas a mais dinâmica. Aborda a crise da saúde pública considerando seus problemas, métodos e serviços. Adota o conceito de comunidade epistêmica para a análise da situação atual. Identifica duas correntes, com paradigmas conceituais distintos - o da Saúde Pública e o da Economia da Saúde. As principais agências de formulação desses paradigmas são, respectivamente, a Organização Mundial da Saúde e o Banco Mundial. No plano nacional, lembra que a Constituição de 1988 previu um Sistema Único de Saúde (SUS universal, com integralidade das ações, descentralizado e participativo, com controle social. O SUS vem sendo implementado através de Normas Operacionais e dos mecanismo de compensação representados pelas Comissões Intergestores. Questão ainda não totalmente resolvida é a do financiamento do SUS.THIS PAPER emphasizes the economic nature of health care at a time when the tertiary sector is the one fastest growing in economy and health care is the most dynamic. It touches upon the public health crisis considering health problems, methods and services. The epistemic community concept is used to analyse the current situation. Two trends are identified, exhibiting distinct conceptual paradigms: one in Public Health, the other in Health Economics. The main agencies for the formulation of those paradigms are, respectively, the World Health Organization and the World Bank. On the national level, the 1988 Constitution provided a universal Unified Health System (SUS - Sistema Unificado de Saúde, complete in its activities, decentralized and fully engaged, under social control. The SUS has been established according to the Operational Rules and the compensation mechanisms represented by its Intermanaging Committees. An issue not yet fully settled is the SUS finacing.

  3. Revestimientos especiales para diques y canales

    Directory of Open Access Journals (Sweden)

    Zorzi, Silvano

    1964-11-01

    realizaciones, obras que actualmente se encuentran satisfactoriamente en servicio. El trabajo termina con unas sencillas y escuetas recomendaciones que constituyen, por sí mismas, las conclusiones que del método se pueden sacar para su mejor éxito y explotación, tanto desde el punto de vista técnico como económico.

  4. Construcciones para implantación inmediata

    Directory of Open Access Journals (Sweden)

    Ripollés Díaz, Fernando

    1984-03-01

    Full Text Available The Article starts with a general theory about the emergency situations: their definition their types and their origins to end up analyzing the different catastrophic emergency cases. It continues with a display of the characteristics the helping operations require under the politic humanitarian and technical points of view. Afterwards the minimum necessary activities for immediate setting are detailed going through every conditionnings that must be considered during each phase of the works. These conditionings are only satisfied by some types of buildings have been established well distinguished types are selected and described. Once the different classes of buildings have been stablished and typologized a special attention is payed to their ways of loading transport and unloading picking from them all those that allow the quickiest real set up. The types of shelters that satisfy this condition are three: the pneumatic dwelling the cellular modules and the light precasted homes. The particularities of these buildings are reviewed. The Article ends with a solution put forward by the author in which a light shelter Is transported and set up by a powerful helicopter.El Artículo comienza por una teoría general sobre las situaciones de emergencia: su definición, su tipología y su génesis, hasta culminar en el análisis de los casos de emergencia catastrófica. Continúa con la exposición de los caracteres que debe reunir una operación de auxilio, bajo los puntos de vista políticos, humanitarios y técnicos. Después, se detallan las actividades mínimamente necesarias para realizar una implantación inmediata, recorriendo minuciosamente los condicionantes que deben cumplirse en cada fase de obra. Estos condicionantes solamente son satisfechos por algunas clases de edificaciones, de entre las cuales se seleccionan y describen diez tipos bien diferenciados. Ya establecida la tipología de las construcciones, se recorren sus modos de estiba

  5. NOTAS PARA UN DIÁLOGO

    Directory of Open Access Journals (Sweden)

    María Nieves Alonso M.

    2004-11-01

    Full Text Available La relación de Pablo Neruda con la poesía y los poetas peninsulares ha sido destacada en varios estudios. El mismo poeta ha entregado hermosas señales sobre el asunto. En esta línea, "Notas para un diálogo" propone demostrar la vinculación profunda entre el Premio Nobel chileno y Antonio Gamoneda, poeta español (leonés nacido en Oviedo contemporáneo. La intuición inicial y los indicios preliminares, surgidos por la lectura de algunos relatos de infancia poetizados por los autores, permite avanzar hasta precisar los elementos de un diálogo temático, léxico y sintáctico que revela una misma proposición estética surgida de una conciencia desolada y en constante regreso a lo deshabitado del yo y con un gran compromiso con su tiempo. La profunda comunidad de la lengua que estos poetas habitan, compleja y diáfana a tiempos, muestra las afinidades y diferencias de unas poéticas que parecen decir: "Estamos rodeados de pura muerte, vivimos rodeados de muerte y, al mismo tiempo, de luz, palabras y silencio. Somos desiertos, pero poblados de tribus, de fauna, de flores"Pablo Neruda's relation to peninsular poetry and poets has been well emphasized in diverse studies. The poet himself has left beautiful intimations on this matter. In this perspective,'Notes for a Dialogue' intends to demostrate the prolound bonds between the Chilean Nobel Prize, and the contemporary Spanish poet, Antonio Gamonal (born in Oviedo. The initial intuition and the preliminary hints, arising from the reading of some childhood memories poetized by these poets, permit us to advance towards the identification of the elements of a syntactical, lexicographic and thematic dialogue revealing an identical aesthetic proposal born out of a desolate conscience in constant return to an uninhabited self, with full commitment to the age, The profound community of the language binding these poets, shows affinities as well as differences in their respective poetics which may

  6. Barajas-park. Edificios para industria limpia

    Directory of Open Access Journals (Sweden)

    Argeles, J. Ramón

    1990-12-01

    Full Text Available During the last 20 years the concept of BUILDINGS FOR INDUSTRIAL USE has involved and has produced an important change in REAL STATE PRODUCTS. The ergonomic differences between INDUSTRY and SERVICES tend to decrease as far as technological advances are concerned. New Company Management Techniques favor the creation of technical and commercial teams to study projects and products and this highly-qualified personnel requires a comfortable atmosphere and surroundings. Warehousing has also progressed. Stock volumes have been reduced in favor of faster rotation. At present, commercial buildings are designed with interaction functions in mind. The space's sensitivity is translated in an economic diversification process. The objective is to design buildings that attract different types of companies, offering all of them identical efficiency. Facility for development and evolution of the companies, with simple modifications, optimizing internal! and external communications, with provisions for parking. Facility for incorporating diverse and sophisticated services. A building with these characteristics offers: A good location. Good Communications. Good natural lighting. High-quality structural design. Good insulation. Large open interior spaces. Capacity to incorporate sophisticated installations and services. Attractive scenery/views and a good neighborhood.

    En los últimos 20 años ha evolucionado el concepto de Edificios de uso industrial produciendo un importante cambio en los productos inmobiliarios. En tecnologías avanzadas las diferencias ergonómicas entre industria y servicios tienden a reducirse. Nuevas Técnicas de Gerencia Empresarial favorecen que alrededor de proyecto o productos se creen equipos compuestos por técnicos y comerciales; para este personal, altamente cualificado, se necesita crear ambientes y entornos agradables. La función de almacenamiento también ha evolucionado, el volumen de stock se reduce, y a

  7. Apuntes para una historia de Las12

    Directory of Open Access Journals (Sweden)

    Paula Torricella

    2011-09-01

    Full Text Available En este artículo exploramos la historia de Las12, el suplemento feminista del diario Página/12, desde su nacimiento en 1998 hasta la actualidad. El análisis pretende reponer los antecedentes de este suplemento en la prensa gráfica argentina, así como reconstruir el contexto de su aparición y las relaciones que entabló con el diario que lo publica. A partir de una lectura general y de comunicaciones con su directora actual y otras periodistas, realizamos una descripción del perfil del suplemento y proponemos ciertos momentos en los que anclar una periodización posible de su historia. Discutimos la pertinencia de entenderlo como "periodismo de género", tal como se concibe actualmente a esta modalidad de la prensa. Y lo contrastamos con dos proyectos periodísticos para los que es un referente necesario: la Asociación Civil Artemisa Comunicación y su portal web de noticias; y Soy, el suplemento de diversidad sexual que el mismo diario inauguró en 2008 y que comparte su directora con Las12. El último apartado realiza un breve recorrido por el suplemento La República de las Mujeres del diario uruguayo La República. El objetivo es señalar algunos rasgos compartidos y aquellas distancias que mantiene con su par argentino.In this article we explore the history of Las12, the feminist publication of Página/12 journal, since its first appearance in 1998 until today. The analysis intends to replace previous publications of this kind in the print media of Argentina, the context of its emergence and the relationships that established with the newspaper to which belongs. While describing its style and proposing a periodization of its history, we discuss the relevance of regarding it as "gender journalism" in the mode that it is currently defined. We compare this publication with two projects for which is a mandatory reference: the Asociación Civil Artemisa Comunicación and its website; and Soy, the publication of sexual diversity of P

  8. Condiciones de posibilidad para una justicia global

    Directory of Open Access Journals (Sweden)

    Pereira, Gustavo

    2004-06-01

    Full Text Available Recognition, as a constitutive part of subjectivity, is a basic need for people as well as for States. The terms of international relationships imposed by a great number of international credit and commerce institutions contradict and undermine such recognition, by means of policies that result in segregation and poverty in the poorest countries. Breaking such logic seems to be the way to enable the existence of conditions of global justice based on terms of reciprocal recognition. A prudential argument is the first step in this process; mid and long-term benefit would be the only rational motivation for international institutions to enable such an openness that would ensure reciprocal recognition. However, this argument is not sufficient, and the objective of a radical inclusion affecting all regions of the planet requires a moral argument based on the idea of equal dignity, inherent to every person. Global justice and its counterpart, local justice, will only be possible through the combination of these two arguments, which would make the existence of a logic of reciprocal recognition possible, thus enabling justice.

    El reconocimiento, en tanto que constitutivo de la subjetividad, es una necesidad básica tanto de las personas como de los Estados. Los términos de relación internacional impuestos por buena parte de los organismos internacionales de crédito y comercio niegan y socavan este reconocimiento a través de políticas que generan exclusión y pobreza en los países más pobres. La ruptura de esta lógica se presenta como un camino que posibilita el surgimiento de condiciones de justicia global basadas en términos de reconocimiento recíproco. Un argumento prudencial oficia como primer paso en este proceso, el beneficio a medio y largo plazo sería la motivación racional para que los organismos internacionales generasen una apertura que permitiese asegurar el reconocimiento recíproco. Sin embargo, este argumento no es

  9. Puente para paso de peatones, en Iowa

    Directory of Open Access Journals (Sweden)

    Howard, -

    1964-07-01

    Full Text Available The footbridge recently constructed at Des Moines (USA is noteworthy in that the approaches to it are curved, and it is supported by cylindrical columns. As the ground was not sufficiently consistent, it became necessary to reinforce it by driving piles into it. The foundation slab was concreted on top of the piles, and this in turn supports the bridge columns. The abutments also rest on a pile foundation. The approaches are steeply inclined, in order to provide enough clearance over the roadway. The deck consists of a continuous reinforced concrete double T shaped section, 60 cm in depth, 2.75 m wide along the top, and 1.50 m wide along the bottom. The only dilation joints are fitted between the extremities of the deck and the abutments. The design of this structure has been carefully thought out in every detail, especially since the slender columns and sharp curves give it a particularly stylized quality. The final result is one of extreme gracefulness and aesthetic charm. The project has been designed by Howard, Needles, Tammen & Bergendoff.La pasarela recientemente construida en Des Moines (EE. UU., presenta la notable particularidad de tener sus accesos en curva y apoyarse sobre pilares de forma cilíndrica. Como el terreno no tenía suficiente resistencia de sustentación se tuvo que reforzar hincando pilotes para hormigonar, sobre ellos, la solera en la que descansa el montante cilíndrico, único, en cada uno de los soportes, operación que fue necesario extender a los dos estribos. Por tener que ganar suficiente altura libre sobre la calzada, los accesos tienen pendientes pronunciadas. La losa que constituye el tablero es de hormigón armado, continua, de sección en forma de T, con 0,60 m de canto, 2,75 m de anchura en la cabeza superior y de 1,50 m en la inferior. En las uniones entre losa y estribos se han formado las dos únicas juntas de dilatación que se han previsto en esta estructura. Dada la forma particular del conjunto

  10. Propuesta para el desarrollo de instrumentos de autoevaluación para programas educativos a distancia

    Directory of Open Access Journals (Sweden)

    Verónica García Martínez

    2011-01-01

    Full Text Available El presente trabajo expone la etapa inicial de un proyecto conjunto entre la Universidad Juárez Autónoma de Tabasco (UJAT y la Universidad Autónoma de Chiapas (UNACH, México; se trata de una estrategia diseñada para elaborar mecanismos que permitan a los programas virtuales autoevaluarse. La propuesta surge como resultado de la aplicación de un modelo de autoevaluación de programas a distancia diseñado por la Asociación Nacional de Universidades e Instituciones de Educación Superior (ANUIES y tomado como referencia para instrumentar en la UJAT, un ejercicio de autodiagnóstico durante el periodo 2008-2009. Los resultados mostraron la necesidad de pensar en mecanismos de evaluación situados en el contexto regional. La propuesta descansa, principalmente, en la revisión documental y en el panel de expertos elegidos mediante el método Delphi y Método combinado TZ. La estrategia metodológica consta de cuatro etapas: a revisión de modelos de evaluación; b la selección de expertos de dos universidades de los Estados de Tabasco y Chiapas que cuentan desde hace más de diez años con programas virtuales; c el diseño de instrumentos de auto diagnóstico y d la calificación de los instrumentos por los expertos. El reporte describe tres de las cuatro etapas del estudio. El promedio del índice de expertos en la autoevaluación fue similar en las dos universidades; se concluye, por lo tanto, que los expertos comparten un nivel de conocimiento afín, en especial en el diseño de materiales u objetos de aprendizaje, no así en indicadores de calidad estimados para la educación virtual.

  11. Rutas para la Alianza Pacífico: ferrocarriles e hidrovías clave para Colombia

    OpenAIRE

    Duque Escobar, Gonzalo

    2014-01-01

    La Cuenca del siglo XXI será el Pacífico, donde son rentables los barcos Suez de 12000 TEU, y no los Panamax de 4500 TEU. La fórmula de Colombia para ir del Altiplano al Pacífico, es encontrar el Ferrocarril Verde y la Hidrovía del Atrato, cruzando la Cordillera Central por Manizales con el Ferrocarril Cafetero, para continuar con el Tren de Occidente a Urabá

  12. Cambiarla escuela para educar en la diversidad

    Directory of Open Access Journals (Sweden)

    Josefina LOZANO MARTÍNEZ

    2009-11-01

    Full Text Available RESUMEN: A lo largo de este artículo realizamos algunas reflexiones sobre los cambios organizativos y curriculares que estimamos han de llevarse a cabo en la escuela para que ésta pueda dar una respuesta educativa de calidad a la diversidad del alumnado. Nos centraremos, posteriormente, en describir algunos ajustes necesarios cuando, entre otros, asisten a las aulas alumnos con necesidades educativas especiales asociadas a la discapacidad psíquica.Por último, y teniendo en cuenta las premisas anteriores, describiremos el resultado de un proceso de investigación-acción realizado por un grupo de profesores de un centro público de Educación Primaria donde se encuentra un porcentaje considerable de alumnos con necesidades educativas especiales asociadas a la discapacidad psíquica y a otros trastornos profundos del desarrollo. Estos docentes, a partir de un estudio de su realidad educativa y asesorados por dos profesoras de la Facultad de Educación, contemplaron propuestas de actuación en torno al diseño, desarrollo y evaluación de unidades didácticas integradas como respuesta educativa a los grandes retos a los que se enfrenta la escuela para educar en la diversidad.ABSTRACT: In this text we reflect about the organizational curricular changes which we think must be realized in the school to give a educational answer of quality to the diversity of students. Then, we describe some necesary adjustments for students of the class who have special educative needs associated to psychis discapacity.Finally and with this in mind we will describe the result of a process of investigation-action which han been realiced by a group of teachers at public school of Primary Education, where there is a big percentaje of students with especial educative needs associated to psychic discapacity and other deep mental disorders of development. These teachers, with the help of a study about their educative reality and two teachers of Education University

  13. Procedimento para projecto de sistemas de escape para veículos

    OpenAIRE

    Mendes, José António Teixeira

    2007-01-01

    Com o aumento da quantidade de veículos e, consequentemente, da poluição sonora urbana, o estudo da redução de ruído tem ganho cada vez mais importância. Daí que nas últimas cinco décadas se tenham conseguido muitos avanços na teoria dos filtros acústicos e, particularmente, no projecto de sistemas de escape para veículos. Tais sistemas devem, também, atender aos requisitos da legislação ambiental em vigor, que são cada vez mais exigentes e rigorosos, assim como contribuir p...

  14. Um algorítmo melhorado para encontrar FAS para grafos planares

    Directory of Open Access Journals (Sweden)

    Candido Ferreira Xavier de Mendonça Neto

    1999-05-01

    Full Text Available Dado um grafo orientado G, uma cobertura é um subconjunto B de arestas que interceptam todos os cortes de G. De maneira equivalente, a contração das arestas de B tornam o grafo G fortemente conexo. Um algoritmo primal-dual de complexidade O(n5 é apresentado por Frank (1981, este algoritmo encontra uma cobertura mínima do grafo orientado. No caso de um grafo planar, o problema dual será encontrar um conjunto mínimo de arestas cuja remoção torna G acíclico. Neste trabalho será mostrado como utilizar o algoritmo de Frank para resolver o problema dual. Será também apresentado uma melhoria que torna o algoritmo de Frank mais eficiente em casos práticos.

  15. Necesidad de un programa de tamizaje para chlamydia trachomatis para Colombia

    OpenAIRE

    Camacho Calixto, Ángela María

    2012-01-01

    En el mundo, la infección Chlamydia trachomatis es la infección bacteriana de transmisión sexual más común. En la mayoría de los casos la infección es asintomática, lo que hace difícil su detección. Este microorganismo puede colonizar el tracto genital superior, causando inflamación y cicatrización en estos órganos tanto en mujeres como en hombres. La intervención actual para la detección y tratamiento de la Chlamydia trachomatis en el mundo no es generalizada, en cambio de esto encontram...

  16. Casa para la playa, New Jersey

    Directory of Open Access Journals (Sweden)

    Breuer, Marcel

    1964-03-01

    Full Text Available The McMullan house, built on the beach, has been designed to be inhabited all the year round. Basically this building is a rectangular block, lifted above the dunes on a framework of timber columns and beams. The ground floor contains the entrance hall, the guest room or servant's quarters, including a bath room, and a shower room which can be reached separately from the beach. The second floor is taken up with the main living quarters, and the second floor contains the bedrooms. The northern and southern sides have few windows, whilst the eastern and western sides have balconies protected with sliding and Venetian blinds, which in addition to supplying an effective protection against the sun, give the house a pleasant sense of secluded intimacy. The blinds are made of wood, and are painted dark brown. Doors and windows are also made of wood, but painted white. This beautiful house on the New Jersey coast exhibits in a marked degree the sculptural quality of architecture, a three dimensional plasticity, which is often neglected in many buildings of the more simple kind. Marcel Breuer has succeeded in making each of the facades of this elementary boxlike design have an interest of its own, by playing with their colour, light and shade effects, texture and combination of materials.La casa McMullan, construida en la playa, está proyectada para ser habitada durante todo el año. En esencia es un bloque paralelepipédico, elevado sobre las dunas y sustentado por un sistema de columnas y vigas de madera vistas, tanto en el interior como en el exterior. Su planta baja alberga: la entrada principal, habitación de huéspedes o de servicio con baño y una ducha con acceso desde la playa. El primer piso agrupa las dependencias nobles. Y el segundo, la zona de dormitorios. Las fachadas norte y sur presentan pocos huecos al exterior; y las este y oeste disponen de galerías con persianas correderas y celosías, que, además de proporcionar intimidad a la

  17. Modelo para determinar as exigências de proteína para poedeiras Modelling protein utilization in laying hens

    Directory of Open Access Journals (Sweden)

    Nilva Kazue Sakomura

    2002-11-01

    Full Text Available O objetivo do trabalho foi elaborar um modelo para estimar as exigências de proteína bruta (PB para poedeiras leves, usando o método fatorial. Para determinar as exigências de proteína bruta (PB para manutenção foi utilizada a técnica do balanço de nitrogênio. A exigência de proteína bruta para o ganho de peso foi determinada em função do conteúdo de nitrogênio na carcaça e a eficiência de utilização do nitrogênio da dieta. A exigência de PB, para produção de ovos, foi determinada considerando o teor de PB determinado nos ovos e a eficiência de deposição do nitrogênio no ovo. A partir dos valores das exigências para manutenção, para o ganho e produção foi elaborada uma equação para predizer as exigências diárias de PB (g/ ave/ dia para poedeiras: PB = 1,94. P0,75 + 0,48.G + 0,301.O, em que P = peso corporal (kg, G = ganho de peso diário (g/dia e O = massa de ovos produzida (g/ave/dia.The objective of this study was to determine a model for crude protein requirements (CP for laying hen by the factorial method. The protein maintenance requirement was determine by the nitrogen balance technique . The crude protein requirement for weight gain was determined based on body nitrogen content and nitrogen efficiency for body deposition. The crude protein requirement for egg production was determined based on the nitrogen content of eggs and nitrogen efficiency for egg deposition. Considering the requirements for maintenance, egg production and weight gain, it was elaborated a protein requirement model for laying hen: PB = 1.94xW.75 + 0.480xG + 0,301x E, where PB = requirement (g/bird/day, W = body weight (kg, G = daily weight gain (g/day and E = egg mass (g/bird/day.

  18. Um Termômetro para as Macro-Prudenciais

    Directory of Open Access Journals (Sweden)

    Fabio Kanczuk

    2013-12-01

    Full Text Available Desenvolvemos um modelo com fricções no crédito tanto para firmas como famílias. Crédito às firmas é tratado como nos modelos de acelerador financeiro (e.g. Bernanke e Gilchrist (1999. Os juros sobre os recursos emprestados às famílias dependem de seu endividamento, como em Curdia e Woodford (2010. O modelo é estimado para o Brasil, utilizado para estudar os episódios de desaceleração, e para a extração dos prêmios de financiamento (destilados a partir de dados não financeiros, os quais são comparados com informações sobre crédito às pessoas físicas e jurídicas. Dessa forma, o obtém-se um termômetro para mensurar como medidas prudenciais sobre o crédito afetam atividade e inflação.

  19. Desarrollo de simuladores para procesos industriales. Parte I. (Colada continua

    Directory of Open Access Journals (Sweden)

    Ramírez, A.

    2006-06-01

    Full Text Available This work was written for illustrating the development of computer simulators for production process. As an example a simulator for continuous casting process was made, this is the most popular method to produce some steel products like billets and slabs. The simulator (SSCC was programmed by the present authors in C++; but mathematical procedures, algorithms and flow charts shown here can be used as a base in any other programming language. This is the first part of the work; it is focused to the development of some computational tools to describe the real continuous casting process

    Este trabajo se realiza con el objeto de ilustrar el desarrollo de simuladores para procesos industriales; como ejemplo se realizó un sistema de simulación para representar el proceso de colada continua que es el proceso más común para la producción de perfiles de acero. El sistema de simulación para colada continua (SSCC fue programado por los presentes autores en lenguaje C++; sin embargo, los procedimientos matemáticos, algoritmos y diagramas de flujo ilustrados en este trabajo pueden ser programados en cualquier lenguaje de programación. Esta primera parte del trabajo se enfoca a desarrollar herramientas de cálculo para representar lo que sucede físicamente durante el proceso de colada continua.

  20. El Derecho Agrario como derecho para la paz

    Directory of Open Access Journals (Sweden)

    Ricardo Zeledón Zeledón

    2015-01-01

    Full Text Available Contenido: El Derecho agrario surgido de la paz y para la consolidación de la paz, como fuente e instrumento para su cumplimiento. La visión de Carrozza como conjunto de reglas destinadas al fin de la paz, y la equidad. Explicación de un Derecho agrario vinculado a la paz por su origen en los Derechos Humanos Económicos y Sociales. Evolución del Derecho Agrario en los Derechos Humanos de la tercera generación (principalmente ambiente, desarrollo y paz, en las nuevas dimensiones del Derecho agrario del futuro. Derecho agrario como derecho para la paz y el respeto de los derechos humanos. Desarrollo sostenible y agricultura del futuro. La nueva orientación de los institutos del derecho agrario como instrumentos de paz, dirigidos a cumplir los fines de la justicia social, el desarrollo económico y el equilibrio ambiental. Desarrollo como respuesta a los problemas del ambiente, alimentario, de la pobreza, indígena y de la mujer rural. El rol de la justicia agraria y ambiental como derecho para la paz. El derecho agrario, disciplina forjada en una concepción iushumanista, acorde con los derechos humanos y la paz. El derecho agrario como derecho para la paz.

  1. Tutor Inteligente para Propuestas de Investigación

    Directory of Open Access Journals (Sweden)

    Jesús Miguel García Gorrostieta

    2014-01-01

    Full Text Available Estudiantes de Nivel Licenciatura llevan a cabo proyec tos de final de curso en los cuales se solicita la estructuración de un trabajo de investigación. Con el fin de mejorar la calidad de dicha tarea y guiar en el desarrollo de este tipo de trabajo, se implementó un Sistema Tutor para ayudar a los estudiantes. En este artículo se presenta un Tutor Inteligente basado en la web para proporcionar asesoramiento a los estudiantes en la estructuración de borradores de proyectos de investigación. Proponemos un modelo del estudiante basado en una red para seguir el progreso de cada estudiante en el desarrollo del proyecto, así como una retroalimentación personalizada en cada evaluación. El tutor incluye un módulo para evaluar la riqueza léxica, que se realiza en términos de densidad léxica, diversidad léxica y sofisticación. Se presentan los resultados de un estudio piloto con estudiantes que usaron el sistema, además de un análisis del cuestionario con el cual se realizó la evaluación empírica, en la cual se muestra que los estudiantes encontraban a la herramienta útil para mejorar sus escri tos.

  2. Collarín para soportes metálicos

    Directory of Open Access Journals (Sweden)

    de Miguel, J. L.

    1998-10-01

    Full Text Available In architectural works, structural calculations are usually few and simple, they mostly corroborate what is already known. Calculations are made for the most part with the purpose of exploring solutions. When working in a specific case operations ought to be framed in the practical understanding, with predictable values and tabulated solutions, with no surprises. To write numbers and trust them blindly, is like a reckless appointment, something that should not be done in structures. This article shows how to use the structural knowledge in order to explore a specific solution: a collar for metal supports.

    En las obras de arquitectura los cálculos estructurales suelen ser pocos y sencillos, más bien para corroborar algo que se sabía de antemano. Los números se hacen, en su mayor parte, para explorar soluciones; cuando se trabaja en un caso particular debe operarse en un marco conocido, con valores predictables y soluciones tabuladas, sin sorpresas. Hacer números para fiarse a pies juntillas de ellos, es como una cita a ciegas, algo no recomendable en estructuras. Este artículo muestra cómo usar los conocimientos estructurales para explorar una solución: la de un collarín para soportes metálicos.

  3. Modelo de internacionalización para la empresa colombiana.

    Directory of Open Access Journals (Sweden)

    Andrés Mauricio Castro Figueroa

    2010-05-01

    Full Text Available Un modelo de internacionalización debe partir de la necesidad de fortalecer el entorno empresarial colombiano con miras a un proceso de globalización cada vez más exigente. Aunque diversos autores internacionales y colombianos han tomado el tema de la exportación como el primer paso para la internacionalización, ésta no puede ser la única base sino que se debe partir de un contexto histórico local para que los escenarios deseados se den. Así mismo, se debe fortalecer el desarrollo interno de la empresa para que se prepare y penetre en los mercados internacionales con suficiente capacidad para afrontar los retos que esto demanda. Sólo a través de herramientas útiles de aplicabilidad para el desarrollo estratégico internacional de las pymes en Colombia, se logrará afrontar los retos que implica un Tratado de Libre Comercio, ya sea con Estados Unidos o la Unión Europea, o con cualquier proceso de integración al que se vincule Colombia.

  4. Tratamientos para dejar de fumar, disponibles en México

    Directory of Open Access Journals (Sweden)

    Sansores Raúl H

    2002-01-01

    Full Text Available Objetivo. Describir las estrategias terapéuticas disponibles para ayudar a los fumadores a dejar de fumar. Material y métodos. Estudio realizado en el Instituto Nacional de Enfermedades Respiratorias, México. Se hizo una revisión en Medline con el encabezado de meta-análisis y se consultó el Cochrane Library, de 1990 a 2001. Resultados. La farmacoterapia muestra una buena probabilidad promedio de éxito para dejar de fumar expresada como una relación entre el medicamento activo y el placebo (índice de 39, 78, 79, 117 y 119% para los chicles de nicotina, los parches de nicotina, el bupropión, el inhalador de nicotina y el spray nasal de nicotina, respectivamente. El éxito de la terapia conductual puede ser buena (RM=3.8, sin embargo, se requiere más investigación. Conclusiones. Se hace énfasis en la necesidad de combinar la terapia cognitivo-conductual con el uso de fármacos, así como la combinación de éstos entre sí para incrementar las posibilidades de éxito para dejar de fumar.

  5. Proyecto curricular institucional: Una alternativa para el cambio

    Directory of Open Access Journals (Sweden)

    Ruth Vallejo

    2002-01-01

    Full Text Available Enfrentar el desafío de la construcción del proyecto curricular institucional representa para la educación de este milenio una prioridad, esto sin lugar a dudas, requiere de un cambio en la estructura organizativa y de gestión en cada plantel; el Currículo Básico Nacional, en marcha, representa un avance significativo, para superar esta situación. Para que esta reforma constituya una alternativa válida, es necesario abordar la formación del docente de forma sistemática, continúa desde su praxis por medio de la investigación-acción, utilizando herramientas metodológicas para el diagnóstico y acompañando todo el proceso con una evaluación institucional que al mismo tiempo que se analiza e implementa permita la formación de los actores involucrados; la revisión y los ajustes permanentes conducen a la construcción de aproximaciones sucesivas que con el trabajo concertado garantizan la viabilidad del proyecto. Se recomienda asumirlo con un carácter cíclico y dinámico para decidir si se puede o no mantener a la luz de los cambios que ocurran dentro y fuera del proceso.

  6. Ciuda tu corazón, es para toda la vida -Para Disfrutar la Música Clasica

    Directory of Open Access Journals (Sweden)

    Martínez-Cogollo Jesús Alberto

    2012-12-01

    Full Text Available Cuida tu corazón, es para toda la vida. Importantelibro de información sobre prevenciónde de las enfermedades cardiovasculares,dirigido a la comunidad en general.Hace parte de la colección de libros sobre prevención primaria: “Cuidatu corazón, vive mejor” que desde hace varios años viene publicandoel profesor, doctor Fernando Manzur Jattin, desde su grupo de investigación:“Centro de Investigaciones Biomédicas”, perteneciente a laFacultad de Medicina de la Universidad de Cartagena y CategorizadoB por Colciencias.Ahora en conjunto con los doctores Rafael de Ávila y Diego Luís CottaArriola, así como con la participación de tres jóvenes pertenecientes asu semillero de investigación: Agustín Alejandro Puello Mestre, JesúsAlberto Martínez Cogollo y Dawin de Jesús Pájaro Pardo, entrega esteimportante documento que contribuye a la necesaria labor de enseñara la comunidad a realizar prevención en enfermedad cardiovascular.Según la Organización Mundial de la Salud, 17.3 millones de personasmurieron en todo el mundo durante el año 2004 a causa de enfermedadescardiovasculares, cerebrovasculares y otras dolencias cardíacas. Lasenfermedades del corazón son la primera causa de muerte en lassociedades industrializadas. Más de 60 millones de norteamericanospresentan algún tipo de patología cardiovascular, proporcionalmentela situación es similar en los países latinoamericanos.Las personas residentes en las sociedades occidentales, consumenproductos ricos en grasas. Ingieren un 40% del total calórico en formade grasas, los cual es perjudicial para la salud, sobre todo si las grasasconsumidas son de origen animal. Las enfermedades cardiovascularesconstituyen el principal problema para la población adulta de ColombiaPARA DISFRUTAR LA MÚSICA CLÁSICA:Este libro viene a ser una oportuna reflexiónsobre la música como disciplina humanísticay sus procesos de elaboración. El maestro,médico psiquiatra, profesor

  7. Desalination of seawater with nuclear power reactors in cogeneration; Desalacion de agua de mar con reactores nucleares de potencia en cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Flores E, R.M

    2004-07-01

    The growing demand for energy and hydraulic resources for satisfy the domestic, industrial, agricultural activities, etc. has wakened up the interest to carry out concerning investigations to study the diverse technologies guided to increase the available hydraulic resources, as well as to the search of alternatives of electric power generation, economic and socially profitable. In this sense the possible use of the nuclear energy is examined in cogeneration to obtain electricity and drinkable water for desalination of seawater. The technologies are analysed involved in the nuclear cogeneration (desalination technology, nuclear and desalination-nuclear joining) available in the world. At the same time it is exemplified the coupling of a nuclear reactor and a process of hybrid desalination that today in day the adult offers and economic advantages. Finally, the nuclear desalination is presented as a technical and economically viable solution in regions where necessities of drinkable water are had for the urban, agricultural consumption and industrial in great scale and that for local situations it is possible to satisfy it desalinating seawater. (Author)

  8. CDM incidence in the economical feasibility of cogeneration in Argentine; Incidencia del MDL en la factibilidad economica de sistemas de cogeneracion industrial en Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Sosa, Maria Isabel; Fushimi, Alberto [Universidad Nacional de La Plata (UNLP), La Plata, BA (Argentina). Fac. de Ingenieria. Area Departamental Mecanica], e-mail: misosa@volta.ing.unlp.edu.ar, e-mail: afushimi@volta.ing.unlp.edu.ar

    2006-07-01

    In this paper, the contribution to the financial and economic feasibility of cogeneration systems with gas turbine and exhaust gas heat recovery boiler is discussed in function of the financial credit for reduction of greenhouse gases emissions (GH Gs) by using the Clean Development Mechanism (CDM). It has to be kept in mind the restrictions of these systems to be capital intensive projects subject to the effects of the economy of scale. Other factors to take into account are the constancy of the heat demand, the rates of sale of electricity and steam surpluses, the regulatory laws, the ignorance of the cogeneration technologies on the part of the investor, among others. The profitability of the investment for implementation of a cogeneration system can be elevated in large facilities with gas turbines and heat recovery boiler (T G + HRSG). Results discussed in previous papers are pointed out and new conclusions are enunciated. (author)

  9. Feasibility of co-generation of water and electricity by means of the IRIS;Factibilidad de cogeneracion de agua y electricidad mediante el IRIS

    Energy Technology Data Exchange (ETDEWEB)

    Vargas E, S.; Alonso V, G.; Gonzalez, J. A.; Xolocostli, V.; Ramirez S, J. R., E-mail: samuel.vargas@inin.gob.m [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2009-10-15

    The importance to count with resources that allow the development of a country is an important factor. The electricity and the water are factors that in the future will be crucial for the development of any region of the planet. In this work the economic reliability of use of IRIS reactor like a energy source for the electricity production, as well as for the potable water production through the desalination of sea water. Within this study the requirements of these two outlines for different regions from the country are analyzed, nevertheless, chooses the northwest region of the Mexican republic, because, according to estimations realized for the Energy Secretary and the National Commission of the Water, this would present important water requirements and electricity, due to the population increase that is considered for all the country, mainly the built-up zones. Combined to this one is due to consider that the present water demand in some regions of the country present a worrisome over-exploitation of this liquid appraising. The economic evaluation of co-generation that appears in this work though the IRIS reactor, includes different desalination capacities at the moment, using the three more used techniques, obtaining the even costs of water and electricity, as well as net saleable energy and the construction costs as much for the desalination plant and the IRIS reactor. (Author)

  10. Cogeneration and production of 2nd generation bio fuels using biomass gasification; Cogeneracion y produccion de biocombustibles de 2 generacion mediante gasificacion de biomasa

    Energy Technology Data Exchange (ETDEWEB)

    Uruena Leal, A.; Diez Rodriguez, D.; Antolin Giraldo, G.

    2011-07-01

    Thermochemical decomposition process of gasification, in which a carbonaceous fuel, under certain conditions of temperature and oxygen deficiency, results in a series of reactions that will produce a series of gaseous products is now widely used for high performance energetic and versatility of these gaseous products for energy and 2nd generation bio fuels and reduce the emission of greenhouse gases. (Author)

  11. Pequenos para idade gestacional: fator de risco para mortalidade neonatal Small for gestational age

    Directory of Open Access Journals (Sweden)

    Márcia Furquim de Almeida

    1998-06-01

    Full Text Available OBJETIVO: Estudar as variáveis contempladas na Declaração de Nascimento (DN como possíveis fatores de risco para nascimentos pequenos para a idade gestacional (PIG e o retardo de crescimento intra-uterino como fator de risco para a mortalidade neonatal. MATERIAL E MÉTODO: As variáveis existentes na DN foram obtidas diretamente de prontuários hospitalares. Os dados referem-se a uma coorte de nascimentos obtida por meio da vinculação das declarações de nascimento e óbito, correspondendo a 2.251 nascimentos vivos hospitalares, de mães residentes, ocorridos no Município de Santo André, Região Metropolitana de São Paulo, no período de l/1 a 30/6/1992, e aos óbitos neonatais verificados nessa coorte. RESULTADOS: Obteve-se a proporção de 4,3% de nascimentos PIG, significativamente maior entre os recém-nascidos de pré-termo e pós-termo, entre os nascimentos cujas mães tinham mais de 35 anos de idade e grau de instrução inferior ao primeiro grau completo. Os recém-nascidos PIG apresentam maior risco de morte neonatal que aqueles que não apresentavam sinais de retardo de crescimento intra-uterino. CONCLUSÕES: Em áreas com menor freqüência de baixo peso ao nascer, é importante investigar a presença de retardo de crescimento intra-uterino entre os nascimentos prematuros e não apenas nos nascimentos de termo. O registro da data da última menstruação (ou da idade gestacional em semanas não agregadas na DN facilitaria a detecção de PIGs na população de recém-nascidos.INTRODUCTION: Variables of birth certificates were analysed as risk factors of SGA (Small for Gestational Age infantis, and with a view to discovering if retarded intra-uterine growth was a risk factor neonatal mortality. MATERIAL AND METHOD: Data were obtained directly from 11 hospital medical records. A cohort of 2.251 hospital live births was obtained. Linkage of the death and birth certificates was undertaken to identify the neonatal deaths. The

  12. Cadenas de valor: un enfoque para las agrocadenas

    Directory of Open Access Journals (Sweden)

    Yadira Peña

    2008-01-01

    Full Text Available Este artículo tiene como propósito mostrar elementos de análisis para abordar el tema de las cadenas de valor. Tras una revisión exhaustiva de bibliografía relacionada y aplicada a la agricultura, se dan a conocer herramientas conceptuales que coadyuvan a construir un escenario claro y conducente para que las cadenas logren mejores niveles de competitividad, crecimiento y desarrollo para su entorno. En la primera y segunda parte se desarrolla el concepto de cadena de valor y se muestran los alcances del enfoque; en la tercera parte se plantean algunas consideraciones sobre la gestión de las cadenas de valor y en la última se ilustran dos casos exitosos en el desarrollo de cadenas de valor.

  13. Intervenciones Placebo Para Incrementar el Rendimiento Deportivo: un Tema Revisitado

    Directory of Open Access Journals (Sweden)

    MILDRETH LARQUIN-CASTILLO

    2015-01-01

    Full Text Available Las intervenciones psicológicas para incrementar el rendimiento de los deportistas han ganado gran popularidad. En este artículo se realizó una revisión de la utilización de intervenciones placebo para potenciar el rendimiento deportivo, a partir de la cual se concluyó que el contexto de aplicación, los rasgos de personalidad del deportista y el ritual de intervención han sido propuestos como los factores más relevantes a tomar en consideración. Se estima que, a pesar de las limitaciones, las intervenciones placebo constituyen alternativas eficaces que tienen distintos modos de aplicación. La utilización de vías conscientes y no-conscientes para activar el efecto placebo se materializa en el empleo de las potencialidades que brindan tanto la sugestión verbal como el priming.

  14. Vaporizador de éter para cirurgia experimental em ratos

    Directory of Open Access Journals (Sweden)

    Souza Fernando de

    1997-01-01

    Full Text Available Os autores descrevem um vaporizador de éter para ratos, artesanalmente construído, com o objetivo de se estabelecer um plano anestésico com fluxo contínuo e homogêneo em cirurgia experimental. O vaporizador é constituído de um compressor de ar para aquários, tubo de ensaio, equipos e válvulas, e outros materiais descartáveis de uso doméstico. As vantagens deste aparelho são a facilidade de manutenção do animal em plano anestésico, com redução da perda de anestésico para o ambiente, redução do gasto de anestésico e seu baixo custo e a possibilidade de mensuração do consumo de anestésico.

  15. Te echo estas yerbas para que te muras

    Directory of Open Access Journals (Sweden)

    Marta Herrera Angel

    2012-11-01

    Full Text Available La historia contenida en el expediente que se transcribe refiere un caso aparentemente trivial y, posiblemente, más común de lo que se piensa. Se trata de una joven india del pueblo de Pasca, Francisca Viracachá, quien, a principios del siglo XVIII, confesó haber matado a otra india de ese pueblo por celos. Para lograr sus fines utilizó unas hierbas que le había dado su madre para que se vengara en caso de que alguien le hiciera daño. En principio podría clasificarse -en términos modernos- como un homicidio por envenenamiento; sin embargo, la confesante afirmó que para matar a su enemiga, María Chiquita, sólo le bastó con entrar a su casa y colocarle las hierbas en la cama.

  16. Dispositivo para la experimentacion animal en la investigacion en neurociencias

    OpenAIRE

    Martín Pascual, Miguel Ángel; Andreu Sánchez, Celia; Santos, José Antonio; Gruart i Massó, Agnès; Delgado García, José María

    2013-01-01

    Dispositivo para la experimentación animal en la investigación en neurociencias conformado por un armazón (1) prismático en el que se sujetan pantallas táctiles que actúan como dispositivos de entada/salida de un sistema informático. El dispositivo comprende además un sistema de adquisición de datos (2) y medios para el procesado de dichos datos (3). Este dispositivo permite la realización de experimentos complejos de forma rápida y flexible a través del diseño de software para la experimenta...

  17. Sexualidade dos adolescentes e VIH/SIDA : conhecer para educar

    OpenAIRE

    Lopes, João Carlos Fernandes

    2006-01-01

    A ONUSIDA elege, como aposta fundamental para conter a propagação do VIH/SIDA, a mobilização dos jovens no sentido de adoptarem comportamentos seguros que deverão manter ao longo da vida. Neste contexto, a escola surge como o palco privilegiado para desenvolver acções tendentes à prevenção do VIH/SIDA, uma vez que é o espaço onde os adolescentes passam a maioria do seu tempo. Para que os programas vejam aumentada a sua potencial eficácia, devem ser o mais específicos possível, pelo que o seu ...

  18. O significado de cuidado para profissionais da equipe de enfermagem

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Baggio

    2006-04-01

    Full Text Available Trata-se de um estudo exploratório descritivo de abordagem qualitativa que objetivou compreender o significado de cuidado para profissionais da equipe de enfermagem. Os sujeitos participantes são auxiliares e técnicos em enfermagem e enfermeiros da rede de saúde. Os dados foram coletados por meio de entrevista estruturada e semi-estruturada. A análise de conteúdo foi o método utilizado para análise dos dados. Os resultados permitiram identificar as seguintes categorias de cuidado do outro: o cuidado verbal e não-verbal; a minimização da dor física no cuidado; cuidar com empatia para atender o todo; o envolvimento e o processo de cuidar.

  19. Modelos para dados de contagem com excesso de zeros

    OpenAIRE

    Santos, Jorge Helder Pereira dos

    2013-01-01

    Dissertação de mestrado em Estatística Os modelos de regressão para dados de contagem são muito utilizados nas mais variadas áreas de estudo para a modelação de fenómenos. Estes modelos integram um quadro especial de metodologias devido ao facto de a variável resposta tomar apenas valores inteiros não negativos. A distribuição de Poisson é a mais conhecida, e a mais utilizada para modelar dados de contagem, no entanto sempre que existe sobredispersão, torna-se necessário recorr...

  20. Sistema de cobro automático para supermercados

    OpenAIRE

    Piris Burgos, Miquel

    2014-01-01

    El objetivo principal de este proyecto es crear un sistema automático de cobro para supermercados, con la intención de agilizar el proceso de la compra actual. Para ello, se ha diseñado un sistema integrado en el carro de la compra que permite, a través de una aplicación móvil o de un lector de código de barras láser, que el cliente vaya escaneando los productos a medida que va comprando. De esta manera se evita que éste tenga que descargar los productos para proceder al pago y luego tener qu...

  1. Edificio administrativo para BMW - Munich - Alemania Federal

    Directory of Open Access Journals (Sweden)

    Schwanzer, Karl

    1973-06-01

    ADMINISTRATIVO: Tiene 18 plantas y 100 m de altura, con planta en forma de trébol de cuatro hojas; para su realización se utilizó un sistema de construcción en suspensión, que consta, fundamentalmente, de los siguientes elementos: — cimiento de 25 X 25 m y 10 m de profundidad; — núcleo del edificio formado por cuatro tubos de hormigón armado, unidos transversalmente entre sí, que albergan las instalaciones; — cruz superior, de vigas de hormigón pretensado, de 16 m de longitud, insertas en las paredes del núcleo, que soportan las plantas suspendidas; — cuatro columnas centrales, de hormigón pretensado y sección circular, que reciben las cargas de las 7 plantas superiores directamente, e indirectamente de las 11 inferiores, a través de las retículas de la planta técnica; — soportes externos, que conducen las cargas de todas las plantas a la técnica; los de compresión, de hormigón armado, transmiten las cargas de las 7 plantas superiores, y los de tracción, de hormigón pretensado, las de las 11 inferiores; — planta técnica, que transmite a las cuatro columnas suspendidas las cargas verticales de los soportes externos de tracción y compresión, a través de los forjados superior e inferior y de las retículas formadas por riostras diagonales; — forjados formados por placas, de hormigón armado ligero, orientadas hacia las columnas suspendidas. El EDIFICIO DE SERVICIO: Es una construcción tradicional a base de hormigón armado. MUSEO: Fue construido con lámina de hormigón ligero; interiormente, cada uno de los planos de exposición es un hongo, de hormigón, a diferente nivel.

  2. Hiperacumulación de metales: ¿una ventaja para la planta y para el hombre?

    Directory of Open Access Journals (Sweden)

    M. Llugany

    2007-01-01

    Full Text Available La hiperacumulación es la capacidad que tienen algunasplantas para concentrar metales en sus tejidos a niveles muy por encima de los normales sin presentar síntomas de toxicidad. Estas plantas hiperacumuladoras han desarrollado mecanismos internos de tolerancia a la toxicidad por metales. Esta peculiaridad las hace útiles para el hombre como herramienta en las nuevas tecnologías de fitoremediación. Sin embargo, ¿cual es el beneficio de esta hiperacumulación de metales para la propia planta? Se han propuesto distintas hipótesis entre las que destaca la ventaja adaptativa de estas plantas frente al estrés biótico. Esta propuesta es una de las más atractivas para explicar la "razón de ser" de estas especies hiperacumuladoras. En este artículo se plantean dos aspectos esenciales: los mecanismos de acumulación y tolerancia de las plantas a la toxicidad por metales y si para la planta la hiperacumulación es realmente una ventaja adaptativa.

  3. Objeto de aprendizaje para la formación docente orientado a desarrollar competencias para usar rea

    Directory of Open Access Journals (Sweden)

    Ahabael LUGO LÓPEZ

    2014-06-01

    Full Text Available El presente artículo tiene como objetivo presentar los resultados de una investigación relacionada con el diseño y uso de un Objeto de Aprendizaje Abierto (en adelante OA. Se usó una metodología de enfoque cualitativo y la entrevista electrónica aplicada a docentes y a expertos que tuvieron a cargo la validación objetiva del OA, se respondió la siguiente pregunta de investigación: ¿En qué medida un recurso orientado a desarrollar competencias para usar Recursos Educativos Abiertos para la práctica educativa, cumple con un conjunto de criterios de calidad preestablecidos de acuerdo con aquello que caracteriza a los objetos de aprendizaje abiertos? Los resultados indican que el objeto de aprendizaje cumplió de forma efectiva con los estándares y especificaciones en cuanto al aspecto pedagógico y tecnológico, sin embargo existieron aspectos tales como: errores conceptuales, actividades, evaluación, entre otros, que fueron considerados para revisarse e inclusive modificarse para que el OA en cuestión se considere un objeto de aprendizaje de calidad. Se destaca el hecho que el tema de la presente investigación constituye una innovación y una herramienta útil y necesaria para las actuales demandas del quehacer docente.

  4. Avaliação das competências de professores de enfermagem para desenvolver programas educativos para adultos

    Directory of Open Access Journals (Sweden)

    Patricia Bover Draganov

    2013-08-01

    Full Text Available Avaliar o desempenho que o enfermeiro docente de enfermagem atribui a si, nas competências para desenvolver programas educativos para adultos, foi objetivo desse estudo descritivo, comparativo, transversal e quantitativo, desenvolvido com 226 docentes enfermeiros de cursos de graduação em enfermagem paulistanos. Os dados foram colhidos por escala de Likert, lançados em planilha Excel® e analisados por estatística descritiva e testes não paramétricos de Wilcoxon e Friedman. A população tinha predominantemente entre 46-55 anos (87/38,49%, eram mulheres (198/87, 61% e mestres (180/79, 65%. Os professores consideraram-se distantes das competências que almejavam alcançar. A menor habilidade esteve em construir desenhos de programas para atender às situações de aprendizagem e a maior, em avaliar programas de ensino. O maior desejo esteve em desenhar programas com formatos criativos e o menor desejo para usar conselhos, comitês e força-tarefa. Concluiuse que desenhar programas educativos para adultos ainda é algo pouco explorado e pouco experenciado por esses docentes.

  5. Educación para un México intercultural

    Directory of Open Access Journals (Sweden)

    Sylvia Schmelkes

    2013-01-01

    Full Text Available Este trabajo sitúa la necesidad de una educación intercultural bilingüe de calidad y con pertinencia cultural y lingüística para los pueblos indígenas, en todos los niveles educativos, y la de una educación intercultural para toda la población, en el marco de la definición de México como país pluricultural y frente a las lamen- tables condiciones de vida de la población indígena en nuestro país. Si bien la educación para un país intercultural es sólo una forma de combatir las injusticias históricas que se han cometido con los pueblos indígenas, la educación contri- buye de manera importante a ello. Se reconocen algunos avances en materia de educación intercultural en el país y se define lo que se entiende por educación intercultural y sus fundamentos. Se precisa lo que ello significa para la población indígena y también para la nacional. Se finaliza dibujando dos escenarios: uno en el que se siga relegando a la población indígena como se ha venido haciendo hasta la fecha, y otro en el que se intente construir un país intercultural. Para este último, se esquematizan los retos educativos y se destaca la conveniencia de la activa participación de los pueblos indígenas en el proceso.

  6. Metodología para el dibujo a mano alzada

    Directory of Open Access Journals (Sweden)

    Yamila Irene Cordovés Pérez

    2015-04-01

    Full Text Available Se realizó una investigación con el objetivo de elaborar una Metodología para el dibujo a mano alzada. Para la elaboración de la misma, se partió de las insuficiencias encontradas en Programas Analíticos de las enseñanzas: Secundaria Básica, Técnica y Profesional y Educación Superior, por la necesidad de impartir el contenido de Croquizado, siendo no tratado por autores de la actualidad, debido a que los adelantos científico-técnicos, imponen realizar dibujos mediante el uso de recursos de multimedia, siendo medios muy atractivos para aprender dibujo en soporte. Los estudiantes de todas las enseñanzas, poseen poco conocimiento de las mediciones, las representaciones de piezas, los tipos de líneas necesarios para realizar dibujos, por esta razón no tienen grado de independencia, en cuanto a lograr habilidades para realizar dibujos sin instrumentos, o croquis o también llamado dibujo a mano alzada. Esta Metodología garantiza un nivel de aplicación y reflexión para los estudiantes, despojándose de elementos reproductivos. Compuesta la misma por cinco etapas, la cual dota al estudiante de sistemas de conocimientos y de habilidades que contribuyen al descubrimiento y desarrollo de determinadas aptitudes en el estudiante. La misma incluye imágenes y desde el punto de vista fisiológico, una imagen dice más que cien palabras, manteniendo el equilibrio entre la palabra y la imagen, ya que esto facilita los procesos del desarrollo del pensamiento en general y, en particular en el proceso de aprendizaje-enseñanza, en la disciplina Dibujo.

  7. Almanacs and schedules for teachers Almanaques y calendarios para maestros

    Directory of Open Access Journals (Sweden)

    Miryam CARREÑO

    2013-09-01

    Full Text Available In this article we analise the contents of the almanacs for school teachers published in the second half of the 19th century (after the enactment of the first Ley de Instrucción Pública and the first decades of the 20th century. These little books, specially written for teachers, played an important role in the making of the school time. They were a good instrument for teachers in organising school work, synchronizying it with the requirements of the Central Administration through the spreading or educational legislation. They were used as well in divulgating professional matters for the teacher's interest: grammar, literature, geography, science... They also have some pages in which textbooks and teaching material are advertised.En este artículo analizamos los contenidos de los almanaques para maestros publicados en la segunda mitad del siglo XIX (después de la puesta en marcha de la primera ley de Instrucción pública y primeras décadas del siglo XX. Estos libritos, especialmente escritos para maestros, juegan un papel muy importante en la construcción del tiempo escolar. Constituyeron un excelente instrumento para los maestros en lo que respecta a la organización del trabajo escolar, sincornizándola con las demandas de la administración central en el desarrollo de la legislación educativa. También se utilizaron para difundir temas de interés para los maestros referentes a diversas disciplinas: gramática, literatura, geografía, ciencias... Dedican, además, algunas páginas para anunciar manuales escolares y material de enseñanza.

  8. Identificação de quartzos incolores para joalheria

    Directory of Open Access Journals (Sweden)

    Fernando Soares Lameiras

    2006-03-01

    Full Text Available Quartzos incolores são irradiados e aquecidos para adquirirem cores esverdeadas, amareladas e amarronzadas para confecção de jóias. Somente uma pequena fração dos quartzos naturais incolores pode desenvolver cores por esse processo. A sua identificação é feita através de testes de irradiação e aquecimento em amostras representativas, que são enviadas para irradiadores para depois serem aquecidas. Trata-se de um procedimento demorado, que não atende a necessidade do mercado de pedras semipreciosas. Um novo teste é apresentado, que dispensa irradiação e aquecimento, para identificação de amostras com potencial para desenvolver cores, cujos resultados podem ser obtidos em apenas alguns minutos. Ele pode ser realizado no campo com um espectrofotômetro infravermelho portátil.Colorless quartz are irradiated and heat-treated to become greenish, yellowish, and brownish for the jewelry industry. Only a small fraction of natural, colorless quartz can develop colors through this process. The identification of this quartz is made through irradiation and heat-treatment tests on representative samples. The samples are sent to irradiators and then heat-treated. These tests are not fast enough for the needs of the semiprecious dealers. A new test is presented, that avoids irradiation and heat-treatment. It can identify samples with potential to develop colors in a few minutes. If a portable infrared spectrophotometer is available, it can be performed in field.

  9. Selección de emplazamientos para vertederos controlados

    Directory of Open Access Journals (Sweden)

    del Pozo Manrique, Marcos

    1991-04-01

    Full Text Available The objective of this article is to bring forward some ideas about the method for the correct election of sanitary landfill sites. Three subjects are developed: — Solid wasting problem and their technical solutions. — Territorial qualification for sanitary landfiliing. — Application to a particularly territory: the Alcalá de Henares area, in the Madrid province. The ground is the principal agent is sanitary landfiliing, so the correct design of sites is essential to obtain high levels of environmental safety.

    El objetivo del presente trabajo es aportar algunas ideas sobre la estrategia básica para la correcta ubicación de vertederos controlados. Para ello se abordan tres temas: — Problemática de los residuos sólidos urbanos y soluciones técnicas aportadas por el vertido controlado, indicando su campo de aplicación así como las principales Interacciones con el medio de este tipo de instalación. — A la vista de esta información previa, definición de los principales requisitos exigibles a nuestro juicio al territorio para la ubicación de un vertedero, así como los criterios para su valoración y selección. — Por último, aplicación a la selección de emplazamientos para el vertido controlado en un territorio concreto, en este caso la comarca de Alcalá de Henares, en la provincia de Madrid. Debido a que el vertido controlado es un medio de eliminación en el que el principal agente técnico es el mismo terreno donde se asiente la instalación, pensamos que una correcta ubicación es la principal garantía para obtener unos niveles duraderos de seguridad ambiental y un comportamiento adecuado en las vertientes económica y social.

  10. PENSAMIENTO ESTADÍSTICO PARA LOS EMPRESARIOS DEL SIGLO XXI

    OpenAIRE

    Pedro Sánchez Solano; Lorena López Lozada

    2004-01-01

    Hoy en día, a pesar de que la calidad de productos-servicios es primordial, el cambio es constante, la educación es integral, la competitividad es mayor y la estadística es una herramienta útil para la gestión de calidad, aún los empresarios piensan que la estadística no es relevante para sus actividades. Esto se debe a que ven ...

  11. Capacidad funcional y salud: orientaciones para cuidar al adulto mayor

    OpenAIRE

    CLARA INÉS GIRALDO M; GLORIA MARÍA FRANCO A

    2008-01-01

    Objetivo: valorar la salud y la capacidad funcional de ancianos con dependencia funcional para el autocuidado, como elementos para orientar el cuidado de enfermería y el cuidado familiar en casa. Metodología: estudio descriptivo transversal en 40 personas de 65 y más años con dependencia funcional, cuidados por familiar, en Envigado Colombia; muestreo por conveniencia. Valoración de la capacidad funcional con el índice de Katz y la escala de Lawton y Brody, ajustados según grupo de Neurocienc...

  12. Benchmarking: retos y riesgos para el ingeniero industrial

    Directory of Open Access Journals (Sweden)

    Sergio Humberto Romo Picazo

    2000-01-01

    Full Text Available Los métodos para el análisis y solución de problemas que tradicionalmente ha usado el ingeniero industrial pueden adoptar un enfoque distinto, usando el concepto de benchmarking. El benchmarking representa una herramienta muy importante para los ingenieros industriales, ya que bien aplicada conduce al mejoramiento de los procesos. Sin embargo, todo ingeniero industrial debe conocer las limitaciones y riesgos que implica la decisión de llevar a cabo un proyecto de benchmarking, aquí se señalan algunos de ellos.

  13. Uso de las TICs para el tratamiento de la Dislexia

    OpenAIRE

    Montero-Pérez, Marta

    2013-01-01

    La investigación sobre la dislexia ha adquirido importancia en las últimas décadas. Centrándose sobre todo en el diagnóstico y tratamiento en edades tempranas, para evitar retrasos en la adquisición de la lecto- escritura ya que estos influyen directamente en el fracaso escolar. La detección temprana y el desarrollo de actividades aplicando las nuevas tecno-logías para el tratamiento de la dislexia, son los ejes fundamentales de este trabajo. Las actividades creadas con la utilización d...

  14. Sistema de control y navegación para MAV

    OpenAIRE

    Valle Ruiz, Héctor

    2010-01-01

    En este trabajo se pretende implementar una plataforma lo más genérica posible, de control y navegación para MAV de bajo coste, que incluya: 1. Una arquitectura programada con software libre y que sea transferible a otras aplicaciones. Para ello se utilizará la plataforma Arduino, cuya programación se realiza en un controlador de la marca Atmel. 2. Incorporar sensores que permitan tanto la localización del vehículo (GPS), analizar la actitud del vuelo (acelerómetros), calcular distancia a obs...

  15. Justicia y ciencia: avanzando juntas para construir un mundo mejor

    OpenAIRE

    Mestres i Naval, Francesc; Vives-Rego, José

    2016-01-01

    En este artículo analizamos las relaciones entre la Justicia y la Ciencia. Ambos ámbitos son ciertamente distintos, pero su compenetración puede ser de vital importancia para la evolución de nuestras sociedades. Entender adecuadamente cómo funciona el mundo la ciencia es de vital importancia para que los tribunales de justicia puedan valorar debidamente las pruebas basadas en las ciencias forenses. Repasamos algunas áreas donde esta relación es bastante fluida y otras donde todavía estamos en...

  16. Marco de trabajo para gestionar las competencias laborales

    OpenAIRE

    Franklin Sandoval; Doris Pernalete

    2014-01-01

    En este artículo se presenta un marco de trabajo innovador diseñado y desarrollado para posibilitar la realización de estudios inherentes con la gestión por competencia en los entornos laborales de la Administración Pública Venezolana (APV). Se analizaron los principales aspectos involucrados con la Gestión del Talento Humano (GTH), que se basan en la competencia laboral, las cuales mediante su desarrollo efectivo se constituyen en fuente principal para impulsar el logro de los objetivos empr...

  17. Recomendaciones para el manejo de la faringoamigdalitis aguda del adulto

    OpenAIRE

    Cots, Josep M; Juan-Ignacio Alós; Mario Bárcena; Xavier Boleda; José L. Cañada; Niceto Gómez; Ana Mendoza; Isabel Vilaseca; Carles Llor

    2015-01-01

    La faringoamigdalitis aguda (FAA) en el adulto es una de las enfermedades infecciosas más comunes en la consulta del médico de familia. La etiología más frecuente es viral. Dentro de la etiología bacteriana, el principal agente responsable es Streptococcus pyogenes o estreptococo β-hemolítico del grupo A (EBHGA), causante del 5-30% de los casos. En el manejo diagnóstico, las escalas de valoración clínica para predecir la posible etiología bacteriana, son una buena ayuda para seleccionar a qué...

  18. Práticas de sustentabilidade para a performance

    OpenAIRE

    Firmo, Carla Maria Cunha

    2013-01-01

    Mestrado em Ciências Empresariais A literatura de sustentabilidade reconhece a necessidade de envolver gestores de topo que estejam fortemente motivados para a resolução de problemas ambientais, no desenvolvimento de negócios sustentáveis. Neste sentido, esta literatura sugere que sejam aplicadas estratégias proativas, como práticas de sustentabilidade, que têm vindo a ser consideradas como um fator precursor para a melhoria da performance empresarial. No entanto, as relações entre estas t...

  19. Desarrollo de un sitio web para una empresa

    OpenAIRE

    SQALLI HOUSSAINI, YOUNES

    2012-01-01

    Este Proyecto Fin de Carrera tiene como objetivo el desarrollo de un sitio Web para una empresa que se dedica a vender e instalar productos informáticos (ordenadores, impresoras, discos duros) y productos de vigilancia. El sitio Web sólo ofrecerá información sobre los productos, no es una solución de comercio electrónico donde el cliente pueda realizar sus compras online, esta vía se deja abierta para posibles ampliaciones de funcionalidades.

  20. Servidor Linux para conexiones seguras de una LAN a Internet

    OpenAIRE

    Escartín Vigo, José Antonio

    2005-01-01

    Este documento esta elaborado para describir la implementación de un servidor GNU/Linux, así como especificar y resolver los principales problemas que un administrador se encuentra al poner en funcionamiento un servidor. Se aprenderá a configurar un servidor GNU/Linux describiendo los principales servicios utilizados para compartir archivos, páginas web, correo y otros que veremos más adelante. La herramienta de configuración Webmin, que se detalla en uno de los últimos capítulos es indepe...

  1. Sistema gestor de recursos para una arquitectura grid

    OpenAIRE

    Ramírez Fernández, Alberto

    2015-01-01

    Sistema gestor de recursos para una arquitectura grid que consta de una aplicación web que permite listar y eliminar estos recursos, una interfaz de programación de aplicaciones RESTful que actúa como servidor central para recopilar información, y un agente, residente en el sistema operativo, que envía periódicamente datos de la máquina a este servidor. Sistema gestor de recursos per a una arquitectura grid que consta d'una aplicació web que permet llistar i eliminar aquests recursos, una ...

  2. Servidor para uniformizar el manejo de distintos analizadores de redes

    OpenAIRE

    OLMO ESTEBAN, RUBÉN DEL

    2013-01-01

    El proyecto trata de ofrecer una interfaz remota unificada para manejar los analizadores de redes del laboratorio de microondas de la Escuela Técnica Superior de Ingenieros de Telecomunicacion en la Universidad Politécnica de Valencia. Para ello se ha utilizado un servidor Web y un programa que hace de puente entre este servidor y los analizadores. The project provides a unified remote inferface for utilizing the microwave analyzer of the microwave laboratory of escuela técnica superior de...

  3. Una técnica para filtrar patrones de fringing

    Science.gov (United States)

    Ostrov, P. G.

    Se presenta una nueva técnica para filtrar los patrones de fringing producidos en los CCDs tipo RCA. El método consiste en construir un mapa con los ángulos de inclinación de las franjas en cada punto de la imagen. Este mapa es ulteriormente utilizado para alinear con el patrón de interferencia una ventana estrecha, sobre la que se aplica un filtro de mediana. Este procedimiento permite eliminar la mayor parte del ruido del patrón de fringing sin destruirlo.

  4. Algoritmo del elipsoide interior para programación lineal

    OpenAIRE

    Salamanca Fernández, Ángel; Juan Ruiz, Jesús

    1991-01-01

    En este artículo se desarrolla un algoritmo de puntos interiores para programación lineal a partir de consideraciones geométricas. En cada iteración del método se dispone de un punto interior al politopo. Con centro en dicho punto se obtiene un elipsoide interior a dicho politopo. La optimización de la función objetivo lineal sobre el elipsoide se obtiene mediante la solución de un problema de mínimos cuadrados. El punto resultante se adopta para la siguiente iteración. Se proponen dos método...

  5. Un nuevo modelo para abordar el protocolo familiar

    OpenAIRE

    Rodríguez Zapatero, M.; Rodríguez Jiménez, Magdalena; Rodríguez Alcaide, J.J.

    2014-01-01

    Entender y gestionar la singularidad de la empresa familiar es determinante para mejorar las posibilidades de transmisión de la misma a generaciones futuras. Las estadísticas, año tras año, vienen a confirmar bajos índices de supervivencia en el traspaso generacional de la empresa familiar; Es por ello que desarrollar herramientas, que permitan y faciliten la comprensión y gestión de dicha singularidad, generará sin duda un fuerte valor añadido y ventaja competitiva para la familia empresaria...

  6. El arroyo Azul como escenario para el aprendizaje escolar

    OpenAIRE

    Rudzik, Gabriela; Merlos, Cristina; Grosman, Fabián

    2007-01-01

    La Educación Ambiental constituye el pilar básico para una sociedad con alta conciencia ecológica, lo cual se logra con información (Abaca y Vila, 1992). En este marco, la premisa que lo que se conoce se quiere y respeta (Arango et al., 2002), es un principio capital aplicable a nuestro medio natural. Conforma una importante y determinante herramienta para promover la participación del ciudadano en el desarrollo armónico; de allí la relevancia de su inclusión en las currículas educativas en t...

  7. Herramientas CASE para ingeniería de Requisitos

    Directory of Open Access Journals (Sweden)

    Andrea Alarcon

    2008-10-01

    Full Text Available En este artículo se presentan apartes del resultado de la investigación sobre algunas herramientas CASE que apoyan las tareas de la Ingeniería de Requisitos (IR. Dicha fase esta contemplada en el proceso de Ingenieríade Software para el desarrollo de proyectos informáticos. Además se pretende analizar, sistematizar e integrarlos resultados del estudio con el fin de determinarlas principales características, ventajas y desventajas de una herramienta CASE para la IR.

  8. La innovación, clave para la competitividad empresarial

    OpenAIRE

    Amparo Moraleda

    2004-01-01

    La integración entre tecnología y negocio es un factor clave para la competitividad de las empresas. Es decir, la tecnología aplicada al ámbito empresarial carece de sentido si no se considera como una herramienta integrada en los procesos de la empresa. Las empresas deben adoptar, por tanto, una política innovadora, donde la tecnología juegue un papel estratégico en el diseño de los modelos de negocio, para convertirse en entidades competitivas, ágiles y eficaces. ...

  9. Sistemas tomográficos multimodalidad para animales de laboratorio

    OpenAIRE

    Lage Negro, Eduardo

    2010-01-01

    Esta Tesis Doctoral explora alternativas tecnológicas para la implementación de sistemas PET y SPECT para roedores así como la integración de los mismos con sistemas tomográficos de rayos X. Específicamente, se aborda el problema de optimizar el rendimiento de los escáneres basados en anillos parciales de detectores debido a que además de ser una solución menos costosa que los equipos basados en anillos completos, permiten la integración de un sistema de imagen anatómica de forma coplanar. Lo...

  10. Infraestructura de eventos para la Internet de las cosas.

    OpenAIRE

    Requena Camacho, Roberto

    2014-01-01

    El Internet de las Cosas, como paradigma para la conexión de los objetos cotidianos a Internet, está suponiendo una revolución en cuanto a la forma en que se interactúa con el entorno. Su uso permite aprovechar con mayor eficiencia las posibilidades que este nos ofrece. Este hecho, está dando lugar a un auge en el esfuerzo que se realiza para desarrollar tecnologías y estándares que soporten las características que requieren este tipo de escenarios. Gracias al Internet de las C...

  11. CARIBE 71, UNA VARIEDAD DE CEBOLLA PARA CLIMA TROPICAL

    OpenAIRE

    Laura Muñoz; Prats, A

    2004-01-01

    En la Estación Experimental Agronómica de Santiago de las Vegas, actual Instituto de Investigaciones Fundamentales en Agricultura Tropical "Alejandro de Humbolt" (INIFAT) del Ministerio de la Agricultura (MINAG), se desarrollaron una serie de investigaciones con el objetivo de mejorar la producción de cebolla en el país. Se determinó la problemática que presentaba el cultivo para la producción comercial y se consideró que era necesario desarrollar variedades para condiciones tropicales, de la...

  12. Metodología para el dibujo a mano alzada

    OpenAIRE

    Yamila Irene Cordovés Pérez

    2015-01-01

    Se realizó una investigación con el objetivo de elaborar una Metodología para el dibujo a mano alzada. Para la elaboración de la misma, se partió de las insuficiencias encontradas en Programas Analíticos de las enseñanzas: Secundaria Básica, Técnica y Profesional y Educación Superior, por la necesidad de impartir el contenido de Croquizado, siendo no tratado por autores de la actualidad, debido a que los adelantos científico-técnicos, imponen realizar dibujos mediante el uso de recurs...

  13. Comunicaciones para cómputo paralelo intercluster

    OpenAIRE

    Aróztegui, Walter J.; Romero, Fernando; Tinetti, Fernando Gustavo

    2006-01-01

    Esta línea de investigación se orienta a resolver el problema general de las comunicaciones entre clusters usados para cómputo paralelo. La idea e partida es todo lo conocido de cómputo paralelo en clusters. En este sentido, utilizar más de un cluster para cómputo paralelo se puede considerar como una extensión natural del procesamiento paralelo en plataformas de cómputo distribuidas. En esta línea de investigación se busca, por lo tanto, resolver el problema de comunicar procesos en difer...

  14. La electrolisis salina para el tratamiento de aguas de lastre

    OpenAIRE

    Mesa Salvany, Daniel

    2014-01-01

    El objetivo principal del proyecto, es el desarrollo de equipos electrolíticos para el tratamiento de aguas de lastre, acorde con los requerimientos de la normativa, y los del sector. Para ello, los objetivos específicos, son:  Definición de los requerimientos de la tecnología, teniendo en consideración todas las normativas navales que afecten al proyecto.  Definición de los requerimientos de la tecnología, teniendo en consideración todas las especificaciones técnicas y comerciales qu...

  15. Sensor perfeccionado para la medida de la toxicidad del agua

    OpenAIRE

    Campo García, Francisco Javier del; Mas Gordi, Jordi

    2009-01-01

    La invención se basa en un sensor de medida para la toxidad del agua y consiste en una red de micro-electrodos recubiertos de una membrana y de un biofilm. La red de micro-electrodos puede ser estándar, y es posible su funcionamiento con un único electrodo, aunque ello acarrearía una perdida de sensibilidad. La membrana se usa para evitar la pasivación del electrodo por las bacterias presentes en el agua, y se utilizará en una de las realizaciones posibles "Nafion", aunque también es posible ...

  16. Recomendaciones para una presentación oral

    OpenAIRE

    Pulpón Segura, Anna M.; Icart Isern, M. Teresa (Maria Teresa); Nolla i Domenjó, Maria; Caja López, Carmen; Solà Pola, Montserrat

    2002-01-01

    Los profesionales de la salud deben ser competentes en el desarrollo de su disciplina pero además deberán ser hábiles en el manejo de las herramientas destinadas a la comunicación, cuyo uso será necesario en algún momento de su carrera profesional. El presente artículo describe algunos de los elementos que intervienen antes, durante y después de la comunicación oral y que pueden ser útiles para mejorar las habilidades personales para realizar una exposición oral. Enfrentarse a una audiencia p...

  17. Modelado del estudiante para ambientes virtuales de aprendizaje en Web

    OpenAIRE

    Rafael Morales Gamboa

    2007-01-01

    En este artículo se proporciona un análisis de la migración del proceso de modelado del estudiante desde los sistemas tutores inteligentes al contexto de la educación en la virtualidad (e-learning), de las implicaciones para las plataformas de educación en la virtualidad en términos de adaptaciones para apoyar el proceso de modelado del estudiante y de la funcionalidad esperada en una nueva generación de ambientes inteligentes de aprendizaje. Dicho análisis está basado en mi experiencia recie...

  18. La Holding Estrategia Fiscal Para las Empresas Familiares

    OpenAIRE

    Rosa Hilda Hernandez Sandoval; Sandra Patricia de la Garza Cienfuegos; Laura Leticia Gaona Tamez

    2010-01-01

    La presente investigación se realizó en Monclova, Coah., en el año 2011 y tiene por objeto constituir una empresa holding para obtener beneficios fiscales sin caer en la evasión o elusión fiscal, esta alternativa permite controlar desde la cúspide a las demás empresas subsidiarias que han sido creadas. Los resultados muestran que existen en México 4,862 empresas familiares que consolidan para efectos fiscales, las cuales se encuentran integradas en 422 grupos. En este régimen de fiscalización...

  19. Anotaciones para un crecimiento previsivo y con desarrollo

    OpenAIRE

    Duque Escobar, Gonzalo

    2011-01-01

    Ahora que la exploración avanza por todos los rincones de la geografía colombiana, obliga a prevenir las consecuencia de una minería extractiva, donde oro e hidrocarburos cobran valor estratégico y son fórmula para movilizar una locomotora clave para el crecimiento económico, pero que requiere operarse sin atropellar comunidades y generar conflictos, sin deteriorar el medio ambiente y el recurso hídrico, y sin comprometer el patrimonio de la nación, si lo que deseamos es el desarrollo.

  20. Sonata para piano Sz. 80 de Bartok: cuestiones interpretativas

    OpenAIRE

    Tudor, Alexandru

    2015-01-01

    Trabalho de Projeto apresentado à Escola Superior do Instituto Politécnico de Castelo Branco para cumprimento dos requisitos necessários à obtenção do grau de Mestre em Música – Área de Especialização em Piano. El objetivo principal de mi trabajo lo constituye el análisis de la Sonata para piano Sz. 80 (1926), pero representa en igual medida un acercamiento a la extraordinaria personalidad de su creador, el compositor húngaro Bela Bartok. Existe muchísima información con respecto a su o...

  1. Programación de tags para el desarrollo web

    OpenAIRE

    Sampedro Jiménez, Julián

    2008-01-01

    El proyecto PFC Taglib es una librería de componentes reutilizables de alto nivel para la capa de presentación (Look&Fell).El objetivo es proporcionar componentes que abstraigan a las aplicaciones los detalles de la capa de presentación como pueden ser usabilidad, cuestiones de diseño, código HTML, JavaScript, AJAX, CSS, etc. El proyecto está constituido en forma de Taglib ( Librería de Tags ) y por una aplicación para poner en práctica su funcionalidad.

  2. Plano de social media marketing para a TAP Portugal

    OpenAIRE

    Lopes, Andreia Cristina Figueiredo

    2014-01-01

    Mestrado em Marketing O social media marketing adquire cada vez maior relevo para as empresas e exige, tal como noutras áreas de marketing, a delineação de um plano estratégico por forma a potenciar o seu sucesso. Tomando como objecto de estudo a companhia aérea TAP Portugal, foi elaborado um Plano de Social Media Marketing, com base no modelo conceptual de Barker et al. (2013), designado de "Social Media Planning Cycle". Para a elaboração do Plano, foram recolhidos dados primários, seguin...

  3. Aprendizaje cooperativo para la ense??anza de la lengua

    OpenAIRE

    Trujillo S??ez, Fernando

    2002-01-01

    El presente art??culo es una reflexi??n en torno al papel del llamado ???aprendizaje cooperativo??? con relaci??n a la did??ctica de la lengua. Para ello se presentan tanto la definici??n de aprendizaje cooperativo como los modelos y t??cnicas m??s relevantes; por ??ltimo se plantea la inclusi??n del aprendizaje cooperativo en el marco de un aprendizaje por tareas y centrado en los contenidos curriculares, adem??s de intentar demostrar el doble valor de este enfoque, tanto para...

  4. Plan de negocios de alianza social para la calidad ASCALIDAD

    OpenAIRE

    Benavides Landinez, Luis Alberto; Hurtado Cardona, Edilma Isabel; Medina Cardozo, María Carolina

    2012-01-01

    Plan de Negocios de una empresa consultora con especialización en la auditoria, interventoría y asesoría a proyectos sociales en donde se analizan cada uno de elementos necesarios para su constitución y puesta en marcha y se adopta un modelo de auditoria e interventoría a programas sociales, para contribuir a la evaluación de la efectividad producida en los beneficiarios de éstos, en el que se avance de la dimensión descriptiva a la dimensión conceptual y metodológica y se constituya en h...

  5. Manual de casos administrativos para el sector agrario

    OpenAIRE

    Sánchez Zapata, Blanca Eugenia

    2006-01-01

    El trabajo es una aplicación del "método de casos", dentro del cual se desarrollan seis de ellos, complementados con la teoría e información pertinente. El método de casos, es una herramienta de docencia – aprendizaje ampliamente conocida y utilizada en varias universidades para la formación de administradores y otras profesiones. Para los casos del presente trabajo, se seleccionaron los temas teóricos que muestran la mayor diferencia metodológica en su aplicación a las empresas agrarias con ...

  6. El concepto de materialidad: implicaciones para gerentes e inversionistas

    OpenAIRE

    Ahmad Hussein Juma’h

    2014-01-01

    Se discuten las implicaciones de la materialidad de la información financiera sobre “manejo de los ingresos”. Implica la descripción y el análisis del contenido de la Codificación de Normas Contables™. Las perspectivas profesionales fueron utilizadas para confirmar la ausencia de directrices de importancia relativa en los Principios de Contabilidad Generalmente Aceptados (en inglés, PCGA) de los EE. UU. Los términos “materialidad”, “significancia” e “importancia” fueron usados para determinar...

  7. Aplicaciones multimedia para rehabilitación cognitiva

    OpenAIRE

    Ortega Bastida, Javier

    2016-01-01

    Diseño de aplicaciones multimedia que posibilitan la rehabilitación de los pacientes a través de aplicaciones de realidad virtual e interfaces 3D: manipulación virtual de entidades, texto predictivo y dibujo guiado sobre entrono integrado para sistema multisensor para rehabilitación e interacción de personas con discapacidad, tanto motora, como cognitiva. El sistema permite la realización de terapias utilizando distintos modos de interacción hombre-máquina, posibilitando múltiples modos de in...

  8. Una institución virtual para el aprendizaje colaborativo

    OpenAIRE

    Pilar Gómez Miranda; Fernando Vázquez Torres

    2005-01-01

    En este reporte de investigación se presentan los trabajos desarrollados en el proyecto de investigación titulado “Modelo de aprendizaje virtual basado en nuevas tecnologías para lograr un ambiente colaborativo centrado en el alumno”, con número de registro 20032009, de la Coordinación General de Programas e Investigación (CGPI) del IPN. En los apartados se muestran la aportación de un prototipo de una institución virtual centrado en el alumno para las carreras de Ciencias de la Informática e...

  9. Eje Cafetero: elementos para una visión prospectiva

    OpenAIRE

    Duque Escobar, Gonzalo

    2013-01-01

    Los siguientes proyectos de interés para el Eje Cafetero, se presentan en el marco del examen que la UTP y la Secretaría de Planeación de la Alcaldía de Pereira hacen del ejercicio de Prospectiva de la ciudad, donde se propone crear un Centro de Pensamiento para formular proyectos de impacto en la Ecorregión Cafetera que encuentren fuentes de financiamiento en el presupuesto nacional, una apuesta que obliga a integrar esfuerzos políticos, empresariales y académicos a nivel regional.

  10. Mecánica de medios continuos para ingenieros

    OpenAIRE

    Oliver Olivella, Xavier; Agelet de Saracibar Bosch, Carlos

    2002-01-01

    Mecánica de medios continuos para ingenieros pretende ser una herramienta para la formación de los ingenieros en la mecánica de medios continuos, que mantiene un equilibrio adecuado entre la rigurosidad de su planteamiento y la claridad de los principios físicos tratados. El contenido del texto está claramente dividido en dos partes, que se presentan secuencialmente. En la primera (capítulos 1 a 5), se introducen los aspectos fundamentales y descriptivos comunes a todos los medios continu...

  11. Maternidad vivida, una alternativa para la salud mental

    Directory of Open Access Journals (Sweden)

    Barroso Maritza

    1993-08-01

    Full Text Available

    Es un texto para quienes les interese el nacimiento de la vida humana: su iniciación, delicadeza, cambios físicos, emocionales y relacionales; los dos padres como gestores cada uno aportando su propia historia personal familiar y social. Nace este trabajo sobre la inquietud y experiencia de las autoras en el campo de la salud, no solo la salud desde el punto de vista físico, también la salud mental de los padres y el territorio seguro que estos elaboran relacionalmente para recibir una vida humana, en la cual los dos también trascienden.

  12. Maternidad vivida, una alternativa para la salud mental

    OpenAIRE

    Barroso Maritza; Villarraga de Ramírez Liliana

    2010-01-01

    Es un texto para quienes les interese el nacimiento de la vida humana: su iniciación, delicadeza, cambios físicos, emocionales y relacionales; los dos padres como gestores cada uno aportando su propia historia personal familiar y social. Nace este trabajo sobre la inquietud y experiencia de las autoras en el campo de la salud, no solo la salud desde el punto de vista físico, también la salud mental de los padres y el territorio seguro que estos elaboran relacionalmente para recibir u...

  13. El audiovisual como herramienta para dar a conocer la biblioteca.

    OpenAIRE

    Dueñas Herrero, Arturo

    2014-01-01

    Las bibliotecas han sido escenario de multitud de secuencias en pel??culas de ficci??n, dejando casi siempre una impresi??n de sitio cerrado, reservado para unos elegidos y vigilado por celosos(celosas, m??s bien) guardianes. Esta concepci??n tradicional ha ido cambiando para transmitir la idea de que la misi??n principal de las bibliotecas no es custodiar, sino difundir el conocimiento, m??s a??n en el caso de las bibliotecas universitarias, cuyo cometido es servir de apoyo a las tareas de d...

  14. HERRAMIENTAS AUTOMATIZADAS PARA LA GESTIÓN DE PROYECTOS

    Directory of Open Access Journals (Sweden)

    Anaisa Hernández González

    2006-12-01

    Full Text Available

    La dirección de proyectos implica la realización de un conjunto de procesos que generan y utilizan información que se usa durante el ciclo de vida del proyecto para controlarlo. En este trabajo se presentan algunas herramientas para la gestión integrada de proyectos, haciendo hincapié en el soporte que brindan a las áreas de conocimiento de la dirección de proyectos.

  15. Un polígono industrial para Manizales

    OpenAIRE

    Duque Escobar, Gonzalo

    2010-01-01

    Manizales debe atender la propuesta de un Polígono Industrial como parte de un Plan Maestro contemplado en el Plan de Acción Inmediato que ha formulado Corpocaldas para la cuenca de la Quebrada Manizales, donde además de contemplar un plan ambiental integral. Se señalan como estrategias fundamentales el reordenamiento del territorio para resolver profundos conflictos, y avanzar en la reconversión de nuestra industria apuntándole a la producción limpia y a la articulación sectorial entre ac...

  16. Verticalizadores para niños con discapacidad

    OpenAIRE

    Vargas, Karina; Bravo, Narcisa; Pánchez, Raúl

    2014-01-01

    El proyecto fue realizado para cubrir la necesidad básica como la falta de equipos para las terapias físicas en el Centro de Educación Especial AVINNFA, beneficiando así a familias del cantón Milagro que asisten al centro con sus hijos que padecen discapacidad severa. El mejoramiento de la calidad de vida, se apoya a que ellos reciban las terapias como la física, la cual estimula a desagraviar la falta de movimiento de los niños, especialmente los que padecen de Parálisis Cerebral Infantil (P...

  17. Un sistema para el mantenimiento de almacenes de datos.

    OpenAIRE

    GARCÍA GERARDO, CLEMENTE

    2008-01-01

    Un almacén de datos es una base de datos diseñada para dar soporte al proceso de toma de decisiones en una organización. Un sistema de almacén de datos integra en un único repositorio, información histórica procedente de distintas fuentes de datos operacionales de la organización o externas a ella. Para que el almacén de datos sea en todo momento un reflejo fiel de la organización a la que sirve, debe ser actualizado periódicamente. Este proceso puede consumir muchos recursos, y en algu...

  18. odelo de incubación para estudiantes emprendedores

    OpenAIRE

    Ana María Gutiérrez Huby

    2013-01-01

    El presente estudio tiene el cometido de formular un modelo de incubación empresarial apropiada para las realidades particulares de dos instituciones universitarias, la Facultad de Ciencias Contables de San Marcos y el Programa de Contaduría Pública del Centro Universitario de los Altos (CUALTOS) de la Universidad de Guadalajara.El enfoque es favorecer el desarrollo de la capacidad de gestión del alumnado de estas instituciones para desarrollar empresa a través de la puesta a su servicio de u...

  19. Caminhos para a gestão integrada do território no Vale do Paraíba de 1950 a 2004

    Directory of Open Access Journals (Sweden)

    José Luiz Ronca Caruso

    2004-01-01

    Full Text Available The Paraíba Valley region and its political-administrative frame. The region and its two phases of Planning: the economic development and the sustainable one. The Paraíba Valley Road System as a policy of the economic planning. The Paraíba Valley Region and its physical conformation: the Paraíba do Sul river basin. The water resources management in the Paraíba do Sul river basin. Two levels of management: the federal and the one of the State. The water resources Planning and its possibilities for a sustainable development of the region, through a comprehensive management

  20. Requisitos para um sistema de informação via web para compras de materiais para obras de construção civil

    OpenAIRE

    Andrade Neto, Flávio

    2010-01-01

    Resumo: Nas indústrias a função de compras está diretamente ligada à produção e, por conseguinte, na indústria da construção civil, diretamente ligada às obras. É necessária uma boa gestão de compras de materiais para garantir bom desempenho, qualidade e eficácia na produção. Através da função de compras circula grande parte dos recursos financeiros de uma empresa construtora, tomando a atividade um âmbito mais estratégico com aumento do foco das operações para atividades de planejamento e, s...