WorldWideScience

Sample records for cfe para cogeneracion

  1. Feasibility of the operation CFE`s conventional power plants for industrial cogeneration; Factibilidad de operar las centrales termoelectricas convencionales de la CFE para cogeneracion industrial

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, Eduardo H.; Acosta Torres, Rosa Aracely [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    An analysis is made on how cogeneration could help to maximize the power plant performance since thanks to cogeneration this type of power plants could utilize a part of the waste energy to be supplied to other processes. Also mention is made of the utilization of computer programs to help the design and the realization of functioning tests of this type of power plants. An economic evaluation is presented on the feasibility of operating this type of power plants as cogeneration units and it is concluded that the operation of fossil power plants in the cogeneration mode is not affected by the site where the power plant is located [Espanol] Se analiza como la cogeneracion podria ayudar a maximizar el rendimiento de las centrales termoelectricas ya que gracias a la cogeneracion este tipo de centrales podrian utilizar una parte de la energia desechada para suministrarla a otros procesos. Tambien se menciona la utilizacion de programas de computo para auxiliar en el diseno o realizacion de pruebas de funcionamiento sobre este tipo de plantas. Se presenta una evaluacion economica sobre la factibilidad de operar este tipo de plantas como unidades de cogeneracion y se concluye en que la operacion de centrales termoelectricas en modo de cogeneracion no se ve afectado por el sitio donde se encuentra la central

  2. Co-generation project for the Combined Cycle Power Plant President Juarez Rosarito and a reverse osmosis desalting plant; Proyecto de cogeneracion para la planta de ciclo combinado Presidente Juarez Rosarito y una planta desaladora de osmosis inversa

    Energy Technology Data Exchange (ETDEWEB)

    Beltran Mora, Hector; Espindola Hernandez, Salvador [Universidad NAcional Autonoma de Mexico (UNAM), Mexico, D.F. (Mexico)

    2006-11-15

    cogeneracion: produccion de electricidad y agua. El programa de operacion de la central desaladora estara determinado por la demanda de energia de la central de ciclo combinado; la propuesta es que la planta desaladora opere en las horas de baja carga de la central y pare cuando sean las hora pico de demanda de energia electrica. Para que este estudio sea representativo se han tomado las curvas de demanda de energia de las unidades de ciclo combinado de la Central Presidente Juarez Rosarito de la Comision Federal de Electricidad (CFE) y datos actualizados de las plantas desaladoras de osmosis inversa que estan disponibles actualmente en el mercado. Como base del estudio se determinaran los costos nivelados tanto de la energia electrica generada por la central de ciclo combinado operando dentro y fuera de un esquema de cogeneracion y los costos nivelados para el agua producida por la planta de osmosis inversa bajo dos supuestos: el primero es comprando la energia electrica a CFE y el segundo considerando que la CFE es duena de la planta desaladora y por tanto el costo de energia electrica para desalar es cero. Este trabajo muestra los impactos economicos en los costos de la generacion de energia electrica y en los del agua desalada en un esquema de cogeneracion. Los resultados mostrados en este estudio pueden considerarse para la futura planeacion en la construccion de plantas desaladoras para abastecer de agua en las zona noroeste del pais donde se tienen serios problemas de desabasto.

  3. Economic and environmental impact of the utilization of the industrial potential of viable cogeneration for period 1998 - 2007; Impacto economico y ambiental de aprovechamiento del potencial industrial de cogeneracion viable para el periodo 1998 - 2007

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, Gabriel; Mendoza Gonzslez, Lourdes [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2001-07-01

    The utilization of the industrial potential of cogeneration offers a significant contribution to the construction of the electrical infrastructure that the growth of the country will require for the period 1998 - 2007. The conditions of growth of the co-generation potential and their levels of utilization are related to a on isolated growth of the other inter actors of the processes of power supply; As levels of economic viability, economic savings to industry, requirements of additional electrical capacity, growth of the industrial activity, costs, use of fuels, environmental impact. Rates of average growth for period 1998 - 2007 are considered and what levels of economic and environmental benefit offers this development to the industry, to the electrical company and to the country. And to what proportion can contribute the utilization of the industrial potential of electrical cogeneration to the requirements of additional electrical capacity that will require the development of the country during this period. With the rates of viable growth of the co-generation the equivalent reduction of fuel consumption is estimated for the industrial sector, given by the improvement in the generation efficiency and with the change in the proportion of fuels used in Comision Federal de Electricidad (CFE) for this period. Evaluating the emissions of the main fuels avoided with this growth and its repercussion at national level via the CFE, and showing the possible international implications of this reduction. [Spanish] El aprovechamiento del potencial industrial de cogeneracion ofrece una significativa aportacion a la construccion de la infraestructura electrica que el crecimiento del pais requerira para el periodo 1998 -2007. Las condiciones de crecimiento del potencial de cogeneracion y sus niveles de aprovechamiento estan relacionados con un crecimiento o aislado de los demas inter actores de los procesos de abasto energetico; Como niveles de viabilidad economica, ahorros

  4. Cogeneration Systems; Sistemas de Cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez M, Manuel F; Huante P, Liborio; Romo M, Cesar A [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2006-07-01

    The present article deals on relevant aspects on the subject of cogeneration within the Mexican territorial limits. In the first place it is presented the role of Mexico in terms of its cogeneration potential, the type of service that has obtained from this predominant modality of cogeneration for self-supplying, the most propitious sectors to develop it, its legislations on the matter, the projects made for the implementation of cogeneration plants, as well as the existing cogeneration schemes for its respective optimization proposals. Without leaving out the analysis on the different types of evaluation on the efficiency of cogeneration systems and the aspects to consider for the election of a generation cycle. [Spanish] El presente articulo trata sobre aspectos relevantes en materia de cogeneracion dentro de los limites territoriales de la nacion mexicana. Se muestra en primer lugar el papel de Mexico en terminos de su potencial de cogeneracion, el tipo de servicio que ha obtenido de esta predominantemente (modalidad de cogeneracion para autoabastecimiento), los sectores mas propicios para desarrollarla, sus legislaciones al respecto, los proyectos realizados para la implementacion de plantas de cogeneracion, asi como los esquemas de cogeneracion existentes con sus respectivas propuestas de optimizacion. Sin dejar de lado el analisis sobre los distintos tipos de evaluacion de la eficiencia de sistemas de cogeneracion y los aspectos a considerar para la eleccion de un ciclo de generacion.

  5. System Aprend-e for the management of learning objects of support to the CFE operation; Sistema Aprend-e para la gestion de objetos de aprendizaje de apoyo a la operacion de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Argotte Ramos, Liliana Paz; Rodriguez Ortiz; Guillermo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Paredes Rivera, Jaime Israel [Comision Federal de Electricidad (CFE) (Mexico)

    2009-07-01

    In this article the system Aprend-e is described as an application of the technology of Learning Objects (LO) integrated to the qualification of the Comision Federal de Electricidad (CFE) personnel, company of the electrical sector in Mexico, as well as to promote the self-training based on LO. An introduction to standard SCORM and the proposed additions by the CFE to the goal-data is included. [Spanish] En este articulo se describe el sistema Aprend-e, como una aplicacion de la tecnologia de Objetos de Aprendizaje (OA) integrada a la capacitacion del personal de la Comision Federal de Electricidad (CFE), empresa del sector electrico en Mexico, asi como para promover el autoaprendizaje basado en OA. Se incluye una introduccion al estandar SCORM y las adiciones propuestas por la CFE a los metadatos.

  6. Boehringer Ingelheim Promeco contemplates the benefits of cogeneration in its new plant; Boehringer Ingelheim Promeco contempla beneficios de la cogeneracion para su nueva planta

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Esparza, R. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Khouri Solis, A. [Boehringer Ingelheim Promeco, Mexico, D. F. (Mexico)

    1997-12-31

    This paper presents the results of the feasibility study performed in BOEHRINGER INGELHEIM PROMECO to determine the benefits that a cogeneration system could render in satisfying the energy demand of its plant currently being expanded. The results showed that in accordance with the operation mode of the already expanded plant, the highest benefits could be obtained of a cogeneration system with a capacity of 1,600 Kw that would partially satisfy the thermal and electrical demands of BOEHRINGER INGELHEIM PROMECO. [Espanol] El presente articulo presenta los resultados de factibilidad que se realizo en Boehringer Ingelheim Promeco para determinar los beneficios que podria rendir un sistema de cogeneracion al satisfacer las demandas energeticas de su planta actualmente en ampliacion. Los resultados mostraron que de acuerdo al modo de operacion de la planta ya ampliada, los beneficios mas altos se obtendrian de un sistema de cogeneracion con capacidad de 1,600 kW que satisfaria parcialmente las demandas termicas y electricas de Boehringer Ingelheim Promeco.

  7. Distribution electric system simulator to support decision-making for CFE (Federal Electric Commission) Distribution Control Centers; Simulador del Sistema Electrico de Distribucion para apoyo en la toma de decisiones en Centros de Control de Distribucion de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa Reza, Alfredo; Quintero Reyes, Agustin; Garcia Mendoza, Raul; Calleros Torres, Tito Manuel [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Borjas Diaz, Jesus Fidel; Sierra Rodriguez, Benjamin; Torres Abrego, Rafael [Comision Federal de Electricidad (Mexico)

    2011-07-01

    This article presents the physical, logical and functional architecture designed to integrate the Electric Distribution System (EDS) simulator developed for the CFE and the electric energy Distribution Control Centers in Mexico. The objective of the EDS simulator is to integrate engineering distribution functions (power flow, short circuit, optimal reconfiguration and reliability, among others) and an expert system (Case-based Reasoning) to aid the process of information analysis, decision-making and the capacity-building of the CFE's Regional and Zonal Distribution Control Centers. The EDS simulator has been installed, updated and is operational in the Tampico Zone and the Gulf Division Distribution Center, as an established product that continually evolves along with the actual operating dynamics. [Spanish] Se presenta la arquitectura fisica, logica y funcional disenada para integrar el simulador del Sistema Electrico de Distribucion (SED) desarrollado para la Comision Federal de Electricidad (CFE) y los Centros de Control de Distribucion de energia electrica en Mexico. El objetivo del simulador del SED es integrar funciones de ingenieria de distribucion (flujo de potencia, corto circuito, reconfiguracion optima, confiabilidad, entre otras) y un sistema experto (Razonamiento Basado en Casos) para apoyar el proceso de analisis de informacion, la toma de decisiones y la capacitacion en los Centros de Control de Distribucion Zonales y Regionales de CFE. El Simulador del SED se encuentra instalado, actualizado y en operacion en la Zona Tampico y en la Division de Distribucion Golfo Centro como un producto consolidado y en constante evolucion a la par de la dinamica operativa real.

  8. Application of the Pinch analysis for the design of a cogeneration system in a paper mill; Aplicacion del analisis Pinch para el diseno de un sistema de cogeneracion en una industria papelera

    Energy Technology Data Exchange (ETDEWEB)

    Mani Gonzalez, A. G.; Arriola Medellin, A. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    The Pinch Analysis is a set of principles, tools and rules for the design that allow the engineer find the best way to configure the elements of a process. In the last ten years it has been utilized for the design of new processes as well as in the energy optimization of existing processes. In this paper the tools utilized for the integration of a cogeneration system in a process for the production of paper is presented. It is also presented how the combined treatment of the Pinch Analysis and the exergy concept allows to define, before the detailed design, the cogeneration potential, the fuel consumption and the amount of pollutant emissions for different cogeneration schemes. [Espanol] El analisis Pinch es un conjunto de principios, herramientas y reglas de diseno que permiten al ingeniero encontrar la mejor manera de configurar los elementos de un proceso. En los ultimos diez anos se ha utilizado para el diseno de procesos nuevos asi como en la optimacion energetica de procesos existentes. En el presente articulo se presentan las herramientas utilizadas para la integracion de un sistema de cogeneracion en un proceso de produccion de papel. Se muestra tambien como el tratamiento combinado del analisis Pinch y el concepto de energia permite definir, antes del diseno detallado, el potencial de cogeneracion, el consumo de combustible y la cantidad de emisiones contaminantes para diferentes esquemas de cogeneracion.

  9. Cogeneration in large processing power stations; Cogeneracion en grandes centrales de proceso

    Energy Technology Data Exchange (ETDEWEB)

    Munoz, Jose Manuel [Observatorio Ciudadano de la Energia A. C., (Mexico)

    2004-06-15

    , cervecerias, papeleras y plantas de celulosa, entre otras, con necesidades de vapor para sus procesos, tienen las condiciones tecnicas y economicas para cogenerar o sea, producir simultaneamente vapor y electricidad. De hecho, muchas de tales instalaciones que existen actualmente en cualquier pais, cuentan con equipos de cogeneracion que les permiten obtener su electricidad a un costo muy bajo, aprovechando la existencia de generadores de vapor que de cualquier forma son indispensables para satisfacer su demanda. En Mexico, dado el marco legal existente, tanto el servicio publico de electricidad como la industria petrolera son actividades de caracter obligatorio para el estado por estas razones, el tema debiera ser parte de la agenda de planeacion de dicho sector energetico. Las oportunidades a las que nos referimos, son validas para las industrias pequenas, pero desde el punto de vista del interes nacional, son mas importantes para las instalaciones de gran tamano y en ese rango, las mas numerosas estan precisamente en PEMEX, mientras que los grandes excedentes de energia y capacidad que resultarian de cogeneraciones en refinerias y petroquimicas serian de un alto valor, precisamente para el servicio publico de electricidad, o sea para la Comision Federal de Electricidad (CFE).

  10. Procedure to determine the convenience of installing a co-generation system; Procedimiento para determinar la conveniencia de instalar un sistema de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Colin Castellanos, Carlos; Acosta Torres, Aracely [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1992-12-31

    In this article a methodology for the selection of the co-generation system better adapted to the energy needs of an industry is presented, covering the following schemes: a) Satisfy the thermal demand and deliver to the net the excess electricity generated. b) Reduce the functioning level of the machine and produce electricity in accordance with the internal demand. The thermal demand will be satisfied, for instance, integrating a boiler in the cycle. c) Satisfy the electric demand and utilize only in part the available heat. d) Or else, reduce the operation level of the machine and produce only the necessary thermal energy, taking from the net the electric energy needed to cover the total demand. [Espanol] En este articulo se presenta una metodologia para la seleccion del sistema de cogeneracion que mejor se adapte a las necesidades energeticas de una industria, cubriendo los siguientes esquemas: a) Satisfacer la demanda termica y ceder a la red el exceso de energia electrica generada. b) Reducir el nivel de funcionamiento de la maquina y producir electricidad de acuerdo a la demanda interna. La demanda termica se cubrira, por ejemplo, integrando una caldera al ciclo. c) Satisfacer la demanda electrica y, utilizar solo en parte el calor disponible. d) O bien, reducir el nivel de operacion de la maquina y solo producir la energia termica necesaria, tomando de la red la energia electrica para cubrir la demanda total.

  11. First multivendor scheme in CFE to protection of 400 kV transmission line, using optical TC's, digital relays and bus IEC 61850-9-2; Primer esquema multivendedor en CFE para proteccion de linea de transmision de 400 kV, utilizando TC's opticos, relevadores digitales y bus IEC 61850-9-2

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Colon, V.R; Rasgado, J.P [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Lara C, H; Melendez, C; Juarez, N [Subdireccion de Transmision, Comision Federal de Electricidad (Mexico)

    2013-03-15

    This paper presents the details of design, installation and putting into service in the Comision Federal de Electricidad (CFE), of the first multi-vendor scheme that exists in the world, for the protection of a 400kV transmission line, which uses optical current transformers and digital relays IEC 61850-9-2. This system arises as a pilot project of the Subdireccion de Transmision of the CFE with the Instituto de Investigaciones Electricas (IIE). To ensure success in the implementation of the protection scheme, CFE joined a team coordinated by the Instituto de Investigaciones Electricas (IIE)involving nine international companies and a university. Pilot protection scheme is in operation under continuous monitoring, in one of the transmission lines of CFE that interconnect Manuel Moreno Torres with El Juile substations. The construction features, the challenges that were overcome and the first results obtained in operation are presented below. [Spanish] Este articulo presenta los detalles del diseno, instalacion y puesta en servicio en la Comision Federal de Electricidad (CFE) del primer esquema multivendedor que existe en el mundo, para la proteccion de una linea de transmision de 400kV, que utiliza transformadores de corriente opticos y relevadores digitales IEC 61850-9-2. Este sistema surge como un proyecto piloto de la Subdireccion de Transmision de la CFE con el Instituto de Investigaciones Electricas (IIE). Para asegurar el exito en la implementacion del esquema de proteccion, la CFE integro un equipo de trabajo coordinado por el Instituto de Investigaciones Electricas (IIE) en el que participaron 9 empresas internacionales y una universidad. El esquema de proteccion piloto, se encuentra en operacion bajo monitoreo continuo, en una de las lineas de transmision de la CFE que interconecta las subestaciones de Manuel Moreno Torres y El Juile. Las caracteristicas de construccion, los retos que fueron vencidos y los primeros resultados obtenidos en su operacion se

  12. Multimedia tutorial system to aid the technical training in energy cogeneration; Sistema tutorial multimedio para apoyar la capacitacion tecnica en cogeneracion de energia

    Energy Technology Data Exchange (ETDEWEB)

    Kemper Valverde, Nicolas; Lara Rosano, Felipe; Guerrero Briseno, Pedro [Laboratorio de Inteligencia Artificial, Instituto de Ingenieria UNAM, Mexico, D. F. (Mexico); Monedero De La Vega, Arturo F. [Seccion Ingenieria Energetica, DEPFI UNAM, Mexico, D. F. (Mexico)

    1994-12-31

    The incorporation of computer aided teaching technologies increases the efficiency in the transmission and acquisition of knowledge, allowing the handling of large information volumes, the knowledge homogenization among the students, the availability, the massive teaching and the permanent updating of the same. On the other hand, considering that all energy saving policy must be supported in a training and dissemination program of the respective energy technologies an immediate option is the use of computerized systems of teaching-learning. Precisely, in this paper, are presented the fundamental technical aspects for the development of a tutorial expert system, to aid the training in energy cogeneration, trying to integrate in the application, the usage of multimedia tools with the intelligent handling of the teaching-learning process through the inference machine of an expert system. [Espanol] La incorporacion de metodologias de ensenanza auxiliada por computadora incrementa la eficiencia en la transmision y adquisicion del conocimiento, permitiendo la manipulacion de grandes volumenes de informacion, la homogeneizacion del conocimiento en los educandos, la disponibilidad, masificacion y la permanente actualizacion del mismo. Por otro lado, considerando que toda politica de ahorro de energia debe estar soportada en un programa de capacitacion y de divulgacion de las tecnologias energeticas respectivas, una alternativa inmediata es el empleo de sistemas computarizados de ensenanza-aprendizaje. Precisamente, en este trabajo, se presenta los aspectos tecnicos fundamentales del desarrollo de un sistema experto tutorial para apoyar la capacitacion en cogeneracion de energia, tratando de integrar en la aplicacion, el empleo de las herramientas multimedios con el manejo inteligente del proceso de ensenanza-aprendizaje a traves de la maquina de inferencia de un sistema experto.

  13. Economic and environmental advantages for the utilization of the industrial potential of cogeneration in Mexico; Ventajas economicas y ambientales para el aprovechamiento del potencial industrial de cogeneracion en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, G [Division de Estudios Posgrado, Facultad de ingenieria, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2003-01-15

    Mexico has an industrial cogeneration potential very important, not evaluated or projected within its historical growth. The objective of the present work consist of studying the industrial cogeneration potential that exists in Mexico, as well as the economic and environmental savings that it would be achieved if one took advantage of this potential. As a result of the present work we can conclude that the cogeneration in Mexico offers a theoretical potential middle of 28,000 MWe to the 2007. It is estimated an economic saving potential in the construction of generation infrastructure electrical, for the high stage of its utilization of almost 7000 million dollars and a stage of emissions reduction of 2007- 21.4%, instead of 2007- 0.35%, for the industrial sector of the country. Provided that change the vision of the government of seeing to the cogeneration as a measure of energy saving and substitute it by that of political of complement to the development of the national electrical sector. [Spanish] Mexico tiene un importante potencial de cogeneracion industrial que no ha sido evaluado ni proyectado dentro de su crecimiento historico, por ello, el objetito de este trabajo consiste en estudiar y conocer los ahorros economicos y ambientales que se podrian lograr si se aprovechara dicho potencial. Como resultado, se muestra que la cogeneracion en Mexico ofrece un potencial teorico medio de 28,000 MW e al ano 2007. Se estima tambien un ahorro economico en la construccion de infraestructura de generacion electrica para el escenario alto de su aprovechamiento de casi 7000 mdd, y un escenario de reduccion de emisiones para el sector industrial del pais de un 0.35% a un 21.47% para el ano 2007. Estos pronosticos se pueden lograr, siempre y cunado el gobierno cambie la vision de manejar este tema como una medida de ahorro de energia, y la sustituya por la politica de complemento al desarrollo del sector electrico nacional.

  14. Economic and environmental advantages for the use of the industrial potential of cogeneration in Mexico City; Ventajas economicas y ambientales para el aprovechamiento del potencial industrial de cogeneracion en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, G. [Division de Estudios de Posgrado, Facultad de Ingenieria, UNAM, Mexico, D.F. (Mexico)

    2003-03-01

    Mexico has an industrial cogeneration potential very important, not evaluated or projected within its historical growth. The objective of the present work consist of studying the industrial cogeneration potential that exists in Mexico, as well as the economic and environmental savings that it would be achieved if one took advantage of this potential. As a result of the present work we can conclude that the cogeneration in Mexico offers a theoretical potential middle of 28,000 MWe to the 2007. It is estimated an economic saving potential in the construction of generation infrastructure electrical, for the high stage of its utilization of almost 7000 million of dollars and a stage of emissions reduction of 2007- 21.37% instead of 2007- 0.35% for the industrial sector of the country. These prognoses can be obtained, as long as the government changes vision to handle this subject as a measure of energy saving, and substitute it by the policy of complement the development of the national electrical sector. [Spanish] Mexico tiene un importante potencial de cogeneracion industrial que no ha sido evaluado ni proyectado dentro de su crecimiento historico, por ello, el objetivo de este trabajo consiste en estudiar y conocer los ahorros economicos y ambientales que se podrian lograr si se aprovechara dicho potencial. Como resultado, se muestra que la cogeneracion en Mexico ofrece un potencial teorico medio de 28,000 MWe al ano 2007. Se estima tambien un ahorro economico en la construccion de infraestructura de generacion electrica para el escenario alto de su aprovechamiento de casi 7 000 mdd, y un escenario de reduccion de emisiones para el sector industrial del pais de un 0.35% a un 21.4% para el ano 2007. Estos pronosticos se pueden lograr, siempre y cuando el gobierno cambie la vision de manejar este tema como una medida de ahorro de energia, y la sustituya por la politica de complemento al desarrollo del sector electrico nacional.

  15. Basic semantic architecture of interoperability for the intelligent distribution in the CFE electrical system; Arquitectura base de interoperabilidad semantica para el sistema electrico de distribucion inteligente en la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa Reza, Alfredo; Garcia Mendoza, Raul; Borja Diaz, Jesus Fidel; Sierra Rodriguez, Benjamin [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2010-07-01

    The physical and logical architecture of the interoperability platform defined for the distribution management systems (DMS), of the Distribution Subdivision of Comision Federal de Electricidad (CFE) in Mexico is presented. The adopted architecture includes the definition of a technological platform to manage the exchange of information between systems and applications, sustained in the Model of Common Information (CIM), established in norms IEC61968 and IEC 61970. The architecture based on SSOA (Semantic Services Oriented Architecture), on EIB (Enterprise Integration Bus) and on GID (Generic Interface Definition) is presented, as well as the sequence to obtain the interoperability of systems related to the Distribution Management of the of electrical energy in Mexico. Of equal way it is described the process to establish a Semantic Model of the Electrical System of Distribution (SED) and the creation of instances CIM/XML, oriented to the interoperability of the information systems in the DMS scope, by means of the interchange of messages conformed and validated according to the structure obtained and agreed to the rules established by Model CIM. In this way, the messages and the information interchanged among systems, assure the compatibility and correct interpretation in an independent way to the developer, mark or manufacturer of the system source and destiny. The primary target is to establish the infrastructure semantic base of interoperability, cradle in standards that sustain the strategic definition of an Electrical System of Intelligent Distribution (SEDI) in Mexico. [Spanish] Se presenta la arquitectura fisica y logica de la plataforma de interoperabilidad definida para los sistemas de gestion de la distribucion (DMS por sus siglas en ingles), de la Subdireccion de Distribucion de la Comision Federal de Electricidad (CFE) en Mexico. La arquitectura adoptada incluye la definicion de una plataforma tecnologica para gestionar el intercambio de informacion

  16. Higher physics for CFE

    CERN Document Server

    Chmabers, Paul; Moore, Ian

    2013-01-01

    Higher Physics for CfE provides complete coverage of the latest SQA syllabus for the Revised Higher (for examination 2012 onwards), and is also tailored specifically to the extended requirements, teaching approaches and syllabus outlines detailed in the Higher revisions for Curriculum for Excellence. It will therefore be appropriate for all new Higher Physics syllabus requirements from 2012 onwards. Each section of the book matches a unit of the CfE syllabus; each chapter corresponds to a content area. The text is composed of three units: Our Dynamic Universe, Particles and Waves, and Electric

  17. Higher English for CFE

    CERN Document Server

    Cunningham, Carolyn

    2015-01-01

    A comprehensive working guide to the the Critical Reading section of Higher English for CfE - worth 40% of available marks in the exam!. Critical Reading (Scottish text questions and critical essay) is a very significant element of the new Higher English qualification. This book provides you with the support and advice you will need to succeed in this vital area, with a top expert guiding you through the course and suggesting approaches to the exam, so that you achieve the best grades you can. By focusing on specific examples of Scottish texts, this book enables you to increase your knowledge

  18. Co-generation and reality Potential in Mexico; Potencial de cogeneracion y realidad en Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Comision Nacional para el Ahorro de Energia (CONAE) (Mexico)

    2005-07-01

    This document deals with the Mexican use of co-generation -the efficient use of the energy- through the support offered by the Comision Nacional para el Ahorro de Energia (CONAE), since this is the agency in charge of fomenting the efficient use of energy by means of actions coordinated with diverse dependencies and organizations of the Administracion Publica Federal and with the governments of the federal entities as well as municipalities, social and private sectors. Among the subjects to be dealt are quality of the electrical and thermal energy, types of fuels that can be used in the co-generation project, the present situation of the co-generation in Mexico and the conditions for their development. [Spanish] Este documento analiza el uso de la cogeneracion en Mexico es decir, el uso eficiente de la energia a traves del apoyo que brinda la Comision Nacional para el Ahorro de Energia (CONAE) ya que es el organo encargado de fomentar la eficiencia en el uso de la energia mediante acciones coordinadas con las diversas dependencias y entidades de la Administracion Publica Federal y con los gobiernos de las entidades federativas y los municipios y, a traves de acciones concertadas, con los sectores social y privado. Se trataran temas como calidad de la energia electrica y termica, los tipos de combustibles que pueden utilizarse en el proyecto de cogeneracion, la situacion actual de la cogeneracion en Mexico y las ccondiciones para su desarrollo.

  19. Cogeneration projects in PEMEX refining; Proyectos de cogeneracion en PEMEX Refinacion

    Energy Technology Data Exchange (ETDEWEB)

    Becerra O' Leary, Jose [Petroleos Mexicanos (Mexico)

    2006-10-15

    Mexican Petroleum proposes the electric power cogeneration, the energy consumption and rationalization as well as the operative performance improvement. This is the reason Pemex refining considers the cogeneration projects development possibility related with the Refining National System to supply the six refineries with steam and electric power. And also the energy auto-supply to other Pemex refining, using the liquid and solid residuals as fuels for petroleum refining. [Spanish] Petroleos Mexicanos propone la Cogeneracion de energia electrica, el aprovechamiento y la racionalizacion del consumo de energia, asi como el mejoramiento del desempeno operativo, por lo cual Pemex Refinacion plantea la posibilidad del desarrollo de proyectos de Cogeneracion asociados a las refinerias del Sistema Nacional de Refinacion, para abastecer de vapor y energia electrica a cada una de las seis refinerias, asi como el autoabastecimiento de energia a otras instalaciones de Pemex Refinacion, utilizando como combustibles los residuales liquidos y solidos de la refinacion del petroleo.

  20. Experiences of energy saving and co-generation projects; Experiencias de proyectos de ahorro de energia y cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez Barajas, Alberto [Heat and Power Systems, S.A. de C.V., Mexico D.F. (Mexico)

    2005-07-01

    In this document are presented the successful projects of energy saving and co-generation that Heat and Power Systems, S.A. de C.V. has made in diverse industries. The investment recovery periods have been smaller to 18 months. The projects have been made for different companies within Mexican Republic. [Spanish] Se presentan los casos exitosos de proyectos de ahorro de energia y cogeneracion que Heat and Power Systems, S.A. de C.V. ha realizado en diversas industrias cuyo periodo de recuperacion de la inversion han sido menores a 18 meses. Los proyectos han sido realizados para distintas empresas dentro de la Republica Mexicana.

  1. How to pass higher French for CFE

    CERN Document Server

    Angus, Douglas

    2015-01-01

    Get your best grade with this guide to Higher French for CfE. We are working with SQA to gain endorsement for this title. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes - Prepare for the exam with top tips and hints on revision techniques - Get your best grade with advice on how to gain those vital extra marks

  2. Higher physics for CFE with answers

    CERN Document Server

    Chambers, Paul; Moore, Ian

    2013-01-01

    The only new textbook appropriate for all new Higher Physics syllabus requirements from 2012 onwards Higher Physics for CfE provides complete coverage of the latest SQA syllabus for the Revised Higher (for examination 2012 onwards), and is also tailored specifically to the extended requirements, teaching approaches and syllabus outlines detailed in the Higher revisions for Curriculum for Excellence. Each section of the book matches a unit of the CfE syllabus; each chapter corresponds to a content area. The text is composed of three units: Our Dynamic Universe, Particles and Waves, and Electric

  3. How to pass higher maths for CFE

    CERN Document Server

    Logan, Brian; Mitchell, John

    2015-01-01

    Get your best grade with this guide to Higher Maths for CfE. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) Maths exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes - Prepare for the exam with top tips and hints on revision techniques - Get your best grade with advice on how to gain those vital extra marks

  4. Cogeneration and Carbon bonds: clean development; Cogeneracion y bonos de carbono: desarrollo limpio

    Energy Technology Data Exchange (ETDEWEB)

    Navarro Perez, Nidia [Facultad de Contaduria y Administracion, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2004-06-15

    The growing preoccupation for the environment in our country and its interest to ratify the Kyoto Protocol with respect to the contamination of the atmosphere, offers great opportunities for the cogeneration so that it fortifies the scientific and technological research and gives a good international image about the sustainable development and care of the environment, so that companies that invest in clean technology will be able to assign a monetary value to their environmental patrimony, this through the so called Green Bonds or Carbon Bonds, this opens a new dimension to finance projects by means of these bonds that can be negotiated at an international level; by means of the Clean of Energy Production the investment can be stimulated and revenues for projects that contribute to the sustainable development of the country and the power efficiency. At the moment the country has at least 13 projects in different analysis stages to enter the carbon bond market, which are presented as co-generation projects of energy, in addition to the formation of the Mexican Committee for Projects of Reduction and Capture of Gas Discharges of Greenhouse Effect. [Spanish] La creciente preocupacion por el medio ambiente en nuestro pais y su interes por ratificar el Protocolo de Kyoto en lo referente a la contaminacion de la atmosfera, ofrece grandes oportunidades para la cogeneracion de manera que fortalezca la investigacion cientifica y tecnologica y dar una buena imagen internacional en torno a temas de desarrollo sustentable y cuidado del medio ambiente, de manera que empresas que invierten en tecnologia limpia podran asignar un valor monetario a su patrimonio ambiental, esto a traves de los llamados Bonos Verdes o Bonos de Carbono, esto abre una dimension nueva para financiar proyectos por medio de estos bonos que pueden negociarse a nivel internacional; por medio de la Produccion Limpia de energia se puede estimular inversion y ganancias para proyectos que contribuyan al

  5. Higher English language skills for CFE

    CERN Document Server

    Firth, Mary M; Mitchell, John

    2015-01-01

    A brand new edition of a bestselling title, updated for the newest Higher English (for CfE) syllabus. We are working with SQA to secure endorsement for this title. This book provides you with the support and advice you will need to succeed in Higher English. By studying literary techniques and with top experts guiding you through and explaining how to use these skills, you will be helped to understand why questions are framed in a particular way and how to answer them in a manner that ensures the highest possible grade. - Become more secure in your knowledge of the English language. - Learn ho

  6. Analysis and use of OLAP tools in the corporative information system of CFE; Analisis y empleo de herramientas OLAP en el sistema de informacion corporativa de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Jacome G, Norma E; Argotte R, Liliana P; Mejia L, Manuel [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2003-07-01

    The commercial tools Oracle Express and Oracle the Discoverer are presented, applied and compared. Both of them were applied in the context of the Data Storage that Comision Federal de Electricidad (CFE) develops, denominated Corporative Information System (SICORP) that involves the handling of large volumes of historical and present information. By the importance and the relevance that at the moment the subject of data storage has, the experiences that are described in the article are very useful for future developments. [Spanish] Se presentan, aplican y comparan las herramientas comerciales Oracle Express y Oracle Discoverer. Ambas fueron aplicadas en el contexto del Almacen de Datos que la Comision Federal de Electricidad (CFE) desarrolla, denominado Sistema de Informacion Corporativa (Sicorp), que involucra el manejo de grandes volumenes de informacion historica y actual. Por la importancia y el auge que actualmente tiene el tema de almacenes de datos, las experiencias que se describen en el articulo son de gran utilidad para futuros desarrollos.

  7. System of lower cogeneration in the cement industry; Sistema de cogeneracion inferior en la industria del cemento

    Energy Technology Data Exchange (ETDEWEB)

    Romero Paredes, H.; Vazquez, A; Ambriz, J. J.; Fosado, A.; Cedillo, D.; Sanchez, R. [Universidad Autonoma Metropolitana-Iztapalapa (Mexico)

    1999-07-01

    energeticos en la industria cementera representan entre el 30 y 60% de los costos de produccion, por lo que cualquier disminucion en su consumo, repercutira considerablemente en la productividad de la empresa. Para determinar la capacidad disponible de energia de desecho y establecer la dimension del sistema de cogeneracion se procedio primeramente a realizar los balances de materia y energia de un tren de produccion de cemento. Para la evaluacion y simulacion numerica se tomo un caso de estudio de una planta nacional. El analisis toma unicamente en cuenta el horno rotatorio, el precalcinador, el enfriador de gases o acondicionador, el enfriador del clinker y los separadores o recuperadores de polvo. En este estudio no se han considerado los molinos ni los sistemas electricos que operan en toda la planta. Los resultados muestran que existe en general un elevado potencial de cogeneracion pues en algunos casos las perdidas de calor pueden alcanzar hasta un 50% de la energia calorifica de entrada. La capacidad de generacion electrica mediante turbina de vapor al aprovechar una fraccion (del orden del 60%) del calor residual, puede ser entre 200 y 300 wats por kg. de clinker producido. En conclusion, al recuperar mediante intercambiadores de calor apropiados para cada uno de los equipos que se mencionaron la energia desperdiciada y una red de intercambio de calor optimizada mediante tecnicas modernas se puede generar una parte importante de la energia electrica que usa una planta cementera. El metodo empleado ha resultado muy atractivo y con la posibilidad de aplicarlo a cualquier planta cementera y asi evaluar los potenciales de cogeneracion de energia.

  8. Cogeneration in a plywood factory; Sistema de cogeneracion en una planta maderera

    Energy Technology Data Exchange (ETDEWEB)

    Castelazo Hernandez, Arturo; Mendoza Arcaraz, Alfonso [Ultra Energia, S. A. de C. V. Naucalpan (Mexico)

    1996-12-31

    back-pressure steam turbine. The back-pressure steam turbine exhaust will be used to heat up the thermal oil through a steam-thermal oil heat exchanger. [Espanol] La Cogeneracion, que es la produccion conjunta de dos manifestaciones de energia a partir de una misma fuente energetica, se presenta como una de las alternativas mas viables para lograr el aprovechamiento optimo de los recursos energeticos finitos. En las ultimas decadas en que el crecimiento economico de Mexico ha estado ligado a la generacion y suministro de energia electrica, el Estado ha fungido como organizador y director del sistema nacional de generacion electrica, sin embargo la intervencion de los particulares ha sido determinante. Debemos tomar en cuenta que para cubrir las necesidades futuras de electricidad del desarrollo nacional, se requeriran aproximadamente 17 mil MW adicionales, para lo cual la iniciativa privada, entre las que podemos destacar a la pequena y mediana industria, tendra despejado el camino para producirlos, aprovechando los cambios en la Ley y el Reglamento del Servicio Publico de Energia Electrica, publicados en el Diario Oficial de la Federacion los dias 23 de diciembre de 1992 y 31 de mayo de 1993 respectivamente. Al contar con un sistema de cogeneracion optimizado, el importe economico anual de la empresa maderera por concepto de energia (electricidad y combustible) se reducira sustancialmente. La empresa maderera requiere la instalacion de un sistema de cogeneracion que suministre 4.75 MWe y 1,861 KWt (1.6 Gcal/hr). La energia electrica se utilizara en la fabricacion de TABLONES DE NOVOPAN y la energia termica para calentar aceite que se utiliza en la presa de madera y en la preparacion de la emulsion utilizada en el proceso. Para satisfacer los requerimientos energeticos se han analizado 2 alternativas: 1. Generacion de energia electrica con un motor de combustion interna que utilice combustoleo como combustible, aprovechandose los gases de escape del motor para pre

  9. Cogeneration in a plywood factory; Sistema de cogeneracion en una planta maderera

    Energy Technology Data Exchange (ETDEWEB)

    Castelazo Hernandez, Arturo; Mendoza Arcaraz, Alfonso [Ultra Energia, S. A. de C. V. Naucalpan (Mexico)

    1996-12-31

    back-pressure steam turbine. The back-pressure steam turbine exhaust will be used to heat up the thermal oil through a steam-thermal oil heat exchanger. [Espanol] La Cogeneracion, que es la produccion conjunta de dos manifestaciones de energia a partir de una misma fuente energetica, se presenta como una de las alternativas mas viables para lograr el aprovechamiento optimo de los recursos energeticos finitos. En las ultimas decadas en que el crecimiento economico de Mexico ha estado ligado a la generacion y suministro de energia electrica, el Estado ha fungido como organizador y director del sistema nacional de generacion electrica, sin embargo la intervencion de los particulares ha sido determinante. Debemos tomar en cuenta que para cubrir las necesidades futuras de electricidad del desarrollo nacional, se requeriran aproximadamente 17 mil MW adicionales, para lo cual la iniciativa privada, entre las que podemos destacar a la pequena y mediana industria, tendra despejado el camino para producirlos, aprovechando los cambios en la Ley y el Reglamento del Servicio Publico de Energia Electrica, publicados en el Diario Oficial de la Federacion los dias 23 de diciembre de 1992 y 31 de mayo de 1993 respectivamente. Al contar con un sistema de cogeneracion optimizado, el importe economico anual de la empresa maderera por concepto de energia (electricidad y combustible) se reducira sustancialmente. La empresa maderera requiere la instalacion de un sistema de cogeneracion que suministre 4.75 MWe y 1,861 KWt (1.6 Gcal/hr). La energia electrica se utilizara en la fabricacion de TABLONES DE NOVOPAN y la energia termica para calentar aceite que se utiliza en la presa de madera y en la preparacion de la emulsion utilizada en el proceso. Para satisfacer los requerimientos energeticos se han analizado 2 alternativas: 1. Generacion de energia electrica con un motor de combustion interna que utilice combustoleo como combustible, aprovechandose los gases de escape del motor para pre

  10. Evaluation of the national cogeneration potential as an option for the expansion of the national electric system; Evaluacion del potencial nacional de cogeneracion como opcion en la expansion del sistema electrico nacional

    Energy Technology Data Exchange (ETDEWEB)

    Nieva Gomez, Rolando; Hernandez Galicia, Julio Alberto [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Portes Mascorro, Enrique; Alvarez Chavez, Jose Maria [Comision Nacional para el Ahorro de Energia (CONAE), Mexico, D. F. (Mexico)

    1997-12-31

    The Comision Nacional para el Ahorro de Energia (CONAE) carried out a study to determine the amount of electric energy available by cogeneration in the industrial sector of our country. This study is based in a survey among the enterprises with the largest fuel consumption belonging to the industrial and commercial sectors and to the petrochemical branch of Petroleos Mexicanos (PEMEX). The results of the study are presented, which show the location of the cogeneration potential by the following estimates: a) The scenario under a potential of 5770 MW to generate annually 4.55 x 107 MWh of electric energy. b) The scenario with a potential of 10819 MW to generate annually 9.47 x 107 Mwh of electric energy [Espanol] La Comision Nacional para el Ahorro de Energia (CONAE) llevo acabo un estudio para determinar la cantidad de energia electrica disponible por cogeneracion en el sector industrial de nuestro pais. El estudio se fundamenta en una encuesta entre las empresas con mayor consumo de combustibles pertenecientes a los sectores industrial y comercial y al ramo petroquimico de Petroleos Mexicanos (PEMEX). Se presentan los resultados del estudio, el cual muestra la ubicacion del potencial de cogeneracion por los siguientes estimados: a) El escenario bajo con un potencial de 5770 MW para producir anualmente 4.55 x 107 Mwh de energia electrica. b) El escenario alto con un potencial de 10819 MW para producir anualmente 9.47 x 107 MWh de energia electrica

  11. How to pass higher physics for CfE

    CERN Document Server

    Chambers, Paul; Mitchell, John

    2014-01-01

    Get your best grade with this guide to Higher Physics for CfE. We are working with SQA to gain endorsement for this title. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes. - Prepare for the exam with top tips and hints on revision techniques. - Get your best grade with advice on how to gain those vital extra marks

  12. Evaluation of avoided carbon dioxide emissions in cogeneration projects; Evaluacion de las emisiones evitadas de bioxido de carbono en proyectos de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Flores Zamudio, Jesus Antonio; Fernandez Montiel, Manuel Francisco; Alcaraz Calderon, Agustin Moises [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: jesus.flores@iie.org.mx; mffm@iie.org.mx; malcaraz@iie.org.mx

    2010-11-15

    In this paper, presents a methodology of how to calculate the emissions of CO{sub 2} (Carbon Dioxide) in cogeneration of plants for evaluate future cases with the type of fuel and fuel flow used in the plant. The methodology was in spreadsheets developed a series of stoichiometric balances. The methodology was done for three types of fossil fuels: solid, liquid and gas. The analysis is made only to the percentages of the items contained in the fuel flow automatically used and results in the combustion products in tons per hour. This method was compared with the results obtained in the software Thermoflow Inc. (Used in Gerencia de Procesos Termicos of Instituto de Investigaciones Electricas for evaluate various process systems that produce energy power) using different cogeneration systems, that is to say about the technology used emissions compared according to the amount of excess air for each type of technology and at one point before the gas cleaning systems. The results can be evaluated for emissions avoided through the fuel type used and developing a cogeneration plant compared to a conventional plant. [Spanish] En este articulo, se presenta una metodologia de como calcular las emisiones de CO{sub 2} (Bioxido de carbono) en plantas de cogeneracion, para evaluar casos a futuro por medio del tipo de combustible y flujo de combustible a utilizar en la planta. La metodologia se realizo en hojas de calculo, donde se desarrollaron una serie de balances estequiometricos. La metodologia se hizo para tres tipos de combustibles fosiles: solido, liquido y gas. El analisis se realiza con solo dar los porcentajes de los elementos que contiene el combustible y el flujo a utilizarse y automaticamente da como resultado los productos de la combustion en toneladas por hora. Esta metodologia se comparo con los resultados obtenidos en el software Thermoflow Inc. (Empleado en la Gerencia de Procesos Termicos del Instituto de Investigaciones Electricas para evaluar diversos

  13. Cogeneration in Mexico: Weaknesses, Threats, strengths and opportunities; Cogeneracion en Mexico: Debilidades, amenazas, fortalezas y oportunidades

    Energy Technology Data Exchange (ETDEWEB)

    Elizalde Baltierra, Alberto; Garcia Pelaez, Juan [Programa Universitario de Energia, UNAM (Mexico)

    1997-07-01

    In this paper the strategies are formulated and evaluated, taking into account the internal and external aspects of the cogeneration in Mexico that foment their development in the medium term (two or four years). In the formulation of strategies a matrix DAFO (Weaknesses, Threats, Strengths and Opportunities) is employed and in the evaluation is applied the procedure of analytical hierarchical structuring. The future on the cogeneration in the next years will depend on diverse factors, among which can be mentioned: the legal frame; the financial situation of the interested companies; the outsourcing of financing; the prices of the electricity and fuels, as well as their availability, among others. [Spanish] En este trabajo se formulan y evaluan estrategias que, tomando en cuenta los aspectos internos y externos de la cogeneracion en Mexico, fomenten su desarrollo en el mediano plazo (dos o cuatro anos). En la formulacion de estrategias se emplea la matriz DAFO (Debilidades, Amenazas, Fortalezas y Oportunidades) y en la evaluacion se aplica el procedimiento de jerarquizacion analitica. El futuro de la cogeneracion en los proximos anos dependera de diversos factores, entre los que se pueden mencionar: el marco legal; la situacion financiera de las empresas interesadas; las fuentes externas de financiamiento; los precios de la electricidad y de los combustibles, asi como su disponibilidad, entre otros.

  14. Prefeasibility analysis of a cogeneration project in the Mexican food industry; Analisis de prefactibilidad de un proyecto de cogeneracion en la industria alimenticia mexicana

    Energy Technology Data Exchange (ETDEWEB)

    Gongora Gonzalez, Guillermo; Castelazo Hernandez, Arturo [Ultra Energia, S. A. de C. V. Naucalpan (Mexico)

    1993-12-31

    The main technical and economical results of a prefeasibility study of an industry considered of medium size in the food area, which is a subsidiary of an American industrial merger, are shown. The above mentioned facility is located in the highland zone, its installed capacity is 2,350 electrical kw and 8,519 thermal kw needed for the optimum development of the productive process. Five technically feasible cogeneration options are analyzed, comparing the advantages and disadvantages of each option. Guides and conclusions for this type of projects are presented . [Espanol] Se muestran los principales resultados tecnicos y economicos de un estudio de prefactibilidad de una industria considerada como mediana de la rama alimenticia, la cual es filial de un consorcio industrial norteamericano. La planta mencionada se encuentra localizada en la zona del altiplano, cuya capacidad instalada es de 2,350 kW electricos y 8,519 kW termicos necesarios para el desarrollo optimo del proceso productivo. Se analizan cinco alternativas de cogeneracion tecnicamente viables, comparando las ventajas y desventajas de cada alternativa. Se presentan las recomendaciones y conclusiones para este tipo de proyectos.

  15. Cogeneration development in Mexico and its recent environmental impact; Desarrollo de la cogeneracion en Mexico y su reciente impacto ambiental

    Energy Technology Data Exchange (ETDEWEB)

    Elizalde Baltierra, Alberto; Garcia Pelaez, Juan [Universidad Nacional Autonoma de Mexico, Mexico, D. F. (Mexico)

    1996-12-31

    This paper presents the historical development of the electric auto supply systems and cogeneration in Mexico since 1942 to 1995 with the understanding that these are clearly differentiated and defined since 1992. Though it is not, but until 1994 when the first ex profeso permit for cogeneration was granted. It also develops a short prospective vision of the cogeneration in our country, as well as the fuel consumption employed by auto- supply systems during 1993. The pollution emissions to the environment are also analyzed and with it the environmental impact of these electric systems in this year. [Espanol] Se presenta el desarrollo historico de los sistemas de autoabastecimiento electrico y cogeneracion en Mexico desde 1942 a 1995, en el entendido que estos se diferencian y definen claramente desde 1992. Es, sin embargo, hasta 1994 cuando se otorgo el primer permiso ex profeso de cogeneracion. Se desarrolla, ademas, una breve vision prospectiva de la cogeneracion en nuestro pais. Asimismo, se analiza el consumo de combustibles empleados por los sistemas de autoabastecimiento en 1993. Se estiman las emisiones contaminantes a la atmosfera y con ello se valora el impacto ambiental de estos sistemas electricos en ese ano.

  16. Implementation impact of the modern automation technologies propitiated by Sicle in the Comision Federal de Electricidad (CFE) transmission substations; Impacto de la implantacion de tecnologias modernas de automatizacion propiciadas por el Sicle en las subestaciones de transmision de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez Arriola, Gustavo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-03-01

    This paper presents the anticipated implementation impact of the automation system (SICLE) (Sistema de Informacion y Control Local de Estacion) (Station Information and Local Control System) in Comision federal de Electricidad (CFE)`s organization, which includes the daily operation and the changes or influence in the control, protection, measurements, substations and power lines, and communications within the electricity transmission network. Likewise, the possible effects on the system suppliers and equipment manufacturers, as well as the Instituto de Investigaciones Electricas (IIE) participation in the development of applications in online monitoring for primary equipment maintenance, based on the principle named by condition or by requirement of the equipment itself. [Espanol] Se presenta el impacto previsto por la implantacion del sistema de automatizacion Sicle (Sistema de Informacion y Control Local de Estacion) en la organizacion de la CFE, lo que incluye la operacion diaria y cambios o influencia en las areas de control, proteccion, medicion, subestaciones y lineas y comunicaciones de la red de transmision. Asimismo, se presentan los posibles efectos en los proveedores de sistemas y los fabricantes de equipo, asi como la participacion del Instituto de Investigaciones Electricas (IIE) en el desarrollo de aplicaciones sobre monitoreo en linea para mantenimiento de equipo primario basado en el principio denominado por condicion o por requerimiento del mismo equipo.

  17. Gasification of heavy fuels to produce electrical energy and hydrogen; Gasificacion de combustibles pesados para producir energia electrica e hidrogeno

    Energy Technology Data Exchange (ETDEWEB)

    Vera Garcia, Oscar Alberto [Universidad Nacional Autonoma de Mexico(UNAM), Mexico, D.F. (Mexico)

    2006-11-15

    integrado (CCGI). El segundo, examina la incorporacion de un reactor shift en el cual el gas de sintesis se transforma en CO{sub 2} y H{sub 2} el cual se usa para mover la turbina a gas, adaptada para hidrogeno puro. Finalmente se estudia la cantidad de otros subproductos que se pueden obtener de estos ciclos de cogeneracion tales como CO{sub 2} para ser usado en recuperacion secundaria de pozos petroleros, N{sub 2} para ser usado en la industria de fertilizantes o en la propia produccion petrolera y H{sub 2} para ser usado en la industria petroquimica o en la generacion con celdas de combustible. Todos los casos son estudiados en forma cuantitativa, realizando los balances de masa y energia de cada uno de ellos. Para darle mas sentido practico a los calculos, se han tomado como base los datos tecnicos de la Central Valladolid de Comision Federal de Electricidad (CFE). Este articulo proporciona una idea basica, pero muy practica, para estimar el consumo de combustible de los diferentes modos de arreglo de una central CCGI, asi como los volumenes de los diferentes gases que se pueden producir y las modificaciones al tamano de los equipos que se requieren.

  18. Utilization of agricultural sugar cane wastes as fuel in modern cogeneration systems applied in sugar cane mills; Aprovechamiento de los residuos agricolas caneras como combustible en sistemas de cogeneracion modernos aplicados a ingenios

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, Eduardo H. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); De Buen Rodriguez, Odon [Comision Nacional para el Ahorro de la Energia, Mexico, D. F. (Mexico)

    1998-12-31

    Considering the new legal frame on cogeneration in Mexico, the possibility of heat and electricity supply required by the sugar mills to be made by an independent cogenerator of the sugar mill, operating with the sugar cane bagasse and agricultural sugar cane wastes, has been evaluated. Such modern cogenerator would be characterized, besides operating in an independent way of the sugar mill, by the use of high efficiency equipment in its process of heat and electricity generation. In this sense the Comision Nacional para el Ahorro de Energia (CONAE) through its Coordination Program and the Instituto de Investigaciones Electricas (IIE) carried out a joint project to determine the technical and economical viability that the sugar industry maintains the present sugar production without the need of burning fuel oil, installing adjacent to every sugar mill, a modern cogeneration system, operated by independent producers, that using sugar cane bagasse and agricultural sugar cane wastes, allows the supply of all the steam and electricity required by the sugar mill, and additionally can add firm capacity and the supply of electric power to the national grid, during the grinding season as well as out of grinding season. [Espanol] En consideracion al nuevo marco juridico de la cogeneracion en Mexico se ha evaluado la posibilidad de que el suministro de calor y electricidad requerido por los ingenios azucareros sea proporcionado por un cogenerador independiente de la planta de azucar, el cual opere utilizando el bagazo y residuos agricolas caneras (biomasa canera). Dicho cogenerador moderno se caracterizaria, ademas de operar de manera independiente a la planta de azucar, por el uso de equipos de alta eficiencia en su proceso de produccion de calor y electricidad. En este sentido la Comision Nacional para el Ahorro de Energia (CONAE) a traves de la Coordinacion de Programacion y el Instituto de Investigaciones Electricas (IIE) realizaron un trabajo en conjunto para determinar

  19. Control system modernization of a turbo-gas unit of CFE in the Comarca Lagunera; Modernizacion del sistema de control de una unidad turbogas de la CFE en la Comarca Lagunera

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez P, Marino; De Lara J, Salvador; Hernandez Muniz, Alfredo [Industria SIGRAMA, Cuernavaca, Morelos (Mexico); Garcia Cabello, Raymundo [Comision Federal de Electricidad (Mexico)

    2004-07-01

    At the present time, the turbo-gas units (TGU) make an important contribution in the development and growth of the national power sector, since this type of units pertaining to the Comision Federal de Electricidad (CFE) contributes with the 6.23% of the national production, that is to say, 2600 MW approx. The turbo-gas units are aero-derivative gas turbines used for power generation, pumping and compression. Generally, they are used to support urgent requests in the demand of electricity or, for the permanent supply of electrical energy in isolated zones. In addition, they are used to quickly get into and get out of operation, which requires high availability, trustworthiness and flexibility. In this sense, and with the intention of improving the operation of the TGUs, the Gerencia de Control e Instrumentation (GCI) (Management of Control and Instrumentation) of the Instituto de Investigaciones Electricas (IIE), has developed a control technology for this type of units, able to replace the original control systems of units with even 30 years of continuous operation or to be installed in new units. [Spanish] En la actualidad, las unidades de turbogas (UTG) tienen una importante contribucion en el desarrollo y crecimiento del sector energetico nacional, pues este tipo de unidades pertenecientes a la Comision Federal de Electricidad (CFE) aportan el 6.23% de la produccion nacional, es decir, 2600 MW aproximadamente. Las unidades turbogas son turbinas de gas aeroderivativas empleadas para la generacion electrica, bombeo y compresion. Por lo general, son utilizadas para apoyar solicitudes urgentes en la demanda de electricidad o bien, para el suministro permanente de energia electrica en zonas aisladas. Ademas, se usan para entrar y salir rapidamente en operacion, lo que requiere alta disponibilidad, confiabilidad y flexibilidad. En este sentido, y con la intencion de mejorar las UTG, la Gerencia de Control e Instrumentacion (GCI) del Instituto de Investigaciones

  20. Fuel-oil cogeneration plant for textile Industry. Central de cogeneracion a fueloleo para industria textil

    Energy Technology Data Exchange (ETDEWEB)

    Navarro Larrauri, M.; Diez Hernandez, J.; Villasante Diaz, A. (IDOM, Ingenieria y Consultoria, S.A. (Spain))

    1993-10-01

    Aznar S.A. is a textile factory especially sensitive to electricity distribution failures. They produce the subsequent shut down at the manufacturing process and several hours of maintenance tasks. A cogeneration plant has been installed to provide electricity and thermal energy to the process. Since the location is far from Natural Gas pipelines the system includes fuel-oil as energy source. Annual electricity production will be 23.300 MWh and 6.400 MWh of them will be exported into the grid. Fuel-oil consumption at the heat exchanger is reduced by 47%, but the whole factory consumption increases a 247% due to the high consumption of the engine. This increase is compensated by revenues from selling electricity and electricity savings. These facts, together with maintenance cost saving leads to a pay back time of 3.3. years. (Author)

  1. Experiences on energy saving in Comision Federal Electricidad (CFE) buildings; Experiencias de ahorro de energia en edificios de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez Velasco, Jorge E. [Comision Federal de Electricidad (CFE) (Mexico)

    2005-07-01

    This document describes the developed saving projects in buildings and generating power stations in 2004 by the Comision Federal de Electricidad (CFE). The projects considered are: buildings of the oficinas nacionales, Divisions of distribution office buildings, office buildings of production regions, construction deputy manager's office building, buildings of transmission and transformation, generating power stations, investments and savings of the projects in oficinas nacionales, divisions of distribution and construction subdivision buildings. From these projects the ones concluded in the 2004 were: Distribution Divisions, Gulf-Center Division, Center-West Distribution Division. The developing projects of 2005: oficinas nacionales, distribution divisions, Construction Subdivision, Generating Power Stations, Transmission Areas and office buildings. And finally, the projects concluded in the 2005 are the distribution divisions, the construction subdivision, the generating power stations, the office buildings, the minisplit units and their advantages with respect to the air conditioning window units. [Spanish] Este documento describe los proyectos de ahorro desarrollados en inmuebles y centrales generadoras en el ano 2004 por la Comision Federal de Electricidad (CFE), los proyectos tratados son: inmuebles de oficinas nacionales, inmuebles de divisiones de distribucion, inmuebles de regiones de produccion, inmuebles de la subdireccion de construccion, inmuebles de transmision y transformacion, centrales generadoras, inversiones y ahorros de los proyectos en inmuebles de oficinas nacionales y divisiones de distribucion y subdireccion de construccion. De dichos proyectos se tiene que los proyectos concluidos en el 2004 fueron: Divisiones de Distribucion, Division Golfo Centro, Division de Distribucion Centro Occidente. Los proyectos en desarrollo del 2005: oficinas nacionales, divisiones de distribucion, Subdireccion de Construccion, Centrales Generadoras, Areas

  2. Solvent extraction of rubidium from gold waste using conventional SX and new CFE methods

    Institute of Scientific and Technical Information of China (English)

    Mohammad Reza Tavakoli Mohammadi; Seyed Mohammad Javad Koleini; Sepideh Javanshir; Hossein Abolghasemi; Mahmoud Abdollahy

    2015-01-01

    Solvent extraction (SX) of rubidium (Rb) from leaching filtrate of gold waste (GW) in Mouteh Processing Plant by 18-crown-6 (18C6) was studied.High potential of new column flotoextraction (CFE) method in extraction of Rb from dilute solutions was also demonstrated.First,the factors affecting SX of Rb from a synthetic rubidium sulfate solution (containing 100 mg·L-1 Rb) were identified.0.05 mol·L-1 18C6 in kerosene,0.02 mol·L-1 picric acid in aqueous phase,aqueous to organic (A/O) ratio of 1,pH 7 and mixing time of 15 min are the optimum values for affective factors.The three-stage precipitation with sodium carbonate,pH adjustment with sulfuric acid and two-stage evaporation and crystallization were conducted to purify the leaching from impurities such as Fe,Al,Mn,Ca and especially competing cations of K and Na.Almost complete extraction of Rb and K from final filtrate containing 0.08 mol·L-1 picric acid was performed using 0.2 mol·L-1 18C6 in kerosene.The Rb and K strippings of 99.12 % and 9.93 %,respectively,are obtained with 2 mol·L-1 nitric acid with A/O ratio of 2.Finally,the performance comparison of the CFE and SX methods in similar conditions shows increased extraction of K and Rb by 16 % and 5 %,respectively,using CFE method.

  3. Fe3C/Fe nanoparticles with urea: Synthesis, structure and magnetic properties

    Science.gov (United States)

    Wang, Xiaobai; Zhang, Daguang; Ren, Xiaozhen; Gao, Jiajia; Han, Yu; Chen, Xiaodong; Shi, Zhan; Yang, Hua

    2016-12-01

    Fe3C/Fe nanocomposites were synthesized by a sol-gel method. Using urea as carbon source and reduce agent in the reaction process. The CTAB works as the surfactant and the bromine contained in CTAB plays a catalytic role. Appropriate choices of the amount of urea and CTAB, reaction temperature and time are very important to obtain high-quality of products. Above 650 °C, the precursor gel turned into the nanocomposites composed of iron carbide and iron. Their structures and magnetic properties are characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), and vibrating sample magnetometry (VSM). The possible formation mechanism of as-prepared nanostructures is discussed.

  4. Core-free rolled actuators for Braille displays using P(VDF-TrFE-CFE)

    Science.gov (United States)

    Levard, Thomas; Diglio, Paul J.; Lu, Sheng-Guo; Rahn, Christopher D.; Zhang, Q. M.

    2012-01-01

    Refreshable Braille displays require many small diameter actuators to move the pins. The electrostrictive P(VDF-TrFE-CFE) terpolymer can provide the high strain and actuation force under modest electric fields that are required for this application. In this paper, we develop core-free tubular actuators and integrate them into a 3 × 2 Braille cell. The terpolymer films are solution cast, stretched to 6 μm thick, electroded, laminated into a bilayer, rolled into a 2 mm diameter tube, bonded, and provided with top and bottom contacts. Experimental testing of 17 actuators demonstrates significant strains (up to 4%) and blocking forces (1 N) at moderate electric fields (100 MV m-1). A novel Braille cell is designed and fabricated using six of these actuators.

  5. Opportunities for the operation of the Comision Federal de Electricidad`s fossil fuel power plant stations eventually to be retired as cogeneration units; Oportunidades de operar las centrales termoelectricas de la Comision Federal de Electricidad, eventualmente retirables como unidades de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, E. H. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Merlos Rueda, R. M. [Programa de Ahorro de Energia para el Sector Electrico, Mexico, D. F. (Mexico)

    1995-12-31

    The Programa de Ahorro de Energia para el Sector Electrico (PAESE) (Program for Energy Conservation for the Electric Sector) in collaboration with the Instituto de Investigaciones Electricas (IIE), decided to evaluate technically and economically the possibilities of operating the Comision Federal de Electricidad`s Thermoelectric Power Stations (TPS), eventually to be retired as cogeneration units in supplying thermal energy to industry. The study was focussed to the Monterrey and San Jeronimo Power Stations, determining in a first stage, the optimum radius for handling and transporting steam and/or hot water and so to define the industries that potentially could obtain heat energy from the TPS, in this stage the thermal needs of the evaluated industries were determined (pressure, temperature and flow). In a second stage, the different arrangements to be made to operate the selected TPS, so as to be in position of satisfying such thermal energy demands were evaluated. This paper presents the results of this study. [Espanol] El Programa de Ahorro de Energia para el Sector Electrico (PAESE), en colaboracion con el Instituto de Investigaciones Electricas, decidieron evaluar tecnica y economicamente las posibilidades de operar las centrales termoelectricas (CT`s) de la Comision Federal de Electricidad, eventualmente retirables, como unidades de cogeneracion al ofrecer calor a la industria. El estudio se enfoco en las centrales de Monterrey y San Jeronimo, determinado en una primera etapa el radio optimo para el manejo y transporte de vapor y/o agua caliente y asi definir a las industrias que potencialmente podrian recibir calor de las CT`s, en esta etapa se determinaron las necesidades termicas de las industrias evaluadas (presion, temperatura y flujo). En una segunda etapa se evaluo los diferentes arreglos para operar las CT`s seleccionadas para que pudieran satisfacer dichas demandas termicas. En este trabajo se presentaron los resultados de dicho estudio.

  6. Mitsubishi latest coal fired USC boiler technology (CFE Pacifico 700 MW)

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, T.; Sakamoto, K. [Mitsubishi Heavy Industries, Ltd., Nagasaki (Japan). Power Systems; Fujitab, M. [Mitsubishi Heavy Industries, Ltd., Yokohama (Japan). Power Systems

    2013-07-01

    Mitsubishi Heavy Industries, Ltd. (MHI) has successfully completed commissioning work for CFE (Comision Federal de Electricidad) Pacifico 700 MW coal-fired unit in March 2010 which is the first supercritical unit in Latin America. This supercritical boiler was designed with state of the art technologies such as low NOx burners, high fineness pulverizers, advanced vertical furnace wall technology and so on. Especially the advanced vertical furnace wall technology with some improvements is a key technology to realize swift load changes such as 5% load per minute ramping rate with assuring dynamic characteristics. Recently the requirement of the high efficiency and the swift load changes for the power boilers has been increased so that even a coal-fired unit needs flexible operation characteristics for balancing variety of power sources. One of the challenges for the swift load change is to keep the furnace wall metal temperature low during the load change, which the advanced vertical furnace wall could realize. The report describes the features of the unit and commissioning result including load swing test results in details.

  7. Automated Determination of [Fe/H] and [C/Fe] from Low-Resolution Spectroscopy

    CERN Document Server

    Marsteller, B; Sivarani, T; Rossi, S; Placco, V; Knapp, G R; Johnson, J A; Lucatello, S

    2009-01-01

    We develop an automated spectral synthesis technique for the estimation of metallicities ([Fe/H]) and carbon abundances ([C/Fe]) for metal-poor stars, including carbon-enhanced metal-poor stars, for which other methods may prove insufficient. This technique, autoMOOG, is designed to operate on relatively strong features visible in even low- to medium-resolution spectra, yielding results comparable to much more telescope-intensive high-resolution studies. We validate this method by comparison with 913 stars which have existing high-resolution and low- to medium-resolution to medium-resolution spectra, and that cover a wide range of stellar parameters. We find that at low metallicities ([Fe/H] < -2.0), we successfully recover both the metallicity and carbon abundance, where possible, with an accuracy of ~ 0.20 dex. At higher metallicities, due to issues of continuum placement in spectral normalization done prior to the running of autoMOOG, a general underestimate of the overall metallicity of a star is seen,...

  8. APS (Arizona Public Service Company)/CFE (Comision Federal de Electricidad) renewable energy mini-grid project in Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Mathai, C.V. [Arizona Public Service Co., Phoenix, AZ (United States)

    1998-09-01

    Arizona Public Service Company (APS) and Comision Federal de Electridad (CFE), the national electric utility of Mexico, have been collaborating over the past two years to assess the feasibility of using renewable energy technologies (solar and wind) for rural electrification. Mexico has thousands of remote villages that are not connected to the national electricity grid. President Zedillo`s Social Development Plan calls for electrifying these villages with the goal of improving the villagers` standard of living. APS and CFE have been monitoring solar and wind resources in several candidate villages in the states of Sonora and Baja California Sur (BCS) in Northwestern Mexico, and have selected San Juanico in BCS for a pilot project. Under this pilot project, the existing diesel generator and distribution system will be retrofitted with a hybrid (solar/wind/diesel) system that will have at least 2/3 of the total power generated coming from renewable energy resources. It will reduce operational costs as well as CO{sub 2} and other air pollution emissions. It will be the largest system of its kind on the American Continent. It is estimated that the hybrid system will reduce the CO{sub 2} emissions by 80%, compared to emissions from use of the existing diesel generator to provide the same energy. It is expected that the pilot project will be implemented by the end of 1997. (author)

  9. Comision Federal de Electricdad (CFE)`s corporate pilot data store; Desarrollo piloto del almacen de datos corporativos de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez Sustaeta, Jorge; Rodriguez Ortiz, Guillermo; Jacome Grajales, Norma Elena; Perez Ramirez, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    The objective of a data store is to permit the access to organizational or corporate data, to offer congruent data, to permit the separation or combination of data from the enterprise`s different points of view, to supply tools for interrogating, to analyze and present information quickly and to feed the re-engineering criteria of the enterprise. In this paper a project is described with two main objectives: first, to develop a pilot version of the corporate data store, considering data coming from diverse operational systems in the electric generation process, such as: SISTERMO (managing indexes of thermoelectric power generation), SISHIDRO (managing indexes for hydroelectric generation) and CB (fuel costs); and second, train its personnel in the development of methodologies and techniques of data storing, in order to prepare them to achieve the project with their own resources [Espanol] Los objetivos de un almacen de datos son permitir el acceso a datos organizacionales o corporativos, brindar datos congruentes, permitir separar o combinar datos desde los diversos puntos de vista de la empresa, proporcionar herramientas para interrogar, analizar y presentar informacion agilmente y alimentar los criterios de reingenieria de la empresa. En este articulo se describe un proyecto con dos objetivos principales: primero, desarrollar una version piloto del almacen de datos corporativos, considerando datos provenientes de diversos sistemas operacionales en el proceso de generacion de energia electrica, tales como: SISTERMO (indices de gestion de generacion termoelectrica), SISHIDRO (indices de gestion de generacion hidroelectrica) y CB (costos de combustible); y segundo, capacitar a su personal en las metodologias y tecnicas de desarrollo de almacenes de datos, con el fin de prepararlos para la consecucion del proyecto con sus propios recursos

  10. Development of a prototype of a Master Central Unit (MCU) for the automation of Distribution Control Centers; Desarrollo de un prototipo de Unidad Central Maestra (UCM) para la automatizacion de Centros de Control de Distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Uribe Blanco, Carlos Eduardo; Mata Almanza, Rafael; Picasso Blanquel, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2011-07-01

    For the purpose of contributing to the strategic plan and to the improvement of productivity and competitiveness levels, the Federal Electric Commission (CFE, Spanish acronym) is making a significant investment in human resources and materials to modernize electric energy supply systems, including monitoring, protection and automatic control for operating all the elements of the electrical process, from generating plants to transmission lines, distribution systems and commercial applications. With this modernization, the CFE is also creating the infrastructure for the interoperability and interconnectivity of the above systems, in such a way to enable it to broaden, continue and complement the functional integration of the linked institutional systems of the latest generation. The total integration of the systems will allow the CFE to move toward Intelligent Electric Networks. Therefore, the CFE requested help from the Electric Research Institute (IIE, Spanish acronym) to develop part of the infrastructure to modernize the automation of distribution. This consists of the development of a prototype of the supervision and control system, using interoperable open technology owned by the CFE which enables using the functions of a SCADA system (Supervisory Control And Data Acquisition) to supervise and control electric distribution networks. [Spanish] Con el proposito de contribuir al plan estrategico y mejoramiento de los niveles de productividad y competitividad, la Comision Federal de Electricidad (CFE) esta invirtiendo fuertemente en recursos humanos y materiales para la modernizacion de los sistemas de suministro de energia electrica, incluyendo el monitoreo, proteccion y control automatico para la operacion de todos los elementos del proceso electrico, desde los centros de generacion hasta las lineas de transmision, los sistemas de distribucion y las aplicaciones de comercializacion. Con dicha modernizacion, la CFE tambien esta generando la infraestructura para la

  11. "Diagnostico de la calidad del servicio en la zona Patzcuaro de CFE"

    OpenAIRE

    Baltierra Villa, Ramiro

    2011-01-01

    La presente investigación tiene como objetivo dianosticar el servicio de atención al cliente de la zona Pátzcuaro de la comisión Federal de Electricidad, determinar el estado tecnológico en que se encuentran los procesos de atención al cliente y evaluar la gestión laboral operativa del personal involucrado. Para dar respuesta al planteamiento el problema diganostico de la calidad del servicio en la zona Pátzcuaro se recurrirá a fuentes bibliográficas especializadas así como al Benchmarking....

  12. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  13. Recent nuclear technology advances of GE-H and GNF in partnership with CFE's Laguna Verde 2

    Energy Technology Data Exchange (ETDEWEB)

    Cuevas V, G.; Iwamoto, T.; Banfield, J. [GE-Hitachi Nuclear Energy Americas LLC, Global Nuclear Fuel - Americas LLC, 3901 Castle Hayne Road, Wilmington, 28401 North Carolina (United States); Calleros M, G., E-mail: Gabriel.Cuevas-Vivas@age.com [Comision Federal de Electricidad, Central Nucleoelectrica de Laguna Verde, Carretera Veracruz-Nautla Km 42.5, Alto Lucero, Veracruz (Mexico)

    2015-09-15

    This paper is presented based on work stemming from the long-standing technical partnership between Comision Federal de Electricidad (CFE) and Global Nuclear Fuel - Americas LLC (GNF), and this paper's purpose is to provide valuable information for the nuclear industry. First, a one-to-one comparison of measurements from Gamma Thermometers (G Ts) installed in Laguna Verde 2 (LV-2) core against axially corresponding Traverse In-core Probe (Tip) measurements is remarkably close. This longest running G T plant validation for the Economic Simplified Boiling Water Reactor (ESBWR) power monitoring devices is also proving that the devices have the potential to simplify power measurements in Boiling Water Reactors (BWRs). Second, code validation results show remarkable reduction of radial power uncertainty with respect to current technology when new GNF codes for three-dimensional core simulations are compared to Tip power measurements. The LV-2 core is of paramount importance for BWR data analysis since the core has been loaded from the start of operation with different GNF fuel bundle types, fuel management has been designed with GNF codes and on-line core monitoring has been performed with GNF's 3-Dimensional Monicore system. This validation is also reliable since gamma Tips are used for local power measurements rather than thermal neutron Tips, which are more sensitive to local turbulence and positional changes. A nuclear/thermal-hydraulic core simulation of GNF fuel is undertaken from the beginning of operation of LV-2 (cycle 1) through the range of different power scenarios including low power, original licensed thermal power, power up rate and extended power up rate. Results confirm the conclusions from previous validations in different BWRs and support GNF efforts for licensing the new generation of nuclear engineering codes. (Author)

  14. -C/Fe System

    Science.gov (United States)

    Ikram-ul-Haq, M.; Khanna, R.; Wang, Y.; Sahajwalla, V.

    2014-12-01

    Sessile drop investigations were carried out on Al2O3-12.9C refractory substrates in contact with molten iron at 1823 K (1550 °C) for 30 minutes. Chemical reactions in this system resulted in the generation of trace quantities of ferro-aluminum alloys. An X-ray micro-diffraction approach was developed to localize and structurally identify these phases based on epitaxial mapping using X'Pert materials research Diffractometer. Using this technique, a small peak in the standard XRD pattern could be enhanced to four diffraction peaks with much higher intensities, leading to a much improved indexing of diffraction peaks and structural characterization of the reaction product.

  15. Higher English for CFE

    CERN Document Server

    Bridges, Ann; Mitchell, John

    2015-01-01

    A brand new edition of the former Higher English: Close Reading , completely revised and updated for the new Higher element (Reading for Understanding, Analysis and Evaluation) - worth 30% of marks in the final exam!. We are working with SQA to secure endorsement for this title. Written by two highly experienced authors this book shows you how to practice for the Reading for Understanding, Analysis and Evaluation section of the new Higher English exam. This book introduces the terms and concepts that lie behind success and offers guidance on the interpretation of questions and targeting answer

  16. Co-generation system with integrated functions of active filter; Sistema de cogeneracion con funciones de filtro activo integradas

    Energy Technology Data Exchange (ETDEWEB)

    Jimenez Grajales, Humberto Raul

    2002-07-15

    adaptive interference. This technique maintains the system in the best functional state, by means of continuous self adjustment facing changes in the operation parameters, generating important and satisfactory results. In addition, simultaneously the PVS uses, in the pursuit of the point of maximum power, the technique of {sup d}isturb and observe{sup ,} which offers a high performance in the injection of active power. [Spanish] Sin duda, la energia electrica es la forma de energia mas ampliamente usada en las actividades economicas y sociales de nuestro mundo moderno. Por ello, se puede decir que las companias generadoras y distribuidoras de electricidad asumen dos retos de relevante preocupacion actual. Uno es generar con mayor eficiencia, menor costo y con un minimo impacto sobre el medio ambiente. El segundo es cumplir con la calidad del suministro, que ha llegado a ser un punto importante tanto para los usuarios como para las companias que distribuyen la energia electrica, y que se refleja en una distribucion y un consumo de energia mas eficiente. El trabajo de tesis que se presenta, describe un sistema fotovoltaico (SFV) interconectado a la red electrica que ayuda a superar los retos citados. Este SFV tiene la funcion de recibir la energia solar entregada por un arreglo de celdas FV; operar en el punto maximo de potencia de las celdas (para mayor aprovechamiento de la energia captada); acondicionarla a una senal alterna, dentro de los parametros tecnicos normativos para la interconexion electrica (establecidos por la compania; Comision Federal de Electricidad en Mexico); e inyectarla a la red electrica con el proposito de compensar potencia reactiva (filtrado activo) demandada por cargas lineales y no lineales, reduciendo la contaminacion de la red electrica; ademas de compensar potencia activa en los picos de demanda de energia electrica maxima. El sistema funciona como filtro activo durante todo el dia, lo que permite que la capacidad de potencia instalada por el

  17. Stator Current Harmonics Evaluation by Flexible Neural Network Method With Reconstruction Structure During Learning Step Based On CFE/SS Algorithm for ACEC Generator of Rey Power Plant

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Yousefi

    2010-07-01

    Full Text Available One method for on-line fault detection in synchronous generator is stator current harmonics analysis. In this paper, the flexible neural network with reconstruction structure during learning has been used to evaluate the stator current harmonics in different loads. Generator modeling, finite element method and state space model make training set of flexible neural network. Many points from generator capability curve are used to complete this set. Flexible neural network that is used in this paper is a perception network with single hidden layer, flexible hidden layer neuron and back propagation algorithms. Results are show that the trained flexible neural network can identify stator current harmonics for desired load from the capability curve. The error is less than 10% in compared to the values obtained directly from the CFE-SS algorithms. The parameters of modeled generator are 43950(KVA, 11(kV, 3000(rpm, 50(HZ, (PF=0.5.

  18. A New Nitrogenase Mechanism Using a CFe8S9 Model: Does H2 Elimination Activate the Complex to N2 Addition to the Central Carbon Atom?

    Science.gov (United States)

    McKee, Michael L

    2016-02-11

    A truncated model of the FeMo cofactor is used to explore a new mechanism for the conversion of N2 to NH3 by the nitrogenase enzyme. After four initial protonation/reduction steps, the H4CFe8S9 cluster has two hydrogen atoms attached to sulfur, one hydrogen bridging two iron centers and one hydrogen bonded to carbon. The loss of the CH and FeHFe hydrogens as molecular hydrogen activates the cluster to addition of N2 to the carbon center. This unique step takes place at a nearly planar four-coordinate carbon center and leads to an intermediate with a significantly weakened N-N bond. A hydrogen attached to a sulfur atom is then transferred to the distal nitrogen atom. Additional prontonation/reduction steps are modeled by adding a hydrogen atom to sulfur and locating the transition states for transfer to nitrogen. The first NH3 is lost in a thermal neutral step, while the second step is endothermic. The loss of H2 activates the complex by reducing the barrier for N2 addition by 3.5 kcal/mol. Since this is the most difficult step in the mechanism, reducing the barrier for this step justifies the "extra expense" of H2 production.

  19. Energy cogeneration for the industrial sector. Exploration of possibilities for Bahia Blanca petrochemical complex; Cogeneracion de energia para el sector industrial. Exploracion de posibilidades para el polo petroquimico de Bahia Blanca

    Energy Technology Data Exchange (ETDEWEB)

    Salzman, Carlos H. [Buenos Aires Univ. (Argentina). Facultad de Ingenieria. Dept. de Electrotecnia; Baraychart, Rogelio [Tecnolatina S.A., Buenos Aires (Argentina)

    1997-12-31

    Many industrial plants have installed gas turbines in connection with total energy schemes. By combining a gas turbine with a steam plant, through an Independent Power Producer (IPP), increasing in overall efficiency can be archived compared to a steam plant alone. The general applications and economic considerations after privatization of Argentine Network, indicates that for power supply, combined cycle with cogeneration, is appropriate for generation, because of improving quality service, lowering capital cost improving and high efficiency. Figures are shown in this paper, for a project at the petrochemical development pole in Bahia Blanca city, located in the south of Buenos Aires Province. (author) 4 refs., 3 figs.; e-mail: gea at delec.fi.uba.ar; tecnolat at ssdnet.com.ar

  20. The [Fe/H], [C/Fe], and [α/Fe] Distributions of the Boötes I Dwarf Spheroidal Galaxy

    Science.gov (United States)

    Lai, David K.; Lee, Young Sun; Bolte, Michael; Lucatello, Sara; Beers, Timothy C.; Johnson, Jennifer A.; Sivarani, Thirupathi; Rockosi, Constance M.

    2011-09-01

    We present the results of a low-resolution spectral abundance study of 25 stars in the Boötes I dwarf spheroidal (dSph) galaxy. The data were obtained with the low resolution imaging spectrometer instrument at Keck Observatory and allow us to measure [Fe/H], [C/Fe], and [α/Fe] for each star. We find both a large spread in metallicity (2.1 dex in [Fe/H]) as well as a low average metallicity in this system, lang[Fe/H]rang = -2.59, matching previous estimates. This sample includes a newly discovered extremely metal-poor star, with [Fe/H] = -3.8, that is one of the most metal-poor stars yet found in a dSph. We compare the metallicity distribution function of Boötes I to analytic chemical evolution models. While the metallicity distribution function of Boötes I is best fit by an Extra Gas chemical evolution model, leaky-box models also provide reasonable fits. We also find that the [α/Fe] distribution and the carbon-enhanced metal-poor fraction of our sample (12%) are reasonable matches to Galactic halo star samples in the same metallicity range, indicating that at these low metallicities, systems like the Boötes I ultra-faint dSph could have been contributors to the Galactic halo. The data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.

  1. Three-phase shots and monopolar reclose in the core network of 400 kV of the Area de Control Occidental of CFE and Its normal probability of occurrence; Disparos trifasicos y de recierre monopolar en la red troncal de 400 kV del area de control occidental, CFE, y su probabilidad normal de ocurrencia

    Energy Technology Data Exchange (ETDEWEB)

    Narvaez Perez, Camilo; Garcia Conejo, Dante Aristoteles [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)]. E-mail: camilo.narvaez@cfe.gob.mx; camilo.narvaez@univa.mx; Ramirez Peredo, Patricia [Universidad de Guadalajara, Guadalajara, Jalisco (Mexico)]. E-mail: patyrape@hotmail.com; Blanco Gomez, Cesar Eduardo [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)

    2013-03-15

    The growing power demand of users, who make loads of power systems, causes the components of such systems operating near its operating limits. And the transmission line, being the most common component in these, requires a thorough analysis in regard to the probability of three-phase shots and monopolars reclosing, considering thunderstorms, the demand system time, the flows circulating in lines, maintenance on other lines and other imponderantes. This research analyzes the normal probability of occurrence of shots in the 400 kV core network of the Area de Control Occidental, CFE and its impact on studies conducted prior to the maintenance. We intend to use the methodology in the Comision Federal de Electricidad and results can be validated with data from previous years, based on a pseudo shots forecast in a given period. [Spanish] La creciente demanda de energia electrica de los usuarios que componen las cargas de los sistemas electricos de potencia, provoca que los componentes de dichos sistemas funcionen cerca de sus limites operativos. Y la linea de transmision, al ser el componente mas comun en estos, requiere de un analisis minucioso en lo que respecta a la probabilidad de disparos trifasicos y recierres monopolares, considerando tormentas electricas, la demanda horaria del sistema, los flujos que circulan en las lineas, los mantenimientos en las demas lineas y demas imponderantes. En esta investigacion se analiza la probabilidad normal de ocurrencia de disparos en la red troncal de 400 kV del Area de Control Occidental y su impacto en los estudios que se realizan previos a los mantenimientos. Se pretende utilizar la metodologia en la Comision Federal de Electricidad, y los resultados pueden ser validados con datos de los anos anteriores, ya que se hace un pseudo pronostico de disparos en un periodo dado.

  2. Study of reliability for the electricity cogeneration and seawater desalination in the Northwest of Mexico; Estudio de factibilidad para la cogeneracion de electricidad y desalacion de agua de mar en el noroeste de Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez U, G. O.; Ortega C, R. F. [UNAM, Instituto de Ingenieria, 04510 Mexico D.F. (Mexico)]. email: exergiovanni@gmail.com

    2008-07-01

    The IMPULSA project of the Engineering Institute of UNAM, it has dedicated from the year 2005 to the study and development of new desalination technologies of seawater with renewable energies. The objective is to form a group of expert engineers and investigators in the desalination topics able to transform their scientific knowledge in engineering solutions, with a high grade of knowledge of the environment and the renewable energies. In the middle of 2007 was took the initiative in the IMPULSA project to study the nuclear desalination topic by its characteristics of zero gas emissions of greenhouse effect, competitive costs in the generation, operative experience and safety of the nuclear reactors, resulting attractive mainly for the desalination projects of seawater of great size. The Northwest of Mexico is particularly attractive as the appropriate site for one nuclear desalination plant of great size given its shortage of drink water and the quick growth of its population; as well as its level of tourist, agricultural and industrial activity. In this study was analyzed from a thermodynamic viewpoint, mentioning the economic aspect, the nuclear desalination according to the world experience; they were simulated some couplings and operation forms of nuclear reactors and desalination units, was made emphasis in one particularly. The objective of the study was to characterize several types and sizes of nuclear reactors of the last generation that could be coupled to a desalination technology as multi-stage distillation, type flash distillation or inverse osmosis. Specially and topic of this article, it is studied a case of the IRIS reactor of 335 MW{sub e} coupled to a MED station of nominal capacity of 140,000 m{sup 3}/day. It is utilized for this effect the DEEP 3.1 program of the IAEA to simulate the coupling and to carry out a thermodynamic and economic preliminary evaluation, as well as the THERMOFLEX simulator to reinforce and to compare the thermodynamic part. They were costs very competitive of 0.038-0.044 $/ kWh for the production of electric energy and of 0.60 at 0.77 $/ m{sup 3} for the produced water, with a lost of power in the generation of among 28 to 43 MW{sub e}. (Author)

  3. The electric power cogeneration in the paper factories as option for the environmental impact reduction; La cogeneracion de electricidad en las fabricas de papel como opcion para la reduccion del impacto ambiental

    Energy Technology Data Exchange (ETDEWEB)

    Dondero Villanueva, Luz Zoraid; Coelho, Suani Texeira [Sao Paulo Univ., SP (Brazil). Programa Interunidades de Pos-Graduacao em Energia

    1998-12-31

    This paper introduces an environmental analysis into a previous study for a Brazilian paper study (400 t paper/day). The main objective is to evaluate and to compare pollutant emissions (S O{sub 2}, N O{sub x} and the particulate matter) from different configurations for cogeneration in a paper industry. Fuel-oil fired steam cycle and natural gas fired combined cycle are compared to current situation in the paper industry. Results show that natural gas combined cycle is a more efficient technology and also presents less pollutant emissions. (author) 3 refs., 4 figs., 1 tab.

  4. Thermodynamic study of residual heat from a high temperature nuclear reactor to analyze its viability in cogeneration processes; Estudio termodinamico del calor residual de un reactor nuclear de alta temperatura para analizar su viabilidad en procesos de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Santillan R, A.; Valle H, J.; Escalante, J. A., E-mail: santillanaura@gmail.com [Universidad Politecnica Metropolitana de Hidalgo, Boulevard acceso a Tolcayuca 1009, Ex-Hacienda San Javier, 43860 Tolcayuca, Hidalgo (Mexico)

    2015-09-15

    In this paper the thermodynamic study of a nuclear power plant of high temperature at gas turbine (GTHTR300) is presented for estimating the exploitable waste heat in a process of desalination of seawater. One of the most studied and viable sustainable energy for the production of electricity, without the emission of greenhouse gases, is the nuclear energy. The fourth generation nuclear power plants have greater advantages than those currently installed plants; these advantages have to do with security, increased efficiencies and feasibility to be coupled to electrical cogeneration processes. In this paper the thermodynamic study of a nuclear power plant type GTHTR300 is realized, which is selected by greater efficiencies and have optimal conditions for use in electrical cogeneration processes due to high operating temperatures, which are between 700 and 950 degrees Celsius. The aim of the study is to determine the heat losses and the work done at each stage of the system, determining where they are the greatest losses and analyzing in that processes can be taken advantage. Based on the study was appointed that most of the energy losses are in form of heat in the coolers and usually this is emitted into the atmosphere without being used. From the results a process of desalination of seawater as electrical cogeneration process is proposed. This paper contains a brief description of the operation of the nuclear power plant, focusing on operation conditions and thermodynamic characteristics for the implementation of electrical cogeneration process, a thermodynamic analysis based on mass and energy balance was developed. The results allow quantifying the losses of thermal energy and determining the optimal section for coupling of the reactor with the desalination process, seeking to have a great overall efficiency. (Author)

  5. Phase relations in the Fe-Fe3C-Fe3N system at 7.8 GPa and 1350 °C: Implications for carbon and nitrogen hosts in Fe0-saturated upper mantle

    Science.gov (United States)

    Sokol, Alexander G.; Kruk, Alexey N.; Seryotkin, Yurii V.; Korablin, Alexander A.; Palyanov, Yury N.

    2017-04-01

    Phase relations in the Fe-Fe3C-Fe3N system are studied in high-pressure experiments at 7.8 GPa and 1350 °C using a split-sphere multi-anvil apparatus. The starting mixtures consisting of Fe, Fe3C and Fe3N are loaded into ceramic or graphite capsules. Contamination with trace amounts of oxygen leads to the appearance of wüstite in the system retaining oxygen fugacity (fO2) near the iron-wüstite (IW) buffer. The metal melt rich in carbon and nitrogen has a large stability field in the central part of the phase diagram, and this field at 1350 °C is tangent to the Fe-Fe3C side of the Fe-Fe3C-Fe3N triangle at the point of the Fe-Fe3C eutectics. Iron nitride ε-Fe3N (space group P6322 or P63/mmc) contains variable amounts of C and N: up to 2.0-2.5 wt% C and 6.0-7.3 wt% N in equilibrium with a C- and N-rich melt and as little as 1.0 wt% C and 3.2 wt% N in equilibrium with γ- Fe. The limit C and N contents in γ-Fe equilibrated with the C- and N-rich melt is about 1.0 wt%, while the N solubility in cementite (Fe3C) does not exceed 0.5 wt%. The obtained data make basis for the isothermal section of the Fe-Fe3C-Fe3N system. The metal melt phase is inferred to be the main host of carbon and nitrogen in the Fe0-saturated (0.1 wt%) mantle at a depth of ∼250 km. In particular, C- and N-bearing austenite (γ-Fe) and metal melts host carbon and nitrogen in the mantle depleted in volatiles (20 ppm C and 1 ppm N), whereas carbon and nitrogen in the mantle with high concentrations of volatiles (250 ppm C and 100 ppm N) reside in C- and N-rich melts with a minor amount of iron carbide (Fe3C). The presence of nickel and sulphur in metal are expected to inhibit the formation of iron carbide and increases the melt phase stability. Redox freezing of N-rich carbonate melts from subduction slabs in Fe0-saturated mantle may produce iron melts supersaturated with nitrogen and stable ε-Fe3N.

  6. System for the design of electrical distribution substations; Sistema para el diseno de subestaciones electricas de distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Zayas Perez, Benjamin Eddie; Islas Perez, Eduardo; Bahena Rada, Jessica Liliana; Romero Lima, Jesus [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra Rodriguez, Benjamin; Moreno Diaz, Humberto [Comision Federal de Electricidad (Mexico)

    2011-07-01

    The physical design of electric substations involves a variety of activities, such as developing, reviewing and performing modifications to different design proposals, estimating costs and producing documents to be integrated into an executive project. These activities are usually conducted at the Distribution Divisions of the Federal Electric Commission (CFE) through two separate processes: the development of engineering plans with computer-aided design software (CAD) and volumetric calculations for the initial budget using conventional spreadsheets. The documents are manually developed on an individual basis, without the existence of any functions to allow for automatically updating the design modifications of any of the plans. The corresponding initial budget becomes a lengthy and laborious process with the likelihood of inconsistencies among the documents. In order to optimize the design process for the public and electromechanical works of electric substations (ES) in a three-dimensional (3D) graphic environment, the IIE's Management of Process Supervision, in coordination with the CFE Distribution Subdivision, developed the System for the Design of Electric Substation Distribution (SDESD). This system makes use of the advantages of CAD3D technology to develop detail engineering, cost engineering to calculate initial budgets and virtual reality for three-dimensional interactive navigation. It is worth mentioning that this system is currently in the implementation phase at the CFE Distribution Subdivision. This article briefly describes the main stages in the development of the project, as well as the functioning and principal components of the system. [Spanish] El diseno fisico de subestaciones electricas implica una variedad de actividades, tales como elaborar, revisar y efectuar modificaciones de diferentes propuestas de diseno, estimar costos y producir documentos, para integrarlos como parte de un proyecto ejecutivo. Estas actividades usualmente se

  7. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1997-12-31

    Electricas (IIE) para la CFE con el fin de mejorar la oportunidad para manejar la informacion. El SIME captura, ordena, almacena y reporta los datos obtenidos de las mediciones en las obras con gran eficiencia y flexibilidad. Este sistema es parte de uno de mayor alcance con el que la CFE asegurara un estado optimo de operacion de sus obras civiles.

  8. Optimum design of a self-supported power transmission tower type 2M2 for 230 kW; Diseno optimo de una torre de transmision autosoportada tipo 2M2, para 230 kW

    Energy Technology Data Exchange (ETDEWEB)

    Espejel Valdez, Eduardo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Millan Monje, Alejandro; Honk Hernandez, Wenceslao [Comision Federal de Electricidad, (CFE), Mexico, D. F. (Mexico)

    1985-12-31

    A group of specialists from the Comision Federal de Electricidad (CFE) and of the Instituto de Investigaciones Electricas (IIE) analyzes the design of various types of power transmission towers in their application stage, in order to enhance them. In this article the structural characteristics of the self-supported tower type 2M2 for 230 kV of two circuits and of suspension, are presented. [Espanol] Un grupo de especialistas de la Comision Federal de Electricidad (CFE) y del Instituto de Investigaciones Electricas (IIE) analiza el diseno de diversos tipos de torres de transmision en su etapa de aplicacion, con el fin de mejorarlos. En este articulo se presentan las caracteristicas estructurales de la torre autosoportada tipo 2M2 para 230 kV, de dos circuitos y de suspension.

  9. Alternative analysis to increase the power in combined-cycle power plants; Analisis de alternativas para el incremento de potencia en plantas termoelectricas de Ciclo Combinado

    Energy Technology Data Exchange (ETDEWEB)

    Pacheco Cruz, Hector; Arriola Medellin, Alejandro M. [Gerencia de Procesos Termicos, Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: hpacheco@iie.org.mx; aarriola@iie.org.mx

    2010-11-15

    The electricity industry traditionally had two thermodynamic cycles for power generation: conventional steam turbine (Rankine cycle) used to supply a base load during the day, and gas turbines (Brayton cycle), for its speed response, normally used to cover peak loads. However, to provide variable peak loads, the gas turbine, as a volumetric machine is affected by the change in air density by changing the combustion temperature. This paper shows the scheme of integration of both systems, that it's known as combined cycle and the different options that would have these power plants, to maintain or increase their power in variable ambient conditions. It analyzes different options, such as: 1. Supplementary fire in the stove. 2. Air cooling intake in the gas turbine (evaporation system or mechanical system). 3. Steam injection in the combustion chamber. [Spanish] La industria electrica tradicionalmente a contado con dos ciclos termodinamicos para generacion electrica: las turbinas convencionales de vapor (ciclo de Rankine) se utilizan para suministrar una carga base durante el dia, y las turbinas de gas (ciclo de Brayton), por su rapidez de respuesta, se utilizan normalmente para cubrir las cargas pico. Sin embargo, para suministrar las cargas variables pico, la turbina a gas, por ser una maquina volumetrica, se ve afectada por el cambio de la densidad del aire de combustion al cambiar la temperatura ambiente. En este trabajo se muestra el esquema de integracion de ambos sistemas, en lo que se conoce como ciclo combinado y las diferentes opciones que tendrian estas plantas de generacion electrica para mantener o incrementar su potencia en condiciones ambiente variable. Para ello se analizan diferentes opciones, tales como: 1.- Combustion suplementaria en el recuperador de calor. 2.- Enfriamiento del aire de admision a la turbina de gas (mediante un sistema de evaporacion o mediante un sistema mecanico). 3.- Inyeccion de vapor a la camara de combustion. Palabras

  10. Training system for the maintenance of power lines of the distribution network, ALEn3D; Sistema para la capacitacion y entrenamiento para el mantenimiento de lineas de la red de distribucion, ALEn3D

    Energy Technology Data Exchange (ETDEWEB)

    Galvan Bobadilla, Israel; Perez Ramirez, Miguel; Ayala Garcia, Andres; Munoz Roman, Jaime Javier; Rodriguez Gallegos, Eric; Salgado Martinez, Marco Antonio [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra Rodriguez, Benjamin [Comision Federal de Electricidad (Mexico)

    2011-07-01

    The maintenance of power lines is a complex activity with many inherent risks. Therefore, training of personnel in this area is a priority for electric energy companies. This article presents a capacity-building system based on virtual reality developed by the Federal Electric Commission (CFE), called ALEn3D. This allows maintenance technicians to train in risk-free interactive 3D environments and to later use that knowledge with an actual installation. The work was validated by expert electricians and, therefore, the system represents a wealth of knowledge and best practices for the maintenance of distribution lines. ALEn3D was designed as a tool for self capacity-building for adults, and therefore includes usability and e-learning elements to facilitate learning and automate the students' ongoing progress. The system can be run by a personal computer, is low-cost, optimized and user friendly. It is being used in the 16 distribution divisions of the CFE. [Spanish] El mantenimiento en lineas energizadas es un actividad compleja y con muchos riesgos inherentes, por lo que la capacitacion del personal en esta area es una prioridad para las empresas de energia electrica. Este articulo presenta un sistema de capacitacion basado en realidad virtual desarrollado para la Comision Federal de Electricidad (CFE), denominado ALEn3D, el cual permite a los tecnicos de mantenimiento capacitarse en ambientes 3D interactivos libes de riesgos, para posteriormente usar esos conocimientos en una instalacion real. El trabajo fue validado por expertos electricistas, por lo tanto, el sistema es un acervo de conocimientos y mejores practicas del mantenimiento a lineas de distribucion. ALEn3D fue disenado como una herramienta de autocapacitacion para adultos, por lo que se incluyeron aspectos de usabilidad y e-learning que facilitan el aprendizaje y automatizan el seguimiento del estudiante. El sistema puede ser ejecutado en una computadora personal y es utilizado en las 16

  11. Specification for the interconnection to a electric network of low tension of photovoltaic systems with 30 kW of capacity; Especificacion para la interconexion a la red electrica de baja tension de sistemas fotovoltaicos con capacidad hasta 30kW

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Gutierrez, Jose [Comision Federal de Electricidad, Mexico (Mexico)

    2007-06-15

    In this presentation, there are shown the details of the photovoltaic systems interconnected with the electric network (SFVI), carried out by the Mexico's Federal Electricity Commission (CFE) with the support of the Mexican Electric Research Institute (IIE). First of all, there are found the objectives of the photovoltaic system interconnected to the electric network (SFVI). Then, there are mentioned the places where such sort of systems could be installed; besides, it is shown a diagram explaining the process of such systems. At the same time, there are briefly explained the components that are necessaries for their properly operation. Some of the elements previously mentioned are: photovoltaic generator (GFV), inverter, interface, and logic circuits and the control. It is shown a diagram with the location of the electrical disconnect switches. Then, it is shortly explained the place where the SFVI should be connected and there are given some requisites that are important to fulfill in order to have everything updated. Finally, it is mentioned the methodology that should be followed in order to supervise that everything works in a properly way, this last issue is carried out by CFE. [Spanish] En esta presentacion se presentan los pormenores del sistema fotovoltaico interconectado a la red (SFVI), realizado por la Comision federal de Electricidad (CFE) con apoyo del Instituto de Investigaciones Electricas (IIE). En primer lugar, se encuentran los objetivos que tiene el uso de SFVI. Enseguida, se muestra un diagrama que explica el proceso que dichos sistemas realizan. Asimismo, se explican brevemente los elementos que, de uno u otro modo, son necesarios para el adecuado funcionamiento del SFV. Ademas, se muestra un diagrama con la ubicacion de los interruptores de desconexion. Luego, se explica escuetamente el lugar donde se debe de conectar el SFVI, ademas de algunas condiciones que se deben de cumplir para que no haya mayores contratiempos. Finalmente, se

  12. Measurement and control techniques for electric equipment development; Tecnicas de medicion y control para el desarrollo de equipos electricos

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Neblina, Joaquin [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1987-12-31

    In broad outlines the measuring and control techniques that are used in the electric equipment development in the short circuit laboratories, are described. In this article the utilization criteria of the traditional and modern (analogical and digital) instruments are described as well as the tendency towards the system`s integration for the automation of the measurement and control processes. Also, mention is made of the systems currently being developed at the Instituto de Investigaciones Electricas (IIE) to be applied at the Short Circuit Laboratories of Comision Federal de Electricidad (CFE) and of the IIE. [Espanol] Se describen a grandes rasgos las tecnicas de medicion y control que se emplean para el desarrollo de equipos electricos en los laboratorios de corto circuito. En este articulo se describen los criterios de utilizacion de los instrumentos tradicionales y modernos (analogicos y digitales), asi como la tendencia hacia la integracion de sistemas para la automatizacion de los procesos de medicion y control. Tambien se mencionan los sistemas que actualmente se desarrollan en el Instituto de Investigaciones Electricas (IIE) para aplicarlos en los Laboratorios de Corto Circuito de la Comision Federal de Electricidad (CFE) y del Instituto.

  13. Proceedings of the 7 Annual conference of the Mexican association for the energy economy. The energy sector in Mexico: challenges and solutions. [Selected papers]; 7. Conferencia anual de la asociacion mexicana para la economia energetica. El sector energia en Mexico: retos y soluciones

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The Mexican Association for the Energy Economy (AMEE) had its VII annual conference, The energy sector in Mexico: challenges and solutions, in October, 2004. Some of the expounded topics are: technical and environmental aspects of the combined cycle power stations; analysis of the generation of electric power across biogas from sanitary landfills in Mexico; cogeneration in large power plants; methodologies for the calculation of relative efficiency: description and application of natural gas distributors in Latin American and others. [Spanish] La Asociacion Mexicana para la Economia Energetica A. C. (AMEE), llevo acabo su VII conferencia anual El sector energia en Mexico: retos y soluciones, en octubre del 2004. Algunos de los temas tratados son: Aspectos tecnicos y medioambientales de las centrales de ciclo combinado con gasificacion integrada; Analisis de la generacion de energia electrica a traves de biogas procedente de rellenos sanitarios en Mexico; Cogeneracion en grandes centrales de proceso; Metodologias para el calculo de eficiencia relativa: descripcion y aplicacion para distribuidores de gas natural en Latinoamerica y otros.

  14. Areas to explore surrounding the Cerro Prieto geothermal field, BC; Areas para exploracion en los alrededores del campo geotermico de Cerro Prieto, BC

    Energy Technology Data Exchange (ETDEWEB)

    Aguilar Dumas, Alvaro [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Residencia General de Cerro Prieto, Mexicali, Baja California (Mexico)]. E-mail: alvaro.aguilar@cfe.gob.mx

    2009-07-15

    Exploration plays an important role in tapping underground natural resources-whether water, oil, natural gas or minerals. Exploratory data allow us to learn reservoir conditions, increasing probable reserves and reservoir life span. Around the Cerro Prieto geothermal field, BC, and in the Mexicali Valley in general, exploration had almost stopped but recently was resumed by the Studies Division of Comision Federal de ELectricidad (CFE)'s Gerencia de Proyectos Geotermoelectricos. The division sent technical personnel to structurally map the northern and eastern portions of Laguna Salada. The paper offers a general outline of the main zones undergoing exploratory studies-studies perhaps culminating in siting exploratory wells to locate more geothermal resources (and ultimately producing them using binary power plants). CFE also wants to site injection wells west of the current production zone, and this is covered, as well. All activities are meant to increase the productive lifespan of the geothermal reservoir. [Spanish] Cuando se trata de la explotacion de recursos naturales del subsuelo, sea agua, gas, petroleo o minerales, la exploracion juega un papel muy importante, ya que permite conocer las condiciones del yacimiento que pudieran llevar a incrementar las reservas de los recursos explotados y extender su vida util. En las zonas aledanas al campo geotermico de Cerro Prieto, BC, y en general en el Valle de Mexicali, la exploracion estaba practicamente detenida habiendose reactivado a raiz de que la Subgerencia de Estudios de la Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad (CFE) envio personal para realizar mapeos estructurales en las porciones norte y oriente de la Laguna Salada. Este trabajo presenta un panorama general de las areas prioritarias para realizar estudios exploratorios y poder programar, con mas bases, pozos exploratorios enfocados a localizar mas recursos geotermicos, inclusive para generar energia por medio

  15. Fe-Cluster Pushing Electrons to N-Doped Graphitic Layers with Fe3C(Fe) Hybrid Nanostructure to Enhance O2 Reduction Catalysis of Zn-Air Batteries.

    Science.gov (United States)

    Yang, Jie; Hu, Jiangtao; Weng, Mouyi; Tan, Rui; Tian, Leilei; Yang, Jinlong; Amine, Joseph; Zheng, Jiaxin; Chen, Haibiao; Pan, Feng

    2017-02-08

    Non-noble metal catalysts with catalytic activity toward oxygen reduction reaction (ORR) comparable or even superior to that of Pt/C are extremely important for the wide application of metal-air batteries and fuel cells. Here, we develop a simple and controllable strategy to synthesize Fe-cluster embedded in Fe3C nanoparticles (designated as Fe3C(Fe)) encased in nitrogen-doped graphitic layers (NDGLs) with graphitic shells as a novel hybrid nanostructure as an effective ORR catalyst by directly pyrolyzing a mixture of Prussian blue (PB) and glucose. The pyrolysis temperature was found to be the key parameter for obtaining a stable Fe3C(Fe)@NDGL core-shell nanostructure with an optimized content of nitrogen. The optimized Fe3C(Fe)@NDGL catalyst showed high catalytic performance of ORR comparable to that of the Pt/C (20 wt %) catalyst and better stability than that of the Pt/C catalyst in alkaline electrolyte. According to the experimental results and first principle calculation, the high activity of the Fe3C(Fe)@NDGL catalyst can be ascribed to the synergistic effect of an adequate content of nitrogen doping in graphitic carbon shells and Fe-cluster pushing electrons to NDGL. A zinc-air battery utilizing the Fe3C(Fe)@NDGL catalyst demonstrated a maximum power density of 186 mW cm(-2), which is slightly higher than that of a zinc-air battery utilizing the commercial Pt/C catalyst (167 mW cm(-2)), mostly because of the large surface area of the N-doped graphitic carbon shells. Theoretical calculation verified that O2 molecules can spontaneously adsorb on both pristine and nitrogen doped graphene surfaces and then quickly diffuse to the catalytically active nitrogen sites. Our catalyst can potentially become a promising replacement for Pt catalysts in metal-air batteries and fuel cells.

  16. Information systems for civil engineering; Sistemas de informacion para ingenieria civil

    Energy Technology Data Exchange (ETDEWEB)

    De Buen R, Pablo R; Alvarado G, Alonso; Alaniz Q, Felipe de J; Guerrero F, Vicente A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2004-07-01

    Since its beginnings, in the Gerencia de Ingenieria Civil (GIC) of the Instituto de Investigaciones Electricas (IIE) the interest has existed to take advantage of and to promote the advantages that the appropriate use of the computerizing systems in the different tasks of civil engineering in the power sector represent. Either as a part of its infrastructure or at the request of their clients, at the GIC have been developed calculation systems for the analysis and design of special structures such as turbo-generators foundations, poles for transmission and distribution and transmission towers, in addition the information systems for the consultation and the analysis of diverse information, such as the related to the Manuals of Civil Works of the Comision Federal de Electricidad (CFE) or the relative to the existing instruments in the large dams of our country. In this article are briefly described some of the computer systems developed by the GIC in recent years. [Spanish] Desde sus inicios, en la Gerencia de Ingenieria Civil (GIC) del Instituto de Investigaciones Electricas (IIE) ha existido el interes por aprovechar y promover las ventajas que representa el uso adecuado de los sistemas de computo en las diferentes tareas de ingenieria civil en el sector energetico. Ya sea como parte de su infraestructura o a solicitud de sus clientes, en la GIC se han desarrollado sistemas de calculo para el analisis y diseno de estructuras especiales como lo son las cimentaciones de turbogeneradores, los postes para transmision y distribucion y las torres de transmision, ademas de sistemas de informacion para la consulta y el analisis de informacion diversa, como es la relacionada con los manuales de obras civiles de la Comision Federal de Electricidad (CFE) o a la relativa a los instrumentos existentes en las grandes presas de nuestro pais. En este articulo se describen brevemente algunos de los sistemas de computo desarrollos por la GIC en anos recientes.

  17. Utilization of the computational technic for the promotion and diffusion of the energy conservation practice; Utilizacion de tecnicas computacionales para promocionar y difundir el ahorro de energia

    Energy Technology Data Exchange (ETDEWEB)

    Kemper Valverde, N. [Laboratorio de Inteligencia Artificial, Instituto de Ingenieria, UNAM, Mexico D. F. (Mexico)

    1995-12-31

    In this paper are presented the developments obtained through the application of the new computational technologies in the diffusion and promotion tasks of energy efficient use and conservation. The most relevant aspects are described of three multimedia courses that were designed in order to increase the possibilities of offering personal training in efficient energy technic, as well as to have on hand totally open consulting and interactive tools. The courses that are described are: ``Design of Energy Conservation Programs for the Industry``, ``Energy Conservation in Combustion Equipment`` and ``Energy Cogeneration Technologies.`` On another subject, an analysis is also made of the possibilities for the development and application of expert systems that advise and give support to the work of technicians and engineers dedicated to energy conservation. The main characteristics of an expert system to give support to the energy analysis of lighting industrial systems, malls, buildings and hotels are also described. [Espanol] En este trabajo se presentan los desarrollos obtenidos por la aplicacion de las tareas de difusion y promocion del uso eficiente y ahorro de energia. Se describen los aspectos mas relevantes de tres cursos multimedia que fueron disenados con el objeto de incrementar las posibilidades de brindar capacitacion individualizada en tecnicas energeticas eficientes, asi como de contar con herramientas de consulta totalmente abiertas e interactivas. Los cursos que se describen son: ``Diseno de Programas de Ahorro de Energia en la Industria,`` ``Ahorro de Energia en Equipos de Combustion`` y ``Tecnologias de Cogeneracion de Energia.`` Por otro lado, tambien se hace un analisis de las posibilidades para el desarrollo y aplicacion de sistemas expertos que asesoren y apoyen el trabajo de tecnicos e ingenieros dedicados al ahorro de energia. Se describen las caracteristicas principales de un sistema experto disenado para brindar apoyo en analisis energeticos

  18. Russia blames Baltic for its CFE pullout

    Index Scriptorium Estoniae

    2007-01-01

    Tavarelvastusleppes osaluse peatanud Venemaa püüdis oma otsust põhjendada Balti riike süüdistades. Vene kindralstaabi ülem Juri Balujevski väitis riigiduumas, et Eesti, Läti ja Leedu relvastuvat väga jõuliselt

  19. Development and application of a methodology for the classification of the operating conditions of power transformers; Desarrollo y aplicacion de una metodologia para la clasificacion del estado operativo de transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Lara Covarrubias, Hector

    2004-05-15

    This thesis work shows the development of a classification model that allows the user to assess the operative condition of power transformers. The proposed model includes the following steps: Relative weights assignation for each IEEE-62-1995 required test. Those relative weights are obtained from test results and standardized and experience based limits obtained by Comision Federal de Electricidad (CFE). Once the relative weights have been assigned, three states, green, yellow and red were defined. Each state was then ranked with a weight number (1, 2 or 3). Specific weights were assigned for each test included in the model. Test score assignation takes into account the product of the relative value and the specific weight of each test. Transformer risk assessment uses the total score obtained from the sum of the tests partial scores. Transformer risk assessment was then classified in three categories. Total score causes the system to issue maintenance or substitution recommendations. The described model will improve maintenance scheduling according the transformer risk assessment and it is fully applicable to the complete CFE power transformer population. Further, smart investment and substitution plans, can be easily obtained from the model, preventing catastrophic failures that may cause logistic and economical problems to the Mexican Power System operation. As an example, the results obtained from the model application to two transformer banks installed in a CFE hydroelectric power plant were discussed and analyzed. [Spanish] El trabajo que se muestra en esta tesis, es el desarrollo de un modelo para la clasificacion del estado operativo de los transformadores de potencia. El modelo propuesto incluye los siguientes pasos: Asignacion de pesos relativos para cada una de las pruebas establecidas en la norma IEEE-62-1995 en funcion de sus resultados, limites establecidos en la normatividad y limites propuestos con base en la experiencia de la Comision Federal de

  20. Compact fluorescent lamps, innovation for electricity saving; Lamparas fluorescentes compactas, innovacion para el ahorro de electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Rivera, Fernando [Fideicomiso para el Ahorro de Energia Electrica (Mexico); Camacho P, Wendolin E; Villalobos Alarcon, German [Phillips Lighting Mexico (Mexico)

    2007-01-15

    An extremely important resource is electricity because it has provided illumination for homes, buildings and cities in the absence of natural light. Therefore, the human being is considering to save this valuable resource by using sophisticated light bulbs. At the end of the 70's the compact fluorescent lamps appeared. In this article we can disclose the advantages and disadvantages of this technology, and how some years later of its invention, those lamps satisfied the client expectations, due to its cost, electricity saving, longer lifetime, use possibilities, and technological improvements. We can also know how Federal Electricity Commission (CFE) and The Trust Fund for Electric Energy Savings (FIDE) supported a project to favor these lamps to be in the Mexican market. [Spanish] La electricidad es un recurso de suma importancia porque ha contribuido a la iluminacion de casas, edificios y ciudades, ante la ausencia de luz natural, es por ello que se ha buscado ahorrar este recurso tan preciado con el uso de lamparas sofisticadas. Una tecnologia que aparecio a finales de los anos 70 fueron las lamparas fluorescentes compactas. En este articulo encontramos sus ventajas y desventajas, y como despues de algunos anos de su creacion comenzaron a llenar las expectativas del cliente gracias a su costo, ahorro de electricidad, mayor tiempo de vida, posibilidades de aplicacion y mejoras tecnologicas. Asi mismo podemos conocer, el proyecto que se hizo para que esta tecnologia entrara al mercado mexicano, con el apoyo de la Comision Federal de Electricidad (CFE) y del Fideicomiso para el Ahorro de Energia Electrica (FIDE).

  1. Electro-economic, environmental and social consequences in the efficient abatement of a hydroelectric plant (C. H. Santa Rosa, CFE-ACO); Consecuencias electro-economicas, ambientales y sociales del abatimiento eficiente de una central hidroelectrica (C. H. Santa Rosa, CFE-ACO)

    Energy Technology Data Exchange (ETDEWEB)

    Narvaez Perez, Camilo; Garcia Conejo, Dante Aristoteles [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)]. E-mail: camilo.narvaez@cfe.gob.mx; camilo.narvaez@univa.mx; Narvaez Perez, Claudia Universidad de Guadalajara, Zapopan, Jalisco [Mexico]). E-mail: claudia_narvaez@hotmail.com; Blanco Gomez, Cesar Eduardo [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)

    2013-03-15

    Renewable energy systems, like hydroelectric generation system gives electric energy, in reliable economic, it takes care with environment, and growths the society, if the hydroelectric dam is suitably drained in non rainy season, if we consider, flow rate in its river, rain, thunderstorms and floods, dam's size, load shape per day, generators capacity unit and the flow in turbines, generating units maintenance and other necessities like irrigation crops in farms. In this research we propose a new methodology about hydroelectric dam drained in non rainy season. But in rainy season, you can consider this methodology with few changes and you would obtain satisfactory results. The methodology is used since 2010 in the Area de Control Occidental in the Comision Federal de Electricidad with results compared with data from previous years, in which different methodologies were applied. [Spanish] Los sistemas de energias renovables, como los complejos hidroelectricos impactan de manera electrica, economica, ambiental y social, siempre y cuando se realice adecuadamente el abatimiento de la presa en el estiaje, considerando, el aporte del cauce, las lluvias aun siendo escasas, el tamano del embalse, la demanda horaria de la carga abastecida, el tamano de los generadores y su gasto turbinado, los mantenimientos de las unidades, las necesidades hidraulicas aguas abajo y demas imponderantes. En esta investigacion se propone una metodologia de abatimiento de presas de centrales hidroelectricas en estiaje. Y para tiempo de lluvias se aplica la metodologia con variantes pequenas y con resultados satisfactorios. La metodologia es utilizada desde el 2010 en el Area de Control Occidental de la Comision Federal de Electricidad, con resultados comparados con los datos de los anos anteriores, en los cuales se aplicaron metodologias diversas.

  2. Burner redesign for the reduction of the unburned particulate emission in thermal power stations of Comision Federal de Electricidad; Rediseno de quemadores para la reduccion de la emision de particulas inquemadas en centrales termicas de la Comisionon Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Huerta Espino, Mario; Espipnoza Garza, Jesus; Mani Gonzalez, Alejandro; Giles Alarcon, Armando; Pena Garcia, Adriana; Albarran Sanchez, Irma L.; Mendez Aranda, Angel [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    In the presence of the increasing demand for reaching higher efficiencies and a smaller production of polluting emissions in combustion systems, studies focused to the optimization of the present designs of burners are required. The Comision Federal de Electricidad (CFE) and the Instituto de Investigaciones Electricas (IIE) have established a project that contemplates the redesign of burners in ten of its units of thermoelectric generation. In this work the redesign of the flame stabilizer or diffuser for the reduction of the unburned particulate emission is explained. The results of the modeling of a burner of rotational flow of steam generators of the CFE are shown, as well as the graphs of the contours of the recirculation zone generated by each diffuser without combustion and a figure of the velocity profile that is generated in front of the diffuser. In agreement with the results obtained in the aerodynamic evaluation of frontal burners of rotational flow, it is possible to established that the characteristics of the recirculation zone, generated by this type of burners, are related to geometric parameters of the diffuser that identify with the number of turns and the pressure drop, where it is necessary to look for designs that improve the conditions of the mixing process and combustion in the burner. [Spanish] Ante la creciente demanda por alcanzar mayores eficiencias y una menor produccion de emisiones contaminantes en sistemas de combustion, se requieren estudios enfocados a la optimizacion de los disenos actuales de quemadores. La Comision Federal de Electricidad (CFE) y el Instituto de Investigaciones Electricas (IIE) han establecido un proyecto que contempla el rediseno de quemadores en diez de sus unidades de generacion termoelectrica. En este trabajo se explica el rediseno del estabilizador de flama o difusor para la reduccion de la emision de particulas inquemadas. Se muestran los resultados de la modelacion de un quemador de flujo rotacional de

  3. Methodology to establish the profile that defines a meta-specification that applies to distribution substations - Mexico case based on norm IEC-61850; Metodologia para establecer el perfil que define una meta-especificacion que aplica a subestaciones de distribucion -caso Mexico- basada en la norma IEC-61850

    Energy Technology Data Exchange (ETDEWEB)

    Picazo Blanquel, Cuitlahuac; Chairez Campos Carlos; Garcia Hernandez, Joaquin; Godinez Enriquez, Hebert; Poujol Galvan, Francisco C.; Suarez Cerda, Dionisio A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Villalobos Ramos, Andres; LLamas Gonzalez, Rosa E. [Comision Federal de Electricidad (Mexico); Samitier Otero, Carlos [Global Networking Engineering (Spain)

    2010-07-01

    In this article is presented a case of study of automation of electrical substations of Comision Federal de Electricidad (CFE) of Mexico, in which the Norm IEC-61850 has been taken as reference. The case of study consists of defining a metaspecification for the protection, control, measurement and communication systems required by the substations of electrical distribution. For the development the obtained previous experience in the development of a bequeathed system SA, norm IEC61850 has been taken as reference, as well as the experiences documented in the Instituto de Investigaciones Electricas (IIE), the Comision Federal de Electricidad (CFE) and Global Networking Engineering (GNE), Spain. This way, the obtained result is the metaspecification, which establishes the application of the control, protective equipment and measurement under the interoperability concepts, as well as the automation functions of substations applied in the intelligent networks (REI's). The methodology put into practice includes the design of the system architecture (SAS), the operation philosophy, the topology of the communications network, the data modeling one with logical nodes that include data types and classes of common data (CDC), transference of information, and administration of the archives ICD, SSD, SCD, and CID. [Spanish] En este articulo se presenta un caso de estudio de automatizacion de subestaciones electricas de la Comision Federal de Electricidad (CFE) de Mexico, en el cual se ha tomado como referencia la norma IEC-61850. El caso de estudio consiste en definir una metaespecificacion para los sistemas proteccion, control, medicion y comunicaciones requeridos por las subestaciones de distribucion electrica. Para el desarrollo se ha tomado como referencia la experiencia previa obtenida en el desarrollo de un sistema SA legado, la norma IEC61850, asi como las experiencias documentadas en el Instituto de Investigaciones Electricas (IIE), la Comision Federal de

  4. On-line monitoring for the detection and prevention of faults in the power transformers; Monitoreo en linea para la deteccion y prevencion de fallas en transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Tagle, Alfredo; Equihua Tapia, Hugo [Comision Federal de Electricidad (Mexico); Linan Garcia, Roberto; Pascacio de los Santos, Alberth; Nunez Dominguez, Arturo [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2000-07-01

    Power transformers are held to thermal, electrical and mechanical efforts, which degrade the isolation system oil/paper. So that to detect incipient degradations in transformers with more than 25 years of service installed in the transmission network of Commission Federal de Electricidad (CFE). The Instituto de Investigaciones Electricas (IIE), developed and installed six on-line Monitoring Systems for Power Transformers (SMLTP). The systems are installed at the substations Puebla II, banks AT-1 and AT-2, Malpaso II, bank, AT-1 and phase B of bank AT-1 of the electrical substation Villa de Garcia. [Spanish] Los transformadores de potencia estan sujetos a esfuerzos termicos, electricos y mecanicos, los cuales degradan el sistema de aislamiento aceite/papel. De modo que con el proposito de detectar degradaciones incipientes en transformadores con mas de 25 anos de servicio instalado en la red de transmision de la Comision Federal de Electricidad (CFE). El Instituto de Investigaciones Electricas (IIE), desarrollo e instalo seis Sistemas de Monitoreo en Linea para Transformadores de Potencia (SMLTP). Los sistemas se encuentran en las subestaciones Puebla II, bancos AT-1 y AT-2, Malpaso II, banco, AT-1 y fase B del banco AT-1 de la subestacion electrica Villa de Garcia.

  5. Supervisory system for real time monitoring of transient thermal stresses in turbines rotors; Sistema supervisorio para el monitoreo en tiempo real de esfuerzos termicos transitorios en rotores de turbinas

    Energy Technology Data Exchange (ETDEWEB)

    Urquiza Beltran, Gustavo; Rios Miranda, Edmundo; Venegas Guzman, Ricardo; Alvarez Garcia, Gabriela [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1991-12-31

    This article presents a supervisory system that, as its main functions, assists the operator on base of the thermal stresses, monitoring in real time the high pressure (HP) and intermediate pressure rotors (IP) of a steam turbine during the start, shut down and/or sudden load changes. The system is based on a thermal model uni-dimensional integrated to the SIMPER (Information System for the Predictive Maintenance of Rotating Equipment), tested in a 300 MW unit of Comision Federal de Electricidad (CFE). [Espanol] En este articulo se presenta un sistema supervisorio que, como funciones principales, asiste al operador con base en el monitoreo de esfuerzos termicos en tiempo real en los rotores de presion alta (PA) y presion intermedia (PI) de una turbina de vapor durante un arranque, paro y/o variaciones bruscas de carga. El sistema esta basado en un modelo termico unidimensional integrado al SIMPER (sistema informatico para el mantenimiento predictivo de equipo rotatorio), experimentado en una unidad de 300 MW de la Comision Federal de Electricidad (CFE).

  6. Nuclear reactor PBMR and cogeneration; Reactor nuclear PBMR y cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez S, J. R.; Alonso V, G., E-mail: ramon.ramirez@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2013-10-15

    In recent years the nuclear reactor designs for the electricity generation have increased their costs, so that at the moment costs are managed of around the 5000 US D for installed kw, reason for which a big nuclear plant requires of investments of the order of billions of dollars, the designed reactors as modular of low power seek to lighten the initial investment of a big reactor dividing the power in parts and dividing in modules the components to lower the production costs, this way it can begin to build a module and finished this to build other, differing the long term investment, getting less risk therefore in the investment. On the other hand the reactors of low power can be very useful in regions where is difficult to have access to the electric net being able to take advantage of the thermal energy of the reactor to feed other processes like the water desalination or the vapor generation for the processes industry like the petrochemical, or even more the possible hydrogen production to be used as fuel. In this work the possibility to generate vapor of high quality for the petrochemical industry is described using a spheres bed reactor of high temperature. (Author)

  7. para Cuba

    Directory of Open Access Journals (Sweden)

    Armando Eloy García de la Figal Costales

    2007-01-01

    Full Text Available Sobre la base del análisis de la aplicación del plan de estudio «C Perfeccionado» (cuarta versión de Mecanización Agropecuaria, desde 1999 se determina como objetivo el diseño del plan de estudio de la nueva carrera de Ingeniería Agrícola para Cuba, mediante la precisión del encargo social en las nuevas condiciones, la preparación profesional existente en el ámbito mundial y nacional y las tendencias mundiales en el desarrollo de la ciencia y la técnica, empleando la metodología del diseño curricular por objetivos. Se determinaron: el objeto de estudio y de la profesión; principales problemas a resolver; campos de acción; modo de actuación; esferas de actuación y el Modelo del Profesional, siendo su objetivo más general: explotar los sistemas de ingeniería agrícola para los procesos tecnológicos y biotecnológicos de la producción agropecuaria sostenible. El plan posee como currículo básico el 79,62 % y el 40,04 % de práctica laboral e investigativa, ambos respecto al total de horas de 5 594.

  8. para palmito

    Directory of Open Access Journals (Sweden)

    Francisco Paulo Chaimsohn

    2007-01-01

    Full Text Available Densidades de siembra, arreglos espaciales y fertilización en pejibaye (Bactris gasipaes cv Diamantes-10 para palmito. La investigación se llevó a cabo en la Estación Experimental Los Diamantes (Guápiles, Costa Rica, el 3 de octubre del 2003, cuyo objetivo fue la evaluación del efecto de diferentes densidades de siembra (3.333, 5.000 y 6.666 plantas/ha, arreglos espaciales, y diversos métodos de fertilización (química, orgánica, sobre el crecimiento de las plantas de pejibaye para producción de palmito. Se consideraron las variables diámetro y altura del tallo primario y el número de hojas y rebrotes como indicadores de producción. El período de evolución abarcó sólo los primeros 25 meses de crecimiento en el campo. El número de hojas, la altura y el diámetro del tallo no mostraron diferencias de respuesta relevantes. Sólo el número de rebrotes disminuyó al aumentar la densidad de la población, cuando se midió a los 15 meses de edad. El efecto de la fertilización se hizo evidente después de la primera cosecha, realizada a los 20 meses, debido al aumento de la competencia entre plantas, ahora más desarrolladas. Fue entonces cuando la fertilización química indujo la producción de un mayor número y vigor de los rebrotes. Sin embargo, las prácticas evaluadas 25 meses después de la siembra, no habían infl uido hasta ese momento en el número de palmitos cosechados, ni tampoco había afectado las características físicas de los sectores foliar y caulinar del palmito.

  9. Computerized procedure for protection coordination in distribution primary circuits; Procedimiento computarizado para coordinacion de protecciones en circuitos primarios de distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Carrillo, Victor M.; Velazquez Sanchez, Raul [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1986-12-31

    Nowadays, the method employed to study the protection coordination are based in the hand outlining of curves time- current and in the visual comparison in log sheets. Due to the large amount of distribution circuits, the engineer makes a considerable effort to perform this type of studies, which besides are routinist and time consuming. In this article a program for the computer aided design for the protection coordination in primary distribution circuits is presented. Such a program -carried out in the Transmission and Distribution Department of the Power Systems Division of the Instituto de Investigaciones Electricas (IIE)- substitutes in an efficient manner, the manual procedures that are performed in the protection coordination studies. The coordination principles, suggested by the equipment manufacturers, were respected, trying, at the same time, to keep the procedures of the Comision Federal de Electricidad personnel (CFE) emerged from the field experience. The algorithm basically consists of an iterative process in the selection of the adjustments taking as a reference the of three-phase short- circuit and of phase to ground, values, as well as the operating times. [Espanol] Actualmente, los metodos que se emplean para estudiar la coordinacion de protecciones se basan en el trazado manual de curvas de tiempo-corriente y en la comparacion visual sobre hojas logaritmicas. Debido a la gran cantidad de circuitos de distribucion, el ingeniero hace un esfuerzo considerable para realizar este tipo de estudios, los que ademas, son rutinarios y tardados. En este articulo, se presenta un programa para el diseno asistido por computadora del proceso de coordinacion de protecciones en circuitos primarios de distribucion. Dicho programa -realizado en el Departamento de Transmision y Distribucion, de la Division de Sistemas de Potencia, del Instituto de Investigaciones Electricas (IIE)- sustituye de manera eficaz los procedimientos manuales que se efectuan en los estudios

  10. Para Leer

    Directory of Open Access Journals (Sweden)

    Adela Sanz Cañibano

    2012-01-01

    Full Text Available Jorge L. Tizón, Ramón Ciurana, M del Carmen Fernández (Comps. Libro de casos. Promoción de la salud mental desde la atención primaria. (Adela Sanz Cañibano Grupo de Expertos en Competencia Intercultural. Instrumento para la valoración de la Competencia Intercultural en la Atención en salud mental. Hacia la equidad en salud. (María Goretti Morón Nozaleda Mariano Hernández Monsalve y Pilar Nieto Degregori (Coords.. Psicoterapia y Rehabilitación de pacientes con psicosis. (Francisco Chicharro Lezcano André du Laurens. De las enfermedades melancólicas. Jourdain Guibelet. Del humor melancólico. (Iñaki Markez Julio José? Segarra Valls. Léxico psico(patológico en la obra de Carlos Castilla del Pino. (Eudoxia Gay Pamos Giorgio Nardone y Alessandro Salvini. El diálogo estratégico. (Fernando Mansilla Izquierdo Michel Foucault. Leçons sur la volonté de savoir, suivi de Le savoir d'Edipe. (Mauricio Jalón Camilo Castelo Branco. La novela de un hombre rico. (Alicia Merisi Kenzaburo Oé. Cuadernos de Hiroshima. (Mauricio Jalón Pascal Quignard. Les solidarités mystérieuses. (Beatriz A. Rubín Documentos en la red (Juan Medrano

  11. Modernization of the subsystem man-machine interface for operation of the combined cycle central of Gomez Palacio; Modernizacion del subsistema de interfaz hombre-maquina para operacion de la central de ciclo combinado de Gomez Palacio

    Energy Technology Data Exchange (ETDEWEB)

    Rivas S, Alfonso; Uribe B, Carlos E; Alvarez C, Victor [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2002-07-01

    In order to take care of the modernization of the Combined Cycle Central of Gomez Palacio (CCCGP) of the Comision Federal de Electricidad (CFE), the Instituto de Investigaciones Electricas (IIE), through the Management of Supervision of Processes (GSP) developed the subsystem of Interface Man-Machine (IMM), to replace the workstations that are deteriorated and obsolete by personal computers, maintaining the same functions of the IMM of the present system, including the management and processing functions that at the present time another system makes. Also, to replace the equipment of the concentrators of communications by a PC with greater capacity, than allows improving in general the flexibility and robustness of the system. Among the main functions integrated in the IMM subsystem there are: the communications master with the controllers (equipment SAC), redundancy of servers, database, historical registry storage, alarm management, tabulations, tendency graphs in real time and historical, process diagrams and Control Panels. [Spanish] Con el objeto de atender las necesidades de modernizacion de la Central de Ciclo Combinado Gomez Palacio (CCCGP) de la Comision Federal de Electricidad (CFE), el Instituto de Investigaciones Electricas (IIE), a traves de la Gerencia de Supervision de Procesos (GSP) desarrollo el subsistema de Interfaz Hmbre-Maquina (IHM), para reemplazar las estaciones de trabajo que se encuentran deterioradas y obsoletas por computadoras personales, manteniendo las mismas funciones de la IHM del sistema actual, incluyendo las funciones de administracion y procesamiento que en la actualidad realiza otro sistema. Asimismo, para reemplazar los equipos de los concentradores de comunicaciones por PC con mayor capacidad, que permitan mejorar la flexibilidad y robustez del sistema en general. Entre las principales funciones integradas en el subsistema de IHM se encuentran: el Maestro de comunicaciones con los controladores (equipo SAC), redundancia de

  12. Feasibility. Technical and financial concepts to determine the feasibility of a self-supplying project; Factibilidad. Conceptos tecnicos y financieros para determinar la factibilidad de un proyecto de autoabastecimiento

    Energy Technology Data Exchange (ETDEWEB)

    Vargas A, Enrique [IGSA S.A. de C.V. (Mexico)

    2005-07-01

    The co-generation is the transformation of an energy source to two or more forms. This document deals with the co-generation equipment: gas turbines, steam turbines and reciprocating motors. It also provides a comparison between turbines and motors altogether with an analysis determining how the savings in the co-generation are obtained -an analysis dealing with thermal balance, the advantage of the radiation, the heat of the oil, the heat of the coolant, the exhaust heat and the production cost of 1 kwh. [Spanish] La cogeneracion es la transformacion de una fuente de energia a dos o mas formas. En este documento se analizan los equipos de cogeneracion: turbinas de gas, turbinas de vapor y motores reciprocantes, de la comparacion entre turbinas y motores, de como se logran los ahorros en la cogeneracion, del balance termico, el aprovechamiento de la radiacion, del calor del aceite, del calor del refrigerante, del calor del escape y del costo en la produccion de 1 kwh.

  13. Higher English language for CFE answers and marking schemes

    CERN Document Server

    Firth, Mary M; Mitchell, John

    2015-01-01

    A book of extremely detailed suggested marking instructions to use alongside the student book. This book of suggested answers offers extremely detailed marking instructions to use alongside the student book, that highlight where students can gain - or lose - the extra marks that influence grade awards. This book is photocopiable within the institution of purchase. The student book book provides you with the support and advice you will need to succeed in Higher English. By studying literary techniques and with top experts guiding you through and explaining how to use these skills, you wi

  14. Dicty_cDB: CFE810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 3e-16 5 BD18362...5 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 3e

  15. Dicty_cDB: CFE215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available , *** SEQUENCING IN PROGRESS ***, 20 unordered pieces. 48 0.12 1 CF974266 |CF974266.1 PSU_nep1G03 Defense-related ESTs from Cacao Lea...ves Theobroma cacao cDNA, mRNA sequence. 44 1.9 1 AC1450

  16. Dicty_cDB: CFE844 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA for GDP dissociation inhibitor (gdi). 38 1e-09 4 BG790353 |BG790353.1 sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEM...OR. ;, mRNA sequence. 62 3e-08 2 AW397479 |AW397479.1 sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS...08 2 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184...1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-15.... ;, mRNA sequence. 62 3e-08 2 BE800797 |BE800797.1 sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYST

  17. Dicty_cDB: CFE454 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lhfihlqvicipl liifghvivsltktvdsvhlnaimpvsmqfsrppmrsstvmntcfhyfiledpl*mfeie llitvd...e B: kliiffifiiynlislif*wqn*k*lfil**ffvvvsnflldtkrrllhfihlqvicipl liifghvivsltktvdsvhlnaimpvsmqfsrppmrsstvmn

  18. Dicty_cDB: CFE781 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence NGDEAMSNGAAFYAASLTHYFKVKEIKLKDILLNSVDVEINNNIINSGGAGETLLEETE- -- ---ELDKTSAWLSDALDNDNTETEEXRKQLKDIKKKA...*iqis*lfkrftn Frame C: mvmkqcqmvlhfmqqv*hiilklkklnlkify*iqlmlkliii*livavlvkly*kklk- -- ---ELDKTSAWLSDALDNDNTETEEX

  19. Dicty_cDB: CFE377 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Zea mays subsp. mays genomic clone ZMMBBb0184K13 3', genomic survey sequence. 48 0.073 1 AC123243 |AC123243...8708.1 CH240_68A20.TV CHORI-240 Bos taurus genomic clone CH240_68A20, genomic survey...red pieces. 46 0.29 1 CC707724 |CC707724.1 OGOBO77TH ZM_0.7_1.5_KB Zea mays genomic clone ZMMBMa0347M09, genomic survey... sequence. 46 0.29 1 CG374571 |CG374571.1 OG2AL08TV ZM_0.7_1.5_KB Zea mays genomic clone ZMMBMa0743B16, genomic survey...BBc Zea mays subsp. mays genomic clone ZMMBBc0527F12 5', genomic survey sequence. 46 0.29 1 AQ844800 |AQ8448

  20. Dicty_cDB: CFE321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nlvssli*svtcpv spskkfkfvpfqtftrltki*vlvyvrvlgidvndvikfaarsnl*inilkiikk*knkk k*kixtxxflixkk Frame B: ---atsri...cst*ixrlwfrcsstiqsskxrlcstr*fi*thv*rcqisfrl*fsrshvrc hhqrnssscrfkllqg*qrfrcsfm*gx

  1. Implementation of the design attendent by computers (CAD) for the location of structures of power transmission lines; Implementacion del diseno asistido por computadora para la localizacion de estructuras de lineas de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Vega Ortiz, Miguel; Gutierrez Arriola, Gustavo [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2000-07-01

    In order that the tools of CAD (Design Attended by Computer) that are offered in the market are really useful, they must combine the criteria and experiences of the expert designers with the specifications and practices established in the electrical company. This includes, from the introduction to the information system of the available input data and its design criteria, to obtaining the required output information. In the present work the methodology developed by the Instituto de Investigaciones Electricas (IIE) in the design of power transmission lines that integrates the Comision Federal de Electricidad (CFE) requirements in the design of its transmission power lines is an advanced computer tool that results in obtaining better designs. Some of the most important aspects are the reduction of the used working time, the cost of the designed line, its reliability, the flexibility in the information handling and the quality of presentation. [Spanish] Para que las herramientas de diseno asistido por computadora que se ofrecen en el mercado sean realmente utiles deben conjuntar los criterios y experiencias de los disenadores expertos con las especificaciones y practicas establecidas en la empresa electrica. Esto incluye desde la introduccion al sistema de la informacion de datos de entrada de la que se dispone y de sus criterios de diseno hasta la obtencion de la informacion de salida que se requiere. En el presente trabajo se resume la metodologia desarrollada por el Instituto de Investigaciones Electricas (IIE) en el diseno de lineas de transmision, que integra los requerimientos de la Comision Federal de Electricidad (CFE) en el diseno de sus lineas de transmision en una herramienta de computo avanzada y que redunda en la obtencion de mejores disenos. Algunos de los aspectos mas importantes son la reduccion del tiempo de trabajo empleado, el costo de la linea disenada, su confiabilidad, la flexibilidad en el manejo de informacion y la calidad de presentacion.

  2. Herramienta para hacer cuestionarios para Moodle

    OpenAIRE

    Muñoz Garcia, jesus

    2010-01-01

    Herramienta de creación de cuestionarios remotos de cuestiones SQL para Moodle. Permite también, el Aprendizaje colaborativo, para que los estudiantes puedan hacer cuestionarios de forma conjunta y desarrollar habilidades de trabajo en equipo. / Tool for Moodle to create remote quiz with SQL question. It also allows collaborative learning, so students can do together remote quiz and develop teamwork and social skills.

  3. Generalized conventional and intelligent supervisory control system for combined cycle generation power plants; Sistema de control supervisorio generalizado convencional e inteligente para centrales de generacion de ciclo combinado

    Energy Technology Data Exchange (ETDEWEB)

    Martinez Morales, Miguel Angel

    2004-12-15

    (conventional or intelligent) is possible to get more power generation than if we use the automatic methods based on feedback MW control. Consequently, the financial benefit due to the MW generated along a period of 2 months, is equivalent to return the investment required if the CCPP would had been repowered. Test also showed that with the fuzzy based SGC is possible to get a 'little more' power generation than if we use the PID based SGC. The development and implementation of the SGC was made in three phases: First Phase: Upgrading of the simulation dynamic mathematical model and implementation in a new software platform based on LabWindows/CVI. Second Phase: Design, implementation and testing of the PID based SGC. Third Phase: Design and implementation and testing of the Intelligent SGC, based in fuzzy logic. [Spanish] El programa de obras de generacion de la Comision Federal de Electricidad (CFE) del ano 2004 al ano 2008 esta caracterizado por el dominio del proceso de ciclo combinado para la expansion de generacion de energia en Mexico [CFE, 2000]. De acuerdo con los datos presentados por esta fuente, el incremento estimado en la capacidad de generacion de potencia electrica es de 12876 MW, de los cuales las centrales de ciclo combinado aportaran 10655 MW, lo que representa el 82.75%. Bajo estas expectativas de expansion de generacion de energia en Mexico, en este trabajo de tesis se desarrollo un sistema de control supervisorio generalizado (CSG) convencional (PID) e inteligente (logica difusa) para una central de generacion de ciclo combinado, el cual permite lograr la operacion optima de la planta a traves del arranque automatico de las unidades generadoras y obtener la maxima cantidad posible de potencia electrica en forma automatica y segura. Para el desarrollo del CSG se implanto un lazo de control por temperatura para el sistema de turbina de gas (TG) y un lazo de control por presion estrangulada para la turbina de vapor (TV). El diseno de estos sistemas

  4. A FORTRAN program for the use of digital terrain elevation models of the Instituto Nacional de Estadistica, Geografia e Informatica of Mexico (INEGI); Programa en FORTRAN para el manejo de modelos digitales de elevacion del terreno del Instituto Nacional de Estadistica, Geografia e Informatica de Mexico (INEGI)

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Estrada, Gerardo [Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad, Morelia (Mexico)

    1996-09-01

    A FORTRAN program is presented for the use of digital terrain elevation models with raster format of the Instituto Nacional de Estadistica, Geografia e Informatica of Mexico (INEGI). This program allows the selection of a data window that can be delimited, optionally, giving the extreme coordinates in degrees, minutes and seconds or in UTM (Universal Transversal Mercator) coordinates. Digital terrain data are selected to produce an output file in SURFER binary grid format with decimal degrees coordinates. Optionally an x, y, z output file in ASCII code permits the griding with commercial software to produce a map with planar rectangular coordinates. During the window selection a simple filtering process is performed to diminish numerical errors of the original file, and if it is wanted, an undersampling can be conducted to prepare less detailed maps of great coverage. This program has been extensively tested in the Gerencia de Proyectos Geotermoelectricos de la Comision federal de Electricidad (CFE) in Mexico, where it is used to prepare base maps, automatically traced topographic profiles and boundary condition for thermal modelling. Another direct uses are the calculus of terrain and isostatic corrections for gravity studies, topographic height estimating based on known horizontal coordinates, climatic effects modelling, automatic calculus of material volumes and many more. [Espanol] Se presenta un programa FORTRAN para el uso de modelos digitales de elevacion del terreno con el formato raster del Instituto Nacional de Estadistica, Geografia e Informatica de Mexico (INEGI). El programa permite la seleccion de una ventana de datos, la cual puede elegirse optativamente dando las coordenadas extremas en coordenadas geograficas en grados, minutos y segundos o en coordenadas UTM (proyeccion Universal Transversa de Mercator). Se seleccionan los datos del modelo digital y se produce una rejilla lista para su despliegue en formato binario UTM cuyo enrejillado permite

  5. Technical and economical assessment of the options for energy saving in the library of the Universidad Autonoma Metropolitana-Azcapotzalco; Evaluacion tecnico economica de opciones para el ahorro de energia en la biblioteca de la Universidad Autonoma Metropolitana-Azcapotzalco

    Energy Technology Data Exchange (ETDEWEB)

    Bratu, N.; Campero, E.; Dorantes, R.; Fuentes, V.; Figueroa, A.; Garcia, R.; Zekkour, A. [Universidad Autonoma Metropolitana-Azcapotzalco, Mexico, D. F. (Mexico)

    1993-12-31

    This paper presents a diagnosis of the electrical energy consumption in the library of the Azcapotzalco Unit of the Universidad Autonoma Metropolitana, to determine the actions that can be implemented for energy conservation. This without disturbing the lighting and thermal comfort. The analysis showed that, by changing the reflecting surfaces of the lighting lamps, the number of units can be reduced, without lowering the illumination level below the recommended values. The saving was estimated for replacement of the fluorescent lamps for others of metallic halogenides in the areas where the ceiling is high; for the installation of switches to improve the selectivity in turning on and turning off the lamps, achieving this way a better usage of the natural light; for the reduction of the electric load of the air conditioning units which will be obtained in incorporating induced draft shafts; and for an improvement in the electric and ballast installation. For the actions that turned out to be redeemable in three years the assistance of the Fideicomiso de Apoyo al Programa de Ahorro de Energia del Sector Electrico (FIDE) of the Comision Federal de Electricidad (CFE) has been available. It is expected that the execution of the modifications will be carried out in the November and December months of 1993, and the results will be evaluated in 1994. [Espanol] En este trabajo se presenta un diagnostico del consumo de energia electrica en la biblioteca de la Unidad Azcapotzalco de la Universidad Autonoma Metropolitana para determinar las acciones que se pueden llevar a cabo para ahorrar energia electrica. Esto sin deteriorar el confort luminico y termico. El analisis mostro que, cambiando las superficies reflectoras de las luminarias, se puede reducir el numero de lamparas, sin que el nivel de iluminacion quede debajo de los valores recomendados. Se estimaron ahorros: por la sustitucion de las lamparas fluorescentes por otras de halogenuros metalicos en las partes donde el

  6. Monitoring systems for the analysis of vibrations and balance of rotary machines; Sistemas de monitorizacion para el analisis de vibraciones y balanceo de maquinas rotatorias

    Energy Technology Data Exchange (ETDEWEB)

    Serrano R, Luis E; Ramirez Solis, J. Antonio; Munoz Q, Rodolfo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2004-07-01

    Often, the rotary equipment faults appear as an abnormal vibration or a change in the characteristic vibration pattern of each machine. From here the importance of counting on tools that allow to acquire and to analyze the vibration signals of the equipment while it is in operation. The Gerencia de Turbomaquinaria has worked in this field since the end of the Seventies, developing diagnosis systems based on personal computers that allow the monitoring of the dynamic behavior of the rotary equipment. The main system of this type that the Instituto de Investigaciones Electricas (IIE), nowadays offers, is the Computerized System for Dynamic Analysis, also known by its abbreviation in Spanish as: SICAD II. This was designed under the requirements of the Comision Federal de Electricidad (CFE) to collect, measure and analyze vibration data of rotary equipment. It is also used in the balance, fault diagnosis and the solution of problems in rotary equipment. The system SICAD II is portable and versatile system with which vibrations are acquired, measured and analyzed by means of the presentation of the data in graphical formats of different type and application. [Spanish] A menudo, las fallas en los equipos rotatorios se manifiestan como una vibracion anormal o como un cambio en el patron de vibraciones caracteristico de cada maquina. De ahi la importancia de contar con herramientas que permitan adquirir y analizar las senales de vibracion de los equipos mientras estan en operacion. La Gerencia de Turbomaquinaria ha trabajado en este campo desde finales de la decada de los setenta, desarrollando sistemas de diagnostico basados en computadoras personales que permiten monitorear el comportamiento dinamico de los equipos rotatorios. El principal sistema de este tipo que ofrece, actualmente, el Instituto de Investigaciones Electricas (IIE) es el Sistema Computarizado para Analisis Dinamico, conocido tambien por su abreviacion como: Sicad II. Este fue disenado bajo los

  7. The installation IGCC power plans in the petroleum refinement: international experiences and lessons for Mexico; La instalacion de plantas IGCC en la refinacion de petroleo: experiencias internacionales y lecciones para Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, Joel [Ecole du Petrole et des Moteurs, Institut Franzais du Petrole, (France)

    2004-06-15

    refinacion de petroleo ha crecido en un 14.3 % a nivel mundial a partir de 1996, en donde ya se contaba con una capacidad instalada de 160 MW. A finales de 2003 se alcanzo una capacidad instalada de 2,500 MW. El crecimiento en la instalacion de las plantas IGCC se presenta primordialmente en Europa, siendo Italia y Espana paises lideres en la construccion de esta tecnologia en la refinacion de petroleo. No obstante, paises como Holanda, Japon, Singapur y Estados Unidos cuentan con plantas IGCC para la generacion de electricidad e hidrogeno, las cuales aprovechan combustibles de bajo valor como residuos de vacio, coque de petroleo, asfalto, combustibles liquidos, entre otros. En Mexico, la instalacion de plantas IGCC en la refinacion de petroleo es nula, sin embargo Petroleos Mexicanos cuenta con la aprobacion del gobierno para la instalacion de plantas de cogeneracion en sus instalaciones. Esta aprobacion permitiria a PEMEX llevar a cabo proyectos para la instalacion de plantas IGCC, especificamente en PEMEX Refinacion, para la generacion de electricidad e hidrogeno a partir del aprovechamiento de residuos pesados de bajo valor economico. La oportunidad que ofrece la instalacion de plantas IGCC en la refinacion de petroleo es dirigida hacia la comercializacion de la electricidad e hidrogeno, lo que impulsaria a PEMEX Refinacion entrar en la competencia del mercado electrico en Mexico.

  8. Normas para vivienda

    OpenAIRE

    Coupé, Françoise

    1990-01-01

    El Seminario Taller Normas para Vivienda, analiza los efectos de las normas vigentes en el país, sobre el desarrollo urbano, la vivienda y la calidad de vida, para participar en la discusión del Estatuto Metropolitano de Usos del Suelo, Urbanismo y Construcción. Se presenta en este Boletín algunos resultados del trabajo realizado.

  9. Diagnosis system for nozzles in high voltage equipment; Sistema de diagnostico para boquillas en equipos de alta tension

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez Nino, Jose; Escorsa Morales, Oscar [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico); Lopez Azamar, Ernesto [Comision Federal de Electricidad (Mexico)

    2000-07-01

    boquillas y que permitan prever su posible falla, el Instituto de investigaciones electricas (IIE) realizo para el laboratorio de pruebas de equipos y, materiales (LAPEM) de la Comision Federal de Electricidad (CFE), un proyecto para el desarrollo de un sistema para la medicion de corrientes capacitivas en estos equipos. Este sistema permite determinar la variacion en capacitancia y perdidas dielectricas, asi como la presencia de descargas parciales internas en boquillas de 115, 230 y 400 kV. Con esta informacion es posible determinar el estado del aislamiento interno de las boquillas y retirarlas del servicio antes de que se produzca un deterioro que ponga en peligro la integridad del equipo. La gerencia de equipos electricos del Instituto de Investigaciones Electricas desarrollo para el LAPEM un sistema que mide corrientes capacitivas de boquillas de transformadores de potencia. Este sistema se diseno con el fin de instalarse en un transformador de maquina de 400 kV en la central termoelectrica de Tula, Hidalgo, de la Comision Federal de Electricidad.

  10. Aviso para las viudas.

    Directory of Open Access Journals (Sweden)

    Francisco de Sales

    2000-01-01

    Full Text Available San Pablo instruye todos los prelados en la persona de su Timoteo, diciendo: «Honra las viudas que son verdaderamente viudas». Para ser, pues, verdaderamente viuda, son necesarias estas cosas

  11. Estrategias para negociaciones exitosas.

    Directory of Open Access Journals (Sweden)

    José B. Parra V

    2010-01-01

    Full Text Available Las estrategias de negociación son herramientas para disminuir conflictos o para intercambiar bienes y servicios. Una negociación exitosa crea relaciones de solidaridad y propicia reciprocidad, cooperación y confianza para quienes tendrán relaciones permanentes de negociación con beneficios para ambas partes. Una estrategia de negociación exitosa requiere manejar el desarrollo del ambiente social del grupo de personas, con la finalidad de tener presente las fronteras que no pueden irrumpirse. Otro aspecto importante, es el lenguaje corporal utilizado por las personas y las tácticas que se practican. El manejo de esta información permite diseñar diferentes modelos de negociaciones para cada caso específico. Este documento propone la utilización de la herramienta MONACO, diseñada por los autores, que es un software útil para encontrar los mejores tácticas posibles dentro de una negociación; basándose en el lenguaje corporal que muestra el negociante oponente durante cada oferta monetaria. El uso de este software da al negociador la oportunidad de manejar las negociaciones con mayor control, el negociador que usa el software puede elegir una estrategia de acuerdo a las relaciones que espera mantener con el negociador oponente.

  12. Advantages of a recovery system implementation of gases of turbo generators, with the cogeneration systems application in process areas; Ventajas de la implementacion de un sistema de recuperacion de gases de turbogeneradores, con aplicacion de sistemas de cogeneracion en areas de proceso

    Energy Technology Data Exchange (ETDEWEB)

    Verazas Mijangos, Enrique [Petroleos Mexicanos (Mexico)

    2007-04-15

    In this article it presented the experience of a project that arises within a scheme based on the legislation that allows the industry to generate electric power for its self-supplying, with the option of transferring the energy surpluses to the network of Federal Electricity Commission or to transport to other centers of consumption, optimizing to its maximum the use of the energy and taking advantage of the installed capacity. This is the case of Petroquimica Pajaritos, engaged in improving the yield energy/product, the installed capacity as well as fulfilling the commitments Mexican Petroleum has acquired with communities where it operates, and of diminishing the atmospheric emissions. [Spanish] En este articulo se presenta la experiencia de un proyecto que surge dentro de un esquema basado en la legislacion que permite a la industria generar energia electrica para su autoabastecimiento, con la opcion de transferir los excedentes de energia a la red de la Comision Federal de Electricidad o portear a otros centros de consumo, optimizando al maximo el uso de la energia y aprovechando la capacidad instalada. Este es el caso de Petroquimica Pajaritos comprometida en mejorar el rendimiento energia/producto, la capacidad instalada, asi como cumplir con los compromisos que Petroleos Mexicanos ha adquirido, con las comunidades donde opera, y de disminuir las emisiones atmosfericas.

  13. Tiempo para un cambio

    Science.gov (United States)

    Woltjer, L.

    1987-06-01

    En la reunion celebrada en diciembre dei ano pasado informe al Consejo de mi deseo de terminar mi contrato como Director General de la ESO una vez que fuera aprobado el proyecto dei VLT, que se espera sucedera hacia fines de este aAo. Cuando fue renovada mi designacion hace tres aAos, el Consejo conocia mi intencion de no completar los cinco aAos dei contrato debido a mi deseo de disponer de mas tiempo para otras actividades. Ahora, una vez terminada la fase preparatoria para el VLT, Y habiendose presentado el proyecto formalmente al Consejo el dia 31 de marzo, y esperando su muy probable aprobacion antes dei termino de este ano, me parece que el 10 de enero de 1988 presenta una excelente fecha para que se produzca un cambio en la administracion de la ESO.

  14. Instalaciones para hotel rural

    OpenAIRE

    Roig Riera, José Antonio

    2015-01-01

    El presente proyecto cuenta con la información necesaria para el desarrollo de las instalaciones de un hotel rural. Dichas instalaciones son; la eléctrica, la de agua caliente sanitaria, las telecomunicaciones y la climatización. En el apartado de la instalación eléctrica, se han calculado todos los cables necesarios para el correcto funcionamiento del hotel, partiendo de las potencias demandadas en cada punto de consumo. Se ha calculado la línea general de alimentación, acomet...

  15. Instrucciones para autores

    OpenAIRE

    Cramer, Thomas

    2012-01-01

    Instrucciones para autoresNota preliminar: ¡Es de suma importancia que antesde enviar cualquier documento a la Revista GeologíaColombiana, lea y cumpla cuidadosamente cada uno delos subíndices de las Normas para autores!A partir del Volumen 35 (2010) recibimos artículosprincipalmente a través del sistema digital enhttp://www.revistas.unal.edu.co/index.php/geocol/index.Si quiere enviar un artículo, por favor regístrese comoAutor en el menú INGRESAR (aquí pueden registrarsetambién evaluadores u...

  16. Aprendizaje cooperativo para ELE

    OpenAIRE

    2004-01-01

    Presentación sucinta para docentes de español como lengua extranjera del conjunto de propuestas metodológicas conocidas bajo la denominación aprendizaje cooperativo : origen, fundamentación, principales principios psicopedagógicos y algunas propuestas prácticas.

  17. Radial Velocities with PARAS

    Science.gov (United States)

    Roy, Arpita; Mahadevan, S.; Chakraborty, A.; Pathan, F. M.; Anandarao, B. G.

    2010-01-01

    The Physical Research Laboratory Advanced Radial-velocity All-sky Search (PARAS) is an efficient fiber-fed cross-dispersed high-resolution echelle spectrograph that will see first light in early 2010. This instrument is being built at the Physical Research laboratory (PRL) and will be attached to the 1.2m telescope at Gurushikhar Observatory at Mt. Abu, India. PARAS has a single-shot wavelength coverage of 370nm to 850nm at a spectral resolution of R 70000 and will be housed in a vacuum chamber (at 1x10-2 mbar pressure) in a highly temperature controlled environment. This renders the spectrograph extremely suitable for exoplanet searches with high velocity precision using the simultaneous Thorium-Argon wavelength calibration method. We are in the process of developing an automated data analysis pipeline for echelle data reduction and precise radial velocity extraction based on the REDUCE package of Piskunov & Valenti (2002), which is especially careful in dealing with CCD defects, extraneous noise, and cosmic ray spikes. Here we discuss the current status of the PARAS project and details and tests of the data analysis procedure, as well as results from ongoing PARAS commissioning activities.

  18. Characterization of the voltage control systems and speed of a synchronous machine of high power for short circuit testing; Caracterizacion de los sistemas de control de voltaje y velocidad de una maquina sincrona de alta potencia para pruebas de corto circuito

    Energy Technology Data Exchange (ETDEWEB)

    Segura Ozuna, Victor Octavio; Hernandez Rodriguez, Isaura Victoria; Alcaide Godinez, Indira Xochiquetzal; Garduno Ramirez, Raul; Montero Cervantes, Julio Cesar [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Ruiz Rodriguez, Genaro; Martinez Torres; Ricardo [CFE-LAPEM, Irapuato, Guanajuato (Mexico)

    2012-07-01

    This paper introduces a characterization of the behavior of the speed and voltage control systems of a special purpose synchronous machine (GCC) based on measuring and monitoring physical signals, and recording of the sampled waveforms. Basically, the GCC supplies the energy to perform high-power short-circuits tests to certify electrical equipment and components, as required by the Comision Federal de Electricidad (CFE) in Mexico. The GCC operates alternately as motor and generator. With the GCC operating as motor, speed control during startup, acceleration, re-acceleration and braking is carried out by a static frequency converter (SFC). Complementary, the voltage controller manipulates excitation power to control terminal voltage when the GCC operates as generator and regulates excitation current when the GCC operates as motor. Compared to conventional voltage regulation systems, which must go off in case of short-circuit, the GCC voltage regulator must keep controlling field excitation to maintain the required line current and terminal voltage during short-circuit tests. Monitoring of physical signals was carried out with a portable data acquisition system based on SCXI and PXI digital platforms. A total of 78 signals were monitored with a 6 kHz sampling rate that was enough to obtain detailed signal waveforms. Data captured was processed and plotted for analysis. The signal graphs show the current real behavior of both, the voltage control system and the speed control system, and constitute a precise characterization of their behavior. [Spanish] Este documento presenta una caracterizacion del comportamiento de los sistemas de control de velocidad y voltaje de una maquina sincrona de proposito especial (GCC) basada en la medicion y monitoreo de senales fisicas, asi como en el registro de las formas de onda muestreadas. Basicamente, la GCC suministra la energia para efectuar pruebas de corto circuito de alta potencia para certificar equipo y componentes

  19. Computerized system for the support of the predictive maintenance in thermoelectric power stations of Comision Federal de Electricidad; Sistema computarizado para el apoyo del mantenimiento predictivo en centrales termoelectricas de la Comision Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Aranda A, Segio; Garcia M, Raul; Poujol G, Francisco; Chairez C, Carlos; Dominguez M, Nely [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2002-07-01

    This paper describes the functionality of the Integral System of Information for the Diagnosis of Predictive Maintenance (SIIDMP) in the thermoelectric centrals, whose primary target is to give support to the personnel related with the maintenance and operation of the thermoelectric central to optimize the application of the inspection, maintenance and its associated costs. It is important to comment that in the generating power stations of Comision Federal de Electricidad (CFE) techniques and methodologies for the preventive and corrective maintenance are applied, in addition of which they count on electronic equipment of operation dedicated to the inspection and control of vibratory equipment. The architecture of the SIIDMP is of the client-server type and for its design and implantation Windows NT 4.0 was used as operating system, SQL Server 7.0 as server and manager of the database, Visual C++ for the programs of data mining, Vision Basic 6.0 for the codification of the application programs and Interface Man-Machine (IMM), the communication mechanism Open Data Base Connectivity (ODBC) to establish the connection with the different data sources, as well as libraries of symbols and graphs that were included in the interface of the user. The main objective of the SIIDMP is to take care of the own necessities on optimization, improvements and savings in the operation of the power stations. With systems like the SIIDMP, a reduction of the costs due to shutdowns by accidental failures of the main equipment is looked for, limiting the deterioration of the equipment, as well as to provide knowledge and aid to all the personnel who take part in the management of the operation and conservation of the facilities of the power station. [Spanish] Se describe la funcionalidad del Sistema Integral de Informacion para el Diagnostico de Mantenimiento Predictivo en las centrales termoelectricas (SIIDMP), cuyo objetivo principal es apoyar al personal relacionado con el

  20. Instrucciones para autores y autoras

    OpenAIRE

    Casa de la Mujer, Revista

    2015-01-01

    Le recomendamos leer este documento a profundidad para queconozca las políticas y normas para postular a consideración su escrito.Estas instrucciones se organizan en tres apartados: I. Datos básicos,II. Políticas y III. Lineamientos para presentar el escrito; para la citacióny referenciación con APA se ofrece el documento titulado Guía dereferenciación y citación con APA.

  1. Consejos para pacientes

    OpenAIRE

    M. Eulalia Lucio-Villegas Menéndez; Laura López González; M. Isabel Gutiérrez Pérez; Natalia Aresté Lluch; M. Luisa Morató Agustí; Santiago Pérez Cachafeiro

    2014-01-01

    En el cuidado de las heridas es tan importante saber qué hacer como saber qué no hacer. Lo primero es valorar la gravedad de la lesión y saber si es necesario acudir a un centro sanitario o no. Si la herida es simple, lo más recomendable es hacer una buena limpieza con suero o agua tras lavado de manos, realizando la desinfección de esta con el antiséptico más adecuado. Los antisépticos no deben usarse para la limpieza de las heridas (usar suero fisiológico o agua del grifo) ni para la cur...

  2. Aplicaciones web para celulares

    OpenAIRE

    Riva, Diego Germán de la

    2007-01-01

    Las tecnologías inalámbricas -y en particular la telefonía celular- han tenido mucho auge y desarrollo en estos últimos años. El teléfono celular hoy día no es solo una herramienta indispensable para la gente de negocios, sino también un elemento primordial para la comunicación entre las personas. El rápido desarrollo tecnológico, la reducción de costos y el incremento de las expectativas de la gente, han provocado una invasión de teléfonos celulares en toda la sociedad, a nivel de llegar a r...

  3. Libertad para volar

    OpenAIRE

    Loureiro, Olalla

    2008-01-01

    La formación, el empleo y la arquitectura sin barreras son aspectos esenciales para la integración del colectivo de personas con discapacidad. Sin embargo, la independencia y la normalización son un grado más en la lucha por la igualdad de trato y es ahí donde entran en juego factores como el ocio y el tiempo libre.

  4. Universidades accesibles para todos

    Directory of Open Access Journals (Sweden)

    Roxana Stupp Kupiec

    2001-01-01

    Full Text Available Este trabajo pretende hacer conciencia sobrelos factores que inciden en la construcción colectiva deuniversidades dispuestas a innovar y transformar suideología, sus políticas, el currículum, los servicios estu-diantiles, la infraestructura física y administrativa y lasestrategias de comunicación e información, bajo el para-digma de la accesibilidad en el entorno. Se hace referen-cia al marco legal internacional y nacional que orientalas acciones que deben planificarse e implementarse enlas instituciones de Educación Superior.En la construcción de universidades accesibles para to-dos se requiere de un cambio en la concepción curricu-lar. Se analizan conceptos como la flexibilidad en la for-mación y el acceso a los planes de estudio para respondera las necesidades educativas de todos los estudiantes. Para promover estas transformaciones se proponen prin-cipios y prácticas tales como la interdisciplinareidad y lainclusión del tema de la discapacidad en todas las carre-ras. Además, se presentan ejemplos de aplicación en dife-rentes áreas del perfil profesional, en la formación deldocente universitario y en actividades de proyección so-cial, vida estudiantil e investigación. En el ámbito estu-diantil, se describen algunos servicios y procesos que sehan desarrollado en la Universidad de Costa Rica

  5. Educando para la ignorancia

    Directory of Open Access Journals (Sweden)

    Miguel Durán

    1996-06-01

    Full Text Available Más que describir una situación particular, los autores buscan con este escrito motivar al estudiante para que asuma posiciones críticas; así como dar un campanazo de alerta a los profesores, en relación a los conocimientos que transmiten a sus alumnos y la forma en que lo hacen; todo con el ánimo de generar verdaderos espacios de reflexión en la universidad.

  6. INICIATIVAS PARA EL CAMBIO

    Directory of Open Access Journals (Sweden)

    César Alfonso Defrancisco-Larrañaga

    2013-07-01

    Full Text Available El planeta no atraviesa por su mejor momento en materia de conservación y renovación de sus recursos naturales. Claramente en los últimos tiempos los recursos hídricos han venido haciéndose cada vez menores; el hombre ha notado con preocupación y vivido en carne propia este fenómeno, que de no ser tratado a tiempo, podría atentar contra la existencia misma. Esto lo ha alentado a buscar métodos que sirvan como solución para contrarrestar éste mal y crear conciencia entre sus iguales, para así poder garantizar su permanencia y la de su entorno durante muchas generaciones. En países desarrollados del continente europeo y en algunos lugares de América del norte, el uso de sistemas de reutilización y tratamiento de aguas grises y aprovechamiento de las aguas lluvias se ha convertido en una constante y nos están dando las pautas para poder seguir el ejemplo y así de esta manera poder aportar a la causa ambiental y a su vez crear un ahorro en nuestros gastos mensuales de consumo.

  7. Systems for the calculation of electrical parameters and energy efficiency for high-capacity hydroelectric generators; Sistemas para el calculo de parametros electricos y eficiencia energetica para generadores hidroelectricos de gran capacidad

    Energy Technology Data Exchange (ETDEWEB)

    Reyes Martinez, Oscar Alfonso; Pascacio de los Santos, Alberth; Perez Abad, Carlos Alberto [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Leon Rivera, Nicolas [CFE-LAPEM, Irapuato, Guanajuato (Mexico)

    2012-07-01

    In recent years, the Comision Federal de Electricidad (CFE) has developed important hydroelectrical power projects in Mexico. Most of them are located in the Santiago River Hydrological System in Nayarit, Mexico. A total of 27 projects with a capacity of 4,300 MW are considered but only 32% of them have been carried out. One of the most ambitious projects that continue in process of construction is the Hydroelectrical Plant La Yesca. This project will conclude in late 2012 and consists of two electric generators of 375 MW, 17 kV. It will be second in power and the third in electrical generation at the system. According to national and international standards, a set of static and dynamic tests must be performed in these generators before commissioning, to ensure their proper operation. Winding stator high voltage endurance test, three phase sudden short circuit test and energy efficiency calculation are some of the most important tests to be performed in a new electrical generator. These tests are difficult to perform on-site due to the equipment capacity required, so very few companies in the world can conduct them. In Mexico no one has the necessary infrastructure for testing in high capacity hydroelectric generators such as those from La Yesca, so the Laboratorio de Pruebas a Equipos y Materiales (LAPEM) has invested in projects to improve this project in order to meet the needs of the Mexican electricity sector. This paper is a description of the systems developed for the calculation of electrical parameters and energy efficiency for this class of generators. [Spanish] En los ultimos anos, la Comision Federal de Electricidad (CFE) ha desarrollado importantes proyectos hidroelectricos en Mexico. La mayor parte se ubican en el Sistema Hidrologico del Rio Santiago en Nayarit, Mexico. Se consideran un total de 27 proyectos con capacidad de 4300 MW, pero solo 32 % de ellos se han llevado a cabo. Uno de los proyectos mas ambiciosos que continua en proceso de

  8. para mejorar el %R

    Directory of Open Access Journals (Sweden)

    Alfredo Díaz Mata

    2001-01-01

    Full Text Available En este trabajo se revisan dos indicadores técnicos bursátiles que están estrechamente relacionados, el oscilador estocástico %K de Lane y el oscilador %R de Williams; asimismo, se evalúa el uso de dos mecanismos asociados con el primero y que no suelen utilizarse con el %R: el proceso de frenado (slowing y el uso de un promedio móvil del propio oscilador estocástico como disparadores de señales de compra y de venta. Realizando simulaciones con 27 acciones y el Índice de Precios y Cotizaciones de la Bolsa Mexicana de Valores se verifica la hipótesis principal y se comprueba que, efectivamente, en muchos casos, el uso del proceso de frenado con el oscilador %R de Williams permite tomar mejores decisiones. Por otro lado, se concluye que de los dos disparadores de señales el que mejor funciona, tanto para %K como para %R es el uso de cotas inferior y superior. Este artículo surgió en el curso de una investigación sobre el análisis técnico bursátil de acciones que se puede realizar en su totalidad por computadora y que, esencialmente, excluye el análisis gráfico. Uno de los propósitos del estudio es determinar si es posible, y bajo qué mecanismos, establecer un sistema de análisis bursátil que le permita al inversionista tomar decisiones de inversión en acciones en la Bolsa Mexicana de Valores sin tener que emplear la considerable cantidad de tiempo que es necesario para el análisis gráfico tradicional. Durante este estudio se realizó un análisis preliminar de unos 120 indicadores técnicos para, por un lado, conocerlos con cierto detalle y, por otra parte, aislar aquellos que prometían ser de utilidad para el objetivo de la investigación. Fue en este proceso cuando se detectó que existen dos indicadores que están relacionados y que permiten un análisis por separado que tiene, cuando menos, dos ventajas. En primer lugar está el placer que da a quien gusta de estos temas encontrarse con indicadores que, de acuerdo

  9. Inmunopotenciadores para la acuicultura

    Directory of Open Access Journals (Sweden)

    Rocmira Pérez

    2014-04-01

    Full Text Available La acuicultura es una de las actividades económicas de mayor crecimiento para la producción de alimentos. Uno de sus principales retos es la obtención de grandes volúmenes de producción con la mayor calidad posible. Esto conlleva a una reducción de la aplicación de antibióticos y productos quimioterapéuticos. Una de las estrategias más prometedoras es la aplicación de inmunopotenciadores, principalmente en los cultivos intensivos. El objetivo de este trabajo fue revisar los principales inmunopotenciadores, así como las tendencias y retos de su uso mundial. Se resumen las particularidades moleculares y funcionales de los mismos y se hace énfasis en los más estudiados: levamisol, ß-glucanos, lipopolisacárido, vitamina C, extractos de plantas y hormonas. Todos estos compuestos de naturaleza heterogénea inciden mayoritariamente en los componentes de la inmunidad innata de los peces, fortaleciendo y potenciando la resistencia a enfermedades; adicionalmente algunos de ellos tienen funciones antiestrés y favorecen su crecimiento. Se concluye que los inmunopotenciadores constituyen una estrategia viable para reducir las pérdidas por problemas sanitarios en el sector de la acuicultura; pero aún quedan por solucionar aspectos como la vía de administración y la etapa de inmunización adecuada para cada especie y tipo de cultivo.

  10. Partir para quedarse

    OpenAIRE

    Cortes, Geneviève; Franqueville, André

    2015-01-01

    Partir para quedarse... la paradoja resume la situación de muchos campesinos de los Andes bolivianos, confrontados a una creciente pobreza. El jefe de familia y muchas veces sus hijos van a trabajar en las planicies amazónicas, a la Argentina o a un país rico del norte. Su propósito es ganar suficiente dinero que les permita al resto de la familia vivir en el lugar de origen e independizarse después. Las olas migratorias son abordadas en un cuadro de un estudio comparativo de las sociedades ...

  11. Comunicar para la salud

    Directory of Open Access Journals (Sweden)

    Lic. Eva Bocco

    1998-01-01

    Full Text Available Con este trabajo quiero plantearles una inquietud en torno al rol que nos cabe a los comunicadores en el área de la salud desde la perspectiva de la comunicación para la salud. ¿Se puede pensar la salud pública desvinculada de la comunicación? ¿La comunicación es posible sin la existencia de salud en la comunidad? ¿Qué puede hacer un comunicador en el ministerio de salud? ¿Puede un estado desarrollar políticas de salud sin la presencia de la comunicación?

  12. Nombrados para el mal

    OpenAIRE

    Lara, Claudio; Sanchez, Mariela

    2011-01-01

    El presente trabajo se encuentra inscripto en la investigación Las vicisitudes del lazo amoroso en la época actual en el Gran La Plata. En ella, nuestro rasgo de investigación fue establecer algunas coordenadas para pensar que los signos de la Declinación del Nombre del Padre deben leerse en la transformación del registro del amor, dejando por fuera el registro que más desarrollos ha tenido dentro del campo del psicoanálisis: el de los ideales y el de la autoridad. La propuesta es que si El n...

  13. Para uma antropologia diferente

    OpenAIRE

    1980-01-01

    Revista da FCSH, N.1, 1980, pp. 235-243 Quando no ano lectivo de 1975/76, começámos, num dos cursos de apôs-graduação, o ensino de Antropologia Cultural na Universidade Nova de Lisboa, muitos dos alunos ficaram deveras surpreendidos com o nosso estilo de linguagem e, particularmente, com a natureza das analogias de tipo transdisciplinar que empregávamos para explicar determinados fenômenos ou factos sociais e culturais. Era corrente, durante as sessões de trabalho, ref...

  14. Espirales tubulares para turbinas

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-07-01

    Full Text Available Para el suministro y fabricación de las espirales tubulares que debían alimentar las turbinas del aprovechamiento hidroeléctrico de Brownlee, que constituye el primero de los cuatro saltos del grupo Hells Canyon, del río Snake, la conocida factoría S. Morgan Smith, especializada en la construcción de turbinas y material a ellas accesorio, se encargó del estudio, fabricación y montaje de cuatro de estas espirales tubulares de 5,50 m de diámetro máximo.

  15. Ha vuelto para mirarnos

    OpenAIRE

    2008-01-01

    En cada entrega analizaremos un cuadro, mirándolo con ojos matemáticos. Con esa particular mirada, fruto de nuestra propia (de)formación. Y desde ese punto de vista haremos paseos por el arte y las matemáticas. Espero que el lector, como hago yo mismo, disfrute descubriendo más allá de lo que a simple vista distinguiría cualquiera. Al fin de cuentas, el arte, como las matemáticas, han sido creados para hacernos disfrutar.

  16. Para pensar o afeto

    Directory of Open Access Journals (Sweden)

    Aluisio Pereira de Menezes

    Full Text Available Apresentação de um conjunto de formulações relativas ao “afeto” anteriores ao surgimento da psicanálise. Dificuldade da psicanálise em construir uma concepção propriamente psicanalítica. Contribuição da fenomenologia de Husserl para o estudo do afeto. Atualidade das concepções do afeto marcadas pelas neurociências. As maneiras principais de ver o problema da conceituação do afeto no pensamento psicanalítico.

  17. Comunicar para la salud

    OpenAIRE

    Lic. Eva Bocco

    1998-01-01

    Con este trabajo quiero plantearles una inquietud en torno al rol que nos cabe a los comunicadores en el área de la salud desde la perspectiva de la comunicación para la salud. ¿Se puede pensar la salud pública desvinculada de la comunicación? ¿La comunicación es posible sin la existencia de salud en la comunidad? ¿Qué puede hacer un comunicador en el ministerio de salud? ¿Puede un estado desarrollar políticas de salud sin la presencia de la comunicación?

  18. Ayudas TIC para Dislexia

    OpenAIRE

    Gassol Noguera, Ambrosio

    2016-01-01

    El artículo que presento intenta difundir las posibilidades de ofrecer ayudas para facilitar la lectura y la escritura en el mismo procesador de textos, sin tener que recurrir al uso de otros programas informáticos a la vez. Además se incorpora la posibilidad de adaptar el formato del texto a las preferencias del usuario (siguiendo los resultados de unos estudios presentados en 2012 que indican que la velocidad y comprensión de personas con dislexia mejora aumentando la separación entre las l...

  19. Principios teatrales para docentes

    Directory of Open Access Journals (Sweden)

    R. Irene Arroyo Zúñiga

    2005-01-01

    Full Text Available Este trabajo pretende dar herramientas a los docentes para que puedan utilizarlas como parte de las actividades dentro de un plan de elección, en cualquier disciplina. Además encontrará una exposición de los elementos que componen el arte de la representación escénica, como son: 1. Expresión corporal; es la capacidad de expresar emociones partiendo únicamente de nuestro cuerpo. 2. Impostación; es la habilidad de proyectar la voz sin lastimar las cuerdas vocales. 3. Dicción; es la pronunciación correcta de las palabras. 4. Actuación; es la posibilidad de crear un personaje partiendo de los recursos expresivos y de la forma natural en que el alumno acostumbra a reaccionar. Técnica de improvisación, en éste artículo propongo una serie de seis pasos que pueden ser de gran ayuda a la hora de usar el teatro como recurso didáctico. El teatro a lo largo de la historia ha sido usado para transmitir conocimientos, valores, creencias y todo aspecto inherente a los individuos y su entorno social. Por lo tanto debemos aprovechar al máximo los beneficios que nos ofrece el teatro como educadores

  20. "Colaborar para Competir"

    Directory of Open Access Journals (Sweden)

    Martha Liliana Hijuelos-Cárdenas

    2016-08-01

    Full Text Available De acuerdo con Michael Porter, los Clusters se definen como “Una agrupación de empresas e instituciones relacionadas entre sí, pertenecientes a un mismo sector o segmento de mercado, que se encuentran próximas geográficamente y que colaboran para ser más competitivas”. Los Clusters son en última instancia una herramienta de competitividad basada en la cooperación de sus miembros, y es una de las estrategias recientes, en el país, para incrementar la productividad y competitividad y las apuestas productivas desde el nivel local. Y es precisamente esta cercanía geográfica de las empresas de un mismo sector, lo que a la vez que genera la competencia entre ellas, también les facilita el acceso a insumos y a conocimientos específicos y en última instancia les permite promover la innovación.

  1. Gas turbine modular helium reactor in cogeneration; Turbina de gas reactor modular con helio en cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Leon de los Santos, G. [UNAM, Facultad de Ingenieria, Division de Ingenieria Electrica, Departamento de Sistemas Energeticos, Ciudad Universitaria, 04510 Mexico, D. F. (Mexico)], e-mail: tesgleon@gmail.com

    2009-10-15

    This work carries out the thermal evaluation from the conversion of nuclear energy to electric power and process heat, through to implement an outline gas turbine modular helium reactor in cogeneration. Modeling and simulating with software Thermo flex of Thermo flow the performance parameters, based on a nuclear power plant constituted by an helium cooled reactor and helium gas turbine with three compression stages, two of inter cooling and one regeneration stage; more four heat recovery process, generating two pressure levels of overheat vapor, a pressure level of saturated vapor and one of hot water, with energetic characteristics to be able to give supply to a very wide gamma of industrial processes. Obtaining a relationship heat electricity of 0.52 and efficiency of net cogeneration of 54.28%, 70.2 MW net electric, 36.6 MW net thermal with 35% of condensed return to 30 C; for a supplied power by reactor of 196.7 MW; and with conditions in advanced gas turbine of 850 C and 7.06 Mpa, assembly in a shaft, inter cooling and heat recovery in cogeneration. (Author)

  2. Environmental characteristics of cogeneration plant; Caracteristicas ambientales de una central de cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Mourelle, A.; Torron, M. M.

    1999-07-01

    The cogeneration of electric power in special regimen, to the help of the new juridical applicable frame, supposes some clear energy advantages that are translated in an environmental improvement in the group of the energy cycle. Nevertheless, this production demands a systematic control of the most significant environmental looks in their operation, with object of assuring the operation to complete the legal applicable dispositions strictly. The article presents an analysis of the environmental implications of the operation of a Central of cogeneration and their control. (Author)

  3. Atmospheric electric discharges and grounding systems; Descargas atmosfericas y sistemas de conexion a tierra

    Energy Technology Data Exchange (ETDEWEB)

    Rivas, Elena [ed.] [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    1999-07-01

    In this article the work made by the Institute of Investigaciones Electricas (IIE), in the area of atmospheric electric discharges and grounding connections at Comision Federal de Electricidad (CFE) is presented. The work consisted of the revision of the procedures for the design of transmission lines and substations of CFE from which high indexes of interruptions are reported, from this, a program was defined that allowed to improve the existing designs in CFE. [Spanish] En este articulo se presenta el trabajo realizado por el Instituto de Investigaciones Electricas (IIE), en el area de descargas atmosfericas y conexiones a tierra en Comision Federal de Electricidad (CFE). El trabajo consistio en la revision de los procedimientos de diseno de las areas de transmision y subestaciones de la CFE para los que se reportan altos indices de salidas, a partir de esto se definio un programa que permitio mejorar los disenos existentes en la CFE.

  4. Boiler model of a 300 Mw fossil fuel power plant for the turbine turning simulator; Modelo de caldera de una planta termoelectrica de 300 Mw para el simulador de rodado de turbina

    Energy Technology Data Exchange (ETDEWEB)

    Rossano Roman, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1993-07-01

    The objective of the model is to reproduce the behavior of a boiler of a 300 Mw fossil fuel unit, in the training turbine turning simulator. This simulator was designed to be used in the training that is performed in the control rooms or training centers of the fossil fuel power plants of the Comision Federal de Electricidad (CFE). In this article the equations of the model for a 300 Mw thermal plant are described, based in balances and physical relationships. The basic considerations and simplifications are shown. The model considers the combustion in the furnace, the dome, the downcomers, the recirculation pumps, the water walls, the superheater and the reheater. The mass and energy balances take into account the sensible heat of all the constituents involved, as well as the combustion heat. Heat transference zones by convection or by a combined mechanism convective-radiant, in the boiler furnace, are considered. The dome pressure is modeled with basis in the mass and energy balance, considering all the existing sources and sinks. The simulation also reflects the pressure transients due to thermal variations, combustion variations, and steam demand variations. The heat transference by convection is considered for all the tube banks along the combustion gases path to the stack. Comparisons were made with the design and operation data of the power station, using a selection of transient states to demonstrate de model fidelity. This selection was focussed of transients states, at the unit start up, since in this operation stage the turning and the heating of the turbine is accomplished. [Espanol] El objetivo del modelo es reproducir el comportamiento de una caldera de una unidad termoelectrica de 300 Mw, en el simulador para entrenamiento en rodado de turbina. Este simulador se diseno para ser utilizado en el entrenamiento que se realiza en los cuartos de control o centros de entrenamiento de las plantas termoelectricas de la Comision Federal de Electricidad (CFE

  5. Remedial actions to improve the availability in steam generators; Acciones correctivas para mejorar la disponibilidad en generadores de vapor

    Energy Technology Data Exchange (ETDEWEB)

    Torres Toledano, J. Gerardo; Porras Loaiza, G. Lizbeth; Sanchez Hernandez, Laura E.; Salinas B, Victor M.; Nebart G, Jesus [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    was demonstrated that the lack of power of the unit is not due to the combustion air deficiency. The metallographic study of the fault of the RU tube is mentioned, where a graph of the estimated life span at different rates of wear by corrosion and metal temperature for a tube of SA-213-TPH metal is presented. The details of the interconnections at the reheater are shown and a table of comparison of proposed temperatures at the RH outlet is present. A table of main causes of power decrease is attached. [Spanish] En este articulo se presentan los resultados del analisis de fallas recurrentes de cuatro Unidades Generadoras de Centrales Termoelectricas (UGT) de la Comision Federal de Electricidad (CFE). En tres de los cuatro casos, los estudios se enfocaron a identificar y corregir las causas raiz de fallas recurrentes en tubos de generadores de vapor, las unidades analizadas son: U-2 del Complejo Termoelectrico Pdte. Adolfo Lopez Mateos (CTPALM) de Tuxpan, Veracruz; U-3 de la Central Termoelectrica (CT) de Salamanca, y U-1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan. En el otro caso se analizo la insuficiencia de aire de combustion como una de las causas de decremento de potencia de la unidad 1 de la CT Gral. Manuel Alvarez Moreno de Manzanillo, Colima. Los generadores de vapor de la unidad 2 del CTPALM y la unidad 3 de la CT de Salamanca presentaron fallas en el banco del recalentador (RH). En este caso las recomendaciones se enfocaron al mejoramiento en las condiciones operativas para atenuar las fallas por corrosion en alta temperatura. A diferencia del CTPALM, en el caso de la U-3 de Salamanca se concluyo que es necesario el rediseno del RH; para ello se propuso permutar trayectorias de tubos calientes con los frios para uniformizar la temperatura de vapor a la salida del RH. Para evaluar los problemas que se han presentado en el generador de vapor de las unidades 1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan se analizaron las fallas de

  6. Bases para proyectiles dirigidos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1959-03-01

    Full Text Available Aunque actualmente no se ha llegado a una línea general de métodos o sistemas que gobiernen un tipo característico de rampa y servicios auxiliares necesarios para el lanzamiento al espacio de proyectiles dirigidos a grandes alturas y distancias, las experiencias obtenidas en diferentes ensayos, utilizando distintos tipos de proyectiles y trayectorias balísticas, han sentado toda una serie de procedimientos, datos y conclusiones de gran valor balístico que, aun teniendo en cuenta la continua evolución del proyectil, sus formas, combustibles y alcances, se conocen ya, con bastante aproximación, las condiciones mínimas que ha de reunir una base dedicada a este tipo de lanzamientos.

  7. Contratados peninsulares para Cuba

    Directory of Open Access Journals (Sweden)

    Iglesias García, Fe

    1994-12-01

    Full Text Available Not available.

    Ante las presiones británicas, la metrópoli española y los ideólogos de los hacendados cubanos tuvieron que dar, desde la tercera década del siglo XIX, una respuesta a la previsible escasez de mano de obra esclava. El artículo estudia los sistemas de contrata implantados en la isla para abastecer de mano de obra blanca y barata a Cuba, deteniéndose particularmente la autora en el estudio de las condiciones de semiesclavitud que se escondían en las mencionadas contratas y en el perfil de los inmigrantes (profesiones, sexo, edad, procedencia....

  8. Gas turbine application in power plants of Mexican refineries; Aplicacion de turbinas de gas en plantas de fuerza de refinerias mexicanas

    Energy Technology Data Exchange (ETDEWEB)

    Alcaraz Calderon, A. M.; Rodriguez Martinez, H.; Garcia Paredes, Job; Morales Guillen, Magdalena; Manzanares Papayanapolous, Emilio [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)]. E-mail: malcaraz@iie.org.mx; jhrm@iie.org.mx; jgarcia@iie.org.mx; mmmg@iie.org.mx; emp@iie.org.mx

    2010-11-15

    This article presents an overview of the application to have the gas turbine power generation systems, electric and steam for Mexican refineries. First there is a general description of the gas turbines and heat recovery (system components CHP) and CHP schemes are based on gas turbines capable of use in Mexican refineries. Subsequently referred to the characteristics of energy consumption (steam and electricity) from Mexican refineries and performs a technical analysis of CHP schemes based on gas turbines from the point of view of rates Q/W, power efficiencies and combined concluded that by their nature are very useful for refinery and gives some recommendations for improved implementation. [Spanish] En este articulo se presenta una vision general de la aplicacion que tienen las turbinas de gas en sistemas de generacion de energia electrica y vapor para refinerias mexicanas. Primeramente se da una descripcion general de las turbinas de gas y recuperadores de calor (componentes principales del sistema de cogeneracion) y se muestran los esquemas de cogeneracion basados en turbinas de gas susceptibles de utilizar en refinerias mexicanas. Posteriormente se mencionan las caracteristicas de consumos energeticos (vapor y energia electrica) de las refinerias mexicanas y se realiza un analisis tecnico de los esquemas de cogeneracion basado en turbinas de gas desde el punto de vista de tasas Q/W, eficiencias electricas y combinadas, concluyendose que por sus caracteristicas son muy utiles para refinerias y se dan algunas recomendaciones para su mejor aplicacion.

  9. Methodology for the electric energy distribution systems planning of small and rural zones of Comision Federal de Electricidad; Metodologia para la planeacion de sistemas de distribucion de energia electrica de zonas pequenas y rurales de Comision Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Ochoa Gomez, Miguel Armando

    2008-12-15

    retiro de las instalaciones que ya no seran utiles. Por otra parte, la gran mayoria de los estudios de planeacion de los sistemas de distribucion que se realizan estan orientados hacia grandes urbes o areas de alto crecimiento, y aunque estos estudios pueden ser aplicados a cualquier sistema, los ingenieros de planeacion de las Zonas de Distribucion medianas o pequenas, con frecuencia se confunden tratando de hacer las actualidades de forma similar a las politicas de planeacion de esas urbes. Las Zonas de Distribucion pequenas tienen particularidades propias, por lo que vale la pena hacer un esfuerzo para investigarlas y analizar todas las oportunidades de mejorar que se presentan y aplicarlas en otras zonas de la Division Jalisco o del pais con caracteristicas similares. Despues de todo, en la Division Jalisco el 60% de las Zonas estan dentro de esta clasificacion y puede ser un porcentaje similar en las otras Divisiones de Distribucion de la CFE. Asimismo, aunque en mucha menor proporcion, estas Zonas tambien tienen necesidades de inversion que sumandolas en ciertos casos, pueden ser superiores a la suma de las necesidades de las grandes Zonas. Para atender la deficiencia anterior, en el Capitulo 2 se propone una metodologia que se especialice en la planeacion de los sistemas electricos de distribucion de las Zonas pequenas o rurales, en el cual se integraron los aspectos mas relevantes de los manuales de planeacion, la teoria de la ingenieria electrica, los procedimientos institucionales, las normas, los programas comerciales y los programas desarrollados por la Gerencia de Planeacion; utilizados en la CFE para hacer la planeacion de los sistemas electricos de distribucion. De la misma manera, en el Capitulo 4 se propone una metodologia para la optimizacion de las redes electricas en baja tension, resaltando algunos errores que comunmente se cometen en el diseno de estos tipos de redes, haciendo recomendaciones para corregirlos con inversiones de bajo costo. Por su

  10. Leer para Creer

    Directory of Open Access Journals (Sweden)

    Roberto Polanco-Carrasco

    2011-12-01

    Full Text Available Más allá de los prejuicios que se puedan alimentar en las aulas por -en ocasiones- brillantes exponentes de la clínica psicológica, resultaría difícil creer que exista hoy en día un profesional que se atreva a sostener que el ser humano es sólo mente, o argumentar que lo corporal o cerebral es secundario e incluso irrelevante en los pacientes con los que habitualmente se deberá tratar. De hacerlo simplemente sería un acto de ignorancia, sobretodo en un momento en que disponemos de evidencias diarias desde las neurociencias que dan para sostener la unidad mente-cuerpo como nunca antes en la historia del estudio de “lo psicológico”. La convicción de que los estudiantes deberán ser nutridos con las nociones básicas de los modernos estudios del cerebro debería reflejarse en la bibliografía de diversas asignaturas y estar presente en el espíritu central del quehacer académico como una manera de prevenir esta viciosa tendencia a ningunear aquello que se desconoce y que finalmente cegará a la hora de probar nuevas formas de ver “el síntoma”.

  11. para promover la salud

    Directory of Open Access Journals (Sweden)

    Ma. del Consuelo Chapela

    2002-01-01

    Full Text Available Hablar de educación a distancia sustentada en el desarrollo de la cibernética obliga a reflexionar sobre sus definiciones, objetivos y medios, especialmente si pensamos en las necesidades de la fracción de población que no tiene acceso a las posibilidades que ofrece el desarrollo tecnológico. En este trabajo se presenta e ilustra con un ejemplo práctico, una perspectiva sobre las posibilidades de la educación a distancia desde las necesidades de la promoción de la salud entre grupos de población marginada en el mundo virtual. Se propone la creación de bibliotecas itinerantes regionales que pongan a disposición de la población con acceso limitado a la información, la tecnología comunicativa necesaria para apoyar los trabajos de promoción de la salud.

  12. Verification and software validation for nuclear instrumentation; Verificacion y validacion de software para instrumentacion nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gaytan G, E. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Salgado G, J. R. [Comision Nacional de Seguridad Nuclear y Salvaguardias, Dr. Barragan No. 779, Col. Narvarte, 03020 Mexico D. F. (Mexico); De Andrade O, E. [Universidad Federal de Rio de Janeiro, Caixa Postal 68509, 21945-970 Rio de Janeiro (Brazil); Ramirez G, A., E-mail: elvira.gaytan@inin.gob.mx [Comision Federal de Electricidad, Gerencia de Centrales Nucleoelectricas, Alto Lucero, Veracruz (Mexico)

    2014-10-15

    In this work is presented a Verification Methodology and Software Validation, to be applied in instruments of nuclear use with associate software. This methodology was developed under the auspices of IAEA, through the regional projects RLA4022 (ARCAL XCIX) and RLA1011 (RLA CXXIII), led by Mexico. In the first project three plans and three procedures were elaborated taking into consideration IEEE standards, and in the second project these documents were updated considering ISO and IEC standards. The developed methodology has been distributed to the participant countries of Latin America in the ARCAL projects and two related courses have been imparted with the participation of several countries, and participating institutions of Mexico like Instituto Nacional de Investigaciones Nucleares (ININ), Comision Federal de Electricidad (CFE) and Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS). In the ININ due to the necessity to work with Software Quality Guarantee in systems for the nuclear power plant of the CFE, a Software Quality Guarantee Plan and five procedures were developed in the year 2004, obtaining the qualification of the ININ for software development for the nuclear power plant of CFE. These first documents were developed taking like reference IEEE standards and regulator guides of NRC, being the first step for the development of the methodology. (Author)

  13. Marcadores para la Realidad Aumentada para fines educativos

    Directory of Open Access Journals (Sweden)

    María Reina Zarate Nava

    2013-12-01

    Full Text Available La Realidad Aumentada (AR es considerada por algunos expertos como la tecnología en crecimiento para el 2014, en diferentes sectores: ingeniería, educación, juegos y negocios, siendo este último el más usado en él 2013. Sin embargo en el sector educativo la AR se presenta en algunos proyectos que se han desarrollado para diferentes áreas de las ciencias, como Química, Física y Matemáticas, lo anterior con el objetivo de facilitar el proceso de Enseñanza-Aprendizaje. En el presente artículo se presenta el modelo de patrones utilizado para un Proyecto AR enfocado en Química, el cual presenta un conjunto de patrones que fueron valorados para facilitar el rastreo de los objetos y a su vez el entendimiento de algunos materiales de los laboratorios de Química I.

  14. Una agenda para educadores

    Directory of Open Access Journals (Sweden)

    Robert O. McClintock

    2007-01-01

    Full Text Available Las instituciones educativas constituyen los principales factores en la construcción social de un nuevo sistema educativo. Las escuelas y los educadores controlan y producen propiedad intelectual de una extraordinaria profundidad y amplitud. Los cambios producidos por las tecnologías digitales están consiguiendo que el acceso y la producción de conocimiento sea más accesible y universal. Lo que es, a la vez, un gran logro de apertura curricular, pero también un grave peligro de perder la perspectiva eminentemente “educativa” de la transmisión del conocimiento en la escuela. Los nuevos recursos permiten a los educadores romper el ciclo de reproducción en los logros educativos, acercarse al medio y a la familia y transformar la escuela. Los educadores y las escuelas deben asumir el reto de constituir comunidades de aprendizaje. Así como de atreverse a producir y difundir ese conocimiento con soporte digital. Lo contrario sería una terrible abdicación. El artículo traza un recorrido histórico sobre esta función de la escuela y su adaptación a los medios y recursos de cada época. Tras lo cual, aboga por asumir el desafío actual de las TICs, para renovar el vínculo progresista con la posteridad y construir un mejor futuro. Los nuevos recursos permiten a los educadores romper el ciclo de reproducción en los logros educativos, acercarse al medio y a la familia y transformar la escuela.

  15. Planar Para Algebras, Reflection Positivity

    CERN Document Server

    Jaffe, Arthur

    2016-01-01

    We define the notion of a planar para algebra, which arises naturally from combining planar algebras with the idea of $\\Z_{N}$ para symmetry in physics. A subfactor planar para algebra is a Hilbert space representation of planar tangles with parafermionic defects, that are invariant under isotopy. For each $\\Z_{N}$, we construct a family of subfactor planar para algebras which play the role of Temperley-Lieb-Jones planar algebras. The first example in this family is the parafermion planar para algebra. Based on this example, we introduce parafermion Pauli matrices, quaternion relations, and braided relations for parafermion algebras which one can use in the study of quantum information. Two different reflections play an important role in the theory of planar para algebras. One is the adjoint operator; the other is the modular conjugation in Tomita-Takesaki theory. We use the latter one to define the double algebra and to introduce reflection positivity. We give a new and geometric proof of reflection positivi...

  16. Almanaques y calendarios para maestros

    Directory of Open Access Journals (Sweden)

    Miryam CARREÑO

    2013-11-01

    Full Text Available En este artículo analizamos los contenidos de los almanaques para maestros publicados en la segunda mitad del siglo XIX (después de la puesta en marcha de la primera ley de Instrucción pública y primeras décadas del siglo XX. Estos libritos, especialmente escritos para maestros, juegan un papel muy importante en la construcción del tiempo escolar. Constituyeron un excelente instrumento para los maestros en lo que respecta a la organización del trabajo escolar, sincornizándola con las demandas de la administración central en el desarrollo de la legislación educativa. También se utilizaron para difundir temas de interés para los maestros referentes a diversas disciplinas: gramática, literatura, geografía, ciencias... Dedican, además, algunas páginas para anunciar manuales escolares y material de enseñanza.

  17. Remedial actions to improve the availability in steam generators; Acciones correctivas para mejorar la disponibilidad en generadores de vapor

    Energy Technology Data Exchange (ETDEWEB)

    Torres Toledano, J. Gerardo; Porras Loaiza, G. Lizbeth; Sanchez Hernandez, Laura E.; Salinas B, Victor M.; Nebart G, Jesus [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    was demonstrated that the lack of power of the unit is not due to the combustion air deficiency. The metallographic study of the fault of the RU tube is mentioned, where a graph of the estimated life span at different rates of wear by corrosion and metal temperature for a tube of SA-213-TPH metal is presented. The details of the interconnections at the reheater are shown and a table of comparison of proposed temperatures at the RH outlet is present. A table of main causes of power decrease is attached. [Spanish] En este articulo se presentan los resultados del analisis de fallas recurrentes de cuatro Unidades Generadoras de Centrales Termoelectricas (UGT) de la Comision Federal de Electricidad (CFE). En tres de los cuatro casos, los estudios se enfocaron a identificar y corregir las causas raiz de fallas recurrentes en tubos de generadores de vapor, las unidades analizadas son: U-2 del Complejo Termoelectrico Pdte. Adolfo Lopez Mateos (CTPALM) de Tuxpan, Veracruz; U-3 de la Central Termoelectrica (CT) de Salamanca, y U-1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan. En el otro caso se analizo la insuficiencia de aire de combustion como una de las causas de decremento de potencia de la unidad 1 de la CT Gral. Manuel Alvarez Moreno de Manzanillo, Colima. Los generadores de vapor de la unidad 2 del CTPALM y la unidad 3 de la CT de Salamanca presentaron fallas en el banco del recalentador (RH). En este caso las recomendaciones se enfocaron al mejoramiento en las condiciones operativas para atenuar las fallas por corrosion en alta temperatura. A diferencia del CTPALM, en el caso de la U-3 de Salamanca se concluyo que es necesario el rediseno del RH; para ello se propuso permutar trayectorias de tubos calientes con los frios para uniformizar la temperatura de vapor a la salida del RH. Para evaluar los problemas que se han presentado en el generador de vapor de las unidades 1 y 2 de la CT Felipe Carrillo Puerto de Valladolid, Yucatan se analizaron las fallas de

  18. Uma ferramenta para planejamento de estudos para concursos

    Directory of Open Access Journals (Sweden)

    Leonardo Pimentel

    2015-11-01

    Full Text Available De acordo com a constituição brasileira, a única forma de se tornar um empregado do governo é passar em um concurso público. O exame de conhecimento do cargo é um dos componentes mais importantes de um concurso. Estudar para esse exame é uma tarefa que requer planejamento. Um meio de obter um bom planejamento é construir uma grade de horários que relacione as matérias a serem estudadas com os respectivos horários disponíveis para o estudo. Esse tipo de problema se assemelha bastante à gerência de projetos, em que se procura estabelecer a distribuição das atividades ao longo do tempo disponível. Assim, torna-se interessante explorar a dinâmica de estudos para concursos como um projeto. O presente trabalho apresenta a ferramenta de apoio ao estudos - Passe-me, baseada no ciclo PDCA (do inglês, Plan-Do-Check-Act. Por se tratar de uma ferramenta web, o tempo de resposta para produzir uma grade de estudos é fundamental. A ferramenta faz uso de algoritmo genético para calcular a grade de horários priorizando a velocidade de resposta. A ferramenta foi avaliada em diferentes cenários de uso e obteve desempenho satisfatório durante a produção da grade de estudos.

  19. ¿Argumentar para definir o definir para argumentar?

    OpenAIRE

    Silva, Luz; Samper, Carmen

    2013-01-01

    Se presenta y se ilustra un marco de referencia de un estudio en curso para obtener el título de Maestría en Docencia de la Matemática de la Universidad Pedagógica Nacional (Colombia); estudio sobre la conexión entre las acciones de definir y argumentar, que puede contribuir a la práctica de profesores en ejercicio y en formación. La habilidad para construir una definición es un posible indicio de comprensión, mientras que saberla de memoria no garantiza la comprensión del concepto (Vinner, 1...

  20. Modelo para establecer sanciones pecuniarias para delitos ambientales

    OpenAIRE

    LUIS DIEGO VÉLEZ GÓMEZ

    2012-01-01

    Este artículo pretende exponer el modelo básico que sustenta el desarrollo de multas óptimas; en él se muestra la forma de desincentivar los intereses del violador de la normatividad ambiental, e igualmente el método para alcanzar efectos compensatorios sobre los daños cometidos al medio ambiente. El desarrollo del tema sobre sanciones pecuniarias (multas) y penalidades (encarcelamiento) toma la relación contractual entre el agente (la empresa) y el principal (La entidad reguladora) para, a t...

  1. Renewable energies for power generation in Latin America: market, technologies and perspectives; Energias renovables para generacion de electricidad en America Latina: mercado, tecnologias y perspectivas

    Energy Technology Data Exchange (ETDEWEB)

    De Martino Jannuzzi, Gilberto [Universidade Estadual de Campinas, UNICAMP e International Energy Initiative (Brazil); De Buen Rodriguez, Odon [Energia, Tecnologia y Educacion, S.C., ENTE, S.C. (Mexico); Gorenstein Dedecca, Joao [International Energy Initiative, IEI (Brazil); Goncalves Nogueira, Larissa [International Energy Initiative, IEI (Brazil); Maia Gomes, Rodolfo Dourado [International Energy Initiative, IEI (Brazil); Navarro, Judith [Energia, Tecnologia y Educacion, S.C., ENTE, S.C. (Mexico)

    2010-07-01

    hidroelectrica en la region. La energia geotermica es un recurso importante en Mexico y en America Central, con una capacidad instalada de 965 MW y 502 MW en 2008, respectivamente. En esos dos casos, es la principal fuente de generacion de electricidad. Argentina posee campos de alta entalpia, adecuados para el aprovechamiento geotermico para la generacion de electricidad, pero no hay ninguna estimacion del potencial de generacion. Chile es otro pais que trata de desarrollar su potencial geotermico. En 2009, el Gobierno de Chile llamo una licitacion para 20 concesiones de explotacion de energia geotermica. Durante el proceso de licitacion geotermica se recibieron 59 ofertas de proyectos de explotacion y se concedio a 9 empresas la concesion de las 20 areas licitadas. La biomasa es un recurso energetico de especial importancia en Brasil, donde ya supera a las PCH. Tambien es relevante en Argentina y Colombia, donde esta asociada a la industria alco-azucarera y al creciente interes en sistemas de cogeneracion.

  2. Procedure of generation of the ECP database for Laguna Verde; Procedimiento de generacion de base de datos ECP para Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-09-15

    This procedure will be used by the personnel of the Discipline of Nuclear Analysis of the Reactor of CFE to execute PRESTO with the purpose of generating the base for the Estimate of the Position of critical bars during the start up (ECP Database). (Author)

  3. Para todo mal, a cura

    Directory of Open Access Journals (Sweden)

    Maria Borges

    2014-11-01

    Full Text Available Nesse artigo, eu apresento a teoria kantiana do mal. Mostrarei que Kant divide o mal em três níveis: fraqueza, impureza e perversidade, relacionando-os com afetos e paixões. Eu defendo que Kant apresenta várias formas de curar o mal nos diversos textos, tais como Doutrina da Virtude, Antropologia, Ideia para uma história universal do ponto de vista cosmopolita e Religião nos limites da simples razão. Eu tentarei mostrar que a virtude é impotente para curar o mal e que Kant apresenta uma comunidade ética para esse fim. Por fim, eu compararei a construção de comunidade ética com o estabelecimento de uma sociedade civil jurídica

  4. Taller para desarrollar la creatividad

    OpenAIRE

    MARTÍNEZ GUEROLA, BEATRIZ

    2015-01-01

    [ES] Partimos de la base de que la creatividad es una capacidad realmente valiosa, no solo para el ámbito artístico, si no para cualquier aspecto de la vida. Este proyecto está enfocado a un taller diseñado para que a partir de técnicas de expresión gráfico-plásticas podamos estimular y desarrollar la creatividad, principalmente en niños de tercer ciclo de primaria. Con este proyecto relacionamos el arte y la creatividad que se asocia a esté con la educación. Martínez Guerola, B. (2015). T...

  5. FRANQUICIAS. Una Alternativa para Emprendedores

    OpenAIRE

    2013-01-01

      Este artículo presenta las ventajas de las franquicias como alternativa de negocios. Para un emprendedor exitoso ya establecido es más rentable permitir el uso de su conocimiento explícito mediante el formato de negocio de su firma y recibir regalías mensuales sobre las ventas brutas, que invertir en la apertura de cada nuevo punto. Igualmente, para quien desee iniciarse como empresario, la modalidad de franquicia es muy interesante: en primer lugar, porque empieza con un negocio ya probado...

  6. Desarrollo multimedia para el aprendizaje

    OpenAIRE

    SEGURA ORTELLS, JUAN JOSÉ

    2013-01-01

    El proyecto se basa en el interés por dinamizar los boletines textuales. Las ventajas de un boletín dinámico respecto a los actuales textuales son tanto para los alumnos como los profesores. El alumno puede ver todo el contenido que está trabajando con todo tipo de ayudas multimedia, que le facilitará el trabajo porque lo hará más fácil de entender y además tendrá ayudas para resolver los problemas, interactuando con el contenido. El profesor podrá hacer un seguimiento más s...

  7. MODELO PARA ESTABLECER SANCIONES PECUNIARIAS PARA DELITOS AMBIENTALES

    Directory of Open Access Journals (Sweden)

    LUIS DIEGO VÉLEZ GÓMEZ

    2012-01-01

    Full Text Available Este artículo pretende exponer el modelo básico que sustenta el desarrollo de multas óptimas; en él se muestra la forma de desincentivar los intereses del violador de la normatividad ambiental, e igualmente el método para alcanzar efectos compensatorios sobre los daños cometidos al medio ambiente. El desarrollo del tema sobre sanciones pecuniarias (multas y penalidades (encarcelamiento toma la relación contractual entre el agente (la empresa y el principal (La entidad reguladora para, a través de esta relación, entrar en la determinación de un diseño eficaz de sanciones. Se utilizara el modelo de agente-principal para examinar los efectos de las sanciones corporativas e individuales sobre los incentivos de cumplimiento en el contexto ambiental; además se emplearán los conceptos de bienes públicos, bienes comunes y externalidades como categorías de análisis que permiten la identificación y valoración de daños ambientales.

  8. "Bac" in Science--A "Whole School" Approach to Learning and Teaching (the CfE)

    Science.gov (United States)

    Ritchie, Margaret R.

    2010-01-01

    The Scottish Baccalaureate in Science or Languages is a new qualification, introduced in 2009, currently being undertaken by senior pupils in Scottish schools. To achieve a Baccalaureate, each pupil must complete an Interdisciplinary Project, a research project that bridges two subjects being studied at Advanced Higher level, plus two Advanced…

  9. Separating Para and Ortho Water

    CERN Document Server

    Horke, Daniel A; Długołęcki, Karol; Küpper, Jochen

    2014-01-01

    Water exists as two nuclear-spin isomers, para and ortho, determined by the overall spin of its two hydrogen nuclei. For isolated water molecules the conversion between these isomers is forbidden and they act as different molecular species. Yet, these species are not readily separable, and little is known about their specific physical and chemical properties, conversion mechanisms, or interactions. Here we demonstrate the production of isolated samples of both spin isomers in pure beams of para and ortho water, with both species in their respective absolute ground state. These single-quantum-state samples are ideal targets for unraveling spin-conversion mechanisms, for precision spectroscopy and fundamental-symmetry-breaking studies, and for spin-enhanced applications, e. g., laboratory astrophysics and -chemistry or hypersensitized NMR experiments.

  10. Financiamiento para construir la finca.

    Directory of Open Access Journals (Sweden)

    Túpac Barahona.

    1998-08-01

    Full Text Available Las instituciones financieras convencionales y no convencionales tienden a excluir de los servicios de crédito a los sectores más frágiles del campesinado, por considerarlos clientes altamente riesgosos. En este artículo, se discute el sentido económico y social que tendrían que desarrollar esquemas de financiamiento para campesinos con economías débiles, pero con un potencial de desarrollo latente.

  11. Cuento: para eso es hombre

    Directory of Open Access Journals (Sweden)

    José Chalarca

    1983-06-01

    Full Text Available No recuerdo si usaba zapatos, solo que era una época difícil para la familia. Una racha de mala suerte que culminó con la prisión del padre, lo forzó a dejar la escuela y a emplearse como mandadero en una casa de ricos cuando tenía apenas once años.

  12. Argumentos para repensar el "desarrollo"

    Directory of Open Access Journals (Sweden)

    María Luisa Eschenhagen

    2001-06-01

    Full Text Available Con este trabajo se quiere hacer una aproximación al problema desde una perspectiva diferente, considerando nuevos argumentos que hasta hace muy poco tiempo no se habían tenido en cuenta y que se vienen formulando de una manera muy interesante en los últimos años. El objetivo del artículo es presentar tres argumentos para señalar la necesidad de repensar, desde sus fundamentos, el concepto de desarrollo.

  13. Para conocer a los otros

    OpenAIRE

    Andrés ESCARBAJAL FRUTOS

    2006-01-01

    El presente artículo analiza el término cultura e intenta dar las claves para conocer otras culturas a través de las categorías culturales que utilizan. Al mismo tiempo, se propone un cuadro de categorías conectado a las dimensiones cognitiva, afectiva y moral-ética, así como a las manifestaciones externas.

  14. Diagramas de Bianchi para Susy

    Directory of Open Access Journals (Sweden)

    Sara Cruz y Cruz

    2006-01-01

    Full Text Available Se revisa el origen de los solitones como soluciones de la ecuación de Korteweg-de Vries y su presencia en la formulación supersimétrica de la Mecánica Cuántica. Se introducen los diagramas de Bianchi como una herramienta simbólica para construir socios supersimétricos de un Hamiltoniano dado.

  15. Nacidos para curar...y vivir.

    OpenAIRE

    Pedro A Marina González

    2009-01-01

    Se presentan argumentos para el debate acerca del impacto para la sociedad y el individuo de las técnicas de reproducción que permiten el “diseño” genético de bebes para el tratamiento de hermanos con enfermedades incurables.

  16. Nacidos para curar...y vivir.

    Directory of Open Access Journals (Sweden)

    Pedro A Marina González

    2009-01-01

    Full Text Available Se presentan argumentos para el debate acerca del impacto para la sociedad y el individuo de las técnicas de reproducción que permiten el “diseño” genético de bebes para el tratamiento de hermanos con enfermedades incurables.

  17. Coccocypselum pulchellum (Rubiaceae, nuevo registro para Argentina

    Directory of Open Access Journals (Sweden)

    Elsa L. Cabral

    2007-01-01

    Full Text Available Se cita Coccocypselum pulchellum por primera vez para Argentina, en Predio Guaraní, Misiones. Esta es la tercera especie de Coccocypselum registrada para la flora de Argentina junto con C. hasslerianum y C. lanceolatum. Se incluyen descripciones, ilustraciones y una clave para reconocer las tres especies argentinas de Coccocypselum.

  18. Ocio Inclusivo para personas con discapacidad

    OpenAIRE

    Ruiloba Arce, Marta María

    2014-01-01

    Mi proyecto de Fin de Grado trata del ocio inclusivo para personas con discapacidad intelectual. Como educadora social apuesto por la inclusión social para la mejora de calidad de vida de las personas, siendo uno de los medios más efectivos para lograr una sociedad sin diferencias ni prejuicios. [...

  19. Condiciones para el aprendizaje organizacional

    Directory of Open Access Journals (Sweden)

    Delio Ignacio Castañeda

    2015-01-01

    Full Text Available El propósito de esta investigación es contribuir al entendimiento de algunas condiciones que favorecen el aprendizaje en las organizaciones, específicamente el rol de la cultura del aprendizaje, la formación, la claridad estratégica y el soporte organizacional. Se emplea una metodología cuantitativa con 613 participantes, empleados de una organización pública y 2 compa˜nías privadas, las 3 entidades ubicadas en Bogotá, Colombia. Para la realización del estudio se conformó una muestra por conveniencia, con el apoyo de los jefes de recursos humanos de 3 organizaciones con sede en la ciudad de Bogotá, Colombia. Para la recolección de los datos se utilizó una escala Likert de 5 niveles de respuesta. Los resultados sugieren que las 4 condiciones estudiadas contribuyen al aprendizaje organizacional. Los hallazgos de este trabajo orientan a profesionales sobre dónde focalizar esfuerzos para promover la adquisición y la generación de conocimiento organizacional y aporta al trabajo investigativo ampliando la evidencia empírica sobre este campo de relevancia organizacional.

  20. requisito para pensar la paz

    Directory of Open Access Journals (Sweden)

    Jaidivi Núñez Varón

    2006-01-01

    Full Text Available Este documento señala puntos de discusión para reflexionar sobre cómo la justicia basada en la construcción social tiene la posibilidad de convertirse en un requisito para pensar la paz. El análisis inicia desde algunos horizontes planteados por la sociología jurídica, la antropología jurídica, la psicología social y el derecho. El objetivo es permitir que el lector tenga preguntas que contribuyan para pensar la paz en un país que tiene la coyuntura del conflicto armado y que cuestiona la justicia desde el escalamiento de la violencia en el espacio cotidiano. Se señalan algunos puntos de la relación entre la justicia y la paz desde la construcción del Estado, identificando los momentos y características de la conexión de estos dos conceptos en el curso de los acontecimientos históricos. Se presenta la concepción de la justicia a través de la óptica del pensamiento complejo y se plantea una discusión de cómo pensar la paz desde la construcción social.

  1. para asegurar un hijo sano

    Directory of Open Access Journals (Sweden)

    Carmen Amarilis Guerra de Castillo

    2006-01-01

    Full Text Available Esta investigación etnográfica focalizada exploró las creencias, los valores, los hábitos y los padrones comportamentales de las embarazadas diabéticas atendidas en el Hospital Doctor Enrique Tejera, quienes residen en tres comunidades urbanas pobres de la ciudad de Valencia - Venezuela, con el objetivo de encontrar el significado del cuidado de si para dichas grávidas. Se utilizó como referencial teórico el Modelo del Análisis de la Salud y la Teoría Antropológica de la Salud, siendo fundamentales para revelar aquello que estaba implícito en el comportamiento de las mujeres con relación a su cuidado. Surgieron tres temas: la salud y la enfermedad - valores culturales del cuidado de si; las prácticas del cuidado de la salud y cuidándose en el embarazo garantiza tener un hijo más saludable. Los temas culturales revelaron que las creencias, los valores, los hábitos y los patrones culturales comportamentales, conforme las tres maneras de acción identificadas, pueden ser preservadas, acomodadas y re-estructuradas para proporcionar un cuidado culturalmente congruente.

  2. Estrategia para la sustentabilidad ambiental

    Directory of Open Access Journals (Sweden)

    Cecilia Erbiti

    2006-01-01

    Full Text Available En el contexto de los postulados conceptuales y metodológicos de la planificación estratégica y de sustentabilidad ambiental, el objetivo de esta investigación es describir el proceso de formulación del Plan de Ordenamiento Territorial del Municipio de Tandil (POTM y analizar su potencialidad para avanzar hacia la sustentabilidad ambiental del sistema. Los resultados de la misma muestran que el POTM no sólo prioriza principios, objetivos y estrategias que materializan las diferentes manifestaciones de la sustentabilidad (económica, social, ecológica y política, sino que la totalidad del Plan se fundamenta en el concepto de desarrollo sostenible y, con ello, se establecen prioridades de actuación que posibilitarán la gestión ambiental urbana. Si bien el POTM muestra una gran potencialidad para avanzar hacia la sustentabilidad del territorio, la implementación y cumplimiento del mismo constituye un fuerte desafío para las autoridades de aplicación.

  3. Nueva Sede para la Academia

    Directory of Open Access Journals (Sweden)

    Mario Camacho Pinto

    1994-06-01

    Full Text Available

    Una nueva sede adecuadamente dotada siempre estuvo en la mente de nuestros expresidentes Académicos César Augusto Pantoja, Hernando Groot, Pablo Gómez Martínez, Jorge Cavelier Gaviria y Efraim Otero-Ruiz, con quienes me tocó en suerte trabajar 12 años consecutivos, cerca de ellos a través de mi cargo de Coordinardor de la Comisión Permanente de Biblioteca y Publicaciones y de la Revista MEDICINA que se ha venido publicando sin interrupciones dentro de un compañerismo ejemplar; además de otras distinciones operativas que me inducen a expresar gratitud.

    Ahora, además, como Secretario de la Coporación por elección unánime de la Asamblea hace dos años, he sido testigo ático de una intensa, inteligente e inagotable actividad que nuestro Presidente Académico Juan Jacobo Muñoz Delgado quien siempre con el visto bueno de la Junta Directiva, mediante un acelerado ritmo de trabajo se impuso la tarea de convertir en realidad inmediata tan anhelada y necesaria idea.

    En efecto, la nueva sede fue inaugurada oficialmente el día 2 de septiembre de 1993.

    Este Editorial es la constancia escrita de tal febril actividad que para proporcionar evidencia a los lectores de “MEDICINA” resumo en breves incisos que muestran el tránsito a un estado con superávit de excepción para esta clase de instituciones:

    1. Terminación de la obra ya iniciada de la remodelación arquitectónica, tanto exterior de seguridad y aspecto como interior con suficientes y modernas instalaciones.

    2. Cerramiento total con altas y elegantes rejas metálicas y doble portería por la calle 69 y la carrera 7a.

    3. Aparcadero lujosamente adoquinado, amplio y seguro para 30 automóviles.

    4. Decoración interior estéticamente consultada, bien lograda en cortinas y clásicas lámparas de cristal obsequiadas por conocidos académicos. Un par de originales urnas precolombianas en el hall de entrada.

    5. Zona social doble, amplia

  4. Vajilla para gastronomía oriental

    OpenAIRE

    2015-01-01

    El equipo de diseño realizó tres sets: un set teishoku (platos calientes), compuesto por cuencos básicos, por un plato principal, por un hashiokis (apoya palillos) y por una jarra para salsa de soja; un set sake, compuesto por un pocillo de 30 ml (uno por persona), por una jarra de 150 ml y por una bandeja; y un set sushi, compuesto por una bandeja para piezas de sushi (para dos personas), por un hashioki (apoya palillos), por una jarra para salsa soja, por un platillo para gari (je...

  5. Justicia (Social) para Adolescentes una alternativa para evitar la criminalidad

    OpenAIRE

    Rios Ruiz, Alma de los Ángeles

    2011-01-01

    Si bien es cierto que las reformas constitucionales del año de 2005 entienden a la justicia para adolescentes como la creación de instituciones que acerquen a los mayores de 12, pero menores de 18 años al ordenamiento jurídico por haber cometido una conducta tipificada como delito; pero semánticamente la palabra Justicia abre una oportunidad al Gobierno  y a la Sociedad Civil de evitar el uso del aparato represor del Estado.

  6. PLATAFORMA PARA LA VENTA DE VIDEOJUEGOS DIGITALES PARA PC

    OpenAIRE

    2013-01-01

    A lo largo del trabajo vamos a exponer nuestra propia idea de negocio de una nueva empresa, llamada GAMERINET, que se dedique a la venta de videojuegos de ordenador en descarga digital a través de nuestra web. Para ello vamos a ver una breve introducción a este sector de negocio y su historia, haremos un análisis de las condiciones actuales del sector, a través del análisis del entorno específico (5 Fuerzas de Porter) y del análisis del entorno general (Análisis PEST). Posterio...

  7. TRABALHAR PARA ESTUDAR / ESTUDAR PARA TRABALHAR: REALIDADE E POSSIBILIDADES

    Directory of Open Access Journals (Sweden)

    Janes Siqueira

    2011-07-01

    Full Text Available O trabalho que apresentamos é parte da pesquisa com os estudantes das licenciaturas e da pedagogia da Universidade de Santa Cruz do Sul-UNISC-RS-Brasil. Este está inserido na linha de pesquisa: educação, trabalho e emancipação. Queremos compreender, à luz do materialismo histórico e dialético e das categorias da crítica da economia política, os significados atribuídos pelos estudantes universitários ao fenômeno trabalho e estudo. É uma pesquisa preferentemente qualitativa de natureza dialética. Para Marx, a essência da realidade humana reside no trabalho, mas a fonte de toda a riqueza está na natureza. Logo, trabalho, natureza e sociedade estão em relação dialética. Trabalho, portanto, é a ideia central articuladora, e natureza e sociedade devem ser estudadas em conexão com o trabalho. Marx trata o trabalho, no modo de produção capitalista, como impedimento ao desenvolvimento humano. Propõe o mesmo como um ato de criação e auto-expressão humana que não deve ter um valor. A compreensão dessa premissa é necessária para que os trabalhadores possam significar e ressignificar o trabalho para além da ideologia dominante. Algumas categorias aparecem como relevantes para a análise: condições de trabalho e de estudo, necessidade de formação, predominância do trabalho sobre o estudo, dificuldade de conciliar tempo de estudo e de trabalho. Na relação com o objeto de estudo, ressaltaremos a crise estrutural do capital, a desregulamentação das leis do trabalho e sua flexibilização e as contradições entre trabalho e estudo bem como quais possibilidades emancipatórias são visualizadas ou sonhadas pelos trabalhadores-estudantes. PALAVRAS-CHAVE: contradições entre trabalho e educação, condições e significados, realidade e possibilidades.

  8. Paz : notas para um estudo

    OpenAIRE

    Aguiar, Roberto Armando Ramos de

    2008-01-01

    Apresenta um mapeamento de alguns aspectos que devem ser aprofundados no tratamento da paz. Comenta sobre a distinção entre paz ativa e paz passiva. Discorre sobre a paz e a natureza, a paz e as categorias de solidariedade, a paz e poder, a paz e política, paz e tecnologia, paz e sujeito, paz, tolerância e hospitalidade, paz e homens de palha, paz e violência, paz e justiça. Considera que para se refletir sobre a paz, o ser humano deve ser recolocado no interior da natureza, pois a prática hi...

  9. Mandevilla (Apocynaceae, Mesechiteae para Brasil

    Directory of Open Access Journals (Sweden)

    J. Francisco Morales

    2005-01-01

    Full Text Available Se describen dos nuevas especies de Mandevilla (Apocynoideae, Mesechiteae subgénero Exothostemon, endémicas de Brasil. Mandevilla abortiva se encuentra relacionada con un grupo de especies conformado por M. huberi, M. obtusifolia y M. pachyphylla, discutiéndose sus afinidades con esos taxones. Mandevilla clandestina ha sido confundida por largo tiempo con M. scabra, diferenciándose por sus flores más pequeñas. Se incluyen descripciones completas, ilustraciones y el listado de especímenes examinados para ambos taxones.

  10. Escuelas aceleradas para alumnos desaventajados

    OpenAIRE

    1992-01-01

    Descripción del proyecto de escuelas aceleradas, nacido en California con Henry M. Levin, para contribuir a reducir las diferencias de rendimiento entre alumnos aventajados y desaventajados al final de la Enseñanza Primaria. Se parte de la idea de que es la escuela y no el niño el causante del fracaso escolar de los grupos sociales marginados en Estados Unidos. Se indican sus objetivos, características y resultados, al tiempo que se hace una reflexión sobre el proyecto a partir de la LOGSE.

  11. Dar de comer para convivir

    OpenAIRE

    DE VIDAS , Anath Ariel; Hémond, Aline; Hooft, Anuschka van ’t

    2014-01-01

    Comer implica cuestiones vitales que articulan las relaciones sociales entre los grupos humanos y que “nutren” numerosas formas culturales concebidas como específicas. Los espectros del hambre y la preocupación cotidiana para conseguir alimentos y prepararlos están aún presentes en numerosas sociedades (Fischler, 1990) y colocan así la comida en el centro de las relaciones sociales y también de ciertas formas culturales de comunicación, de clasificación, de inclusión y de exclusión (Douglas, ...

  12. Un framework para mundos virtuales

    OpenAIRE

    Basílico, Matías M.; Arnaude, Juan R.

    2005-01-01

    Los Frameworks nos proveen la herramienta para diseñar las relaciones de un dominio determinado sentando así una Arquitectura de Software que modela gran parte de la lógica de todas las aplicaciones encargadas de solucionar problemas del dominio. El Framework es la base subyacente sobre la que “descansan” las aplicaciones desarrolladas. Ya en tercer año de la carrera, realizamos una aplicación sobre mundos virtuales de criaturas y colonias de seres vivos (VRColonies). Llegando al final de ...

  13. Pequenos para idade gestacional: fator de risco para mortalidade neonatal

    Directory of Open Access Journals (Sweden)

    Almeida Márcia Furquim de

    1998-01-01

    Full Text Available OBJETIVO: Estudar as variáveis contempladas na Declaração de Nascimento (DN como possíveis fatores de risco para nascimentos pequenos para a idade gestacional (PIG e o retardo de crescimento intra-uterino como fator de risco para a mortalidade neonatal. MATERIAL E MÉTODO: As variáveis existentes na DN foram obtidas diretamente de prontuários hospitalares. Os dados referem-se a uma coorte de nascimentos obtida por meio da vinculação das declarações de nascimento e óbito, correspondendo a 2.251 nascimentos vivos hospitalares, de mães residentes, ocorridos no Município de Santo André, Região Metropolitana de São Paulo, no período de l/1 a 30/6/1992, e aos óbitos neonatais verificados nessa coorte. RESULTADOS: Obteve-se a proporção de 4,3% de nascimentos PIG, significativamente maior entre os recém-nascidos de pré-termo e pós-termo, entre os nascimentos cujas mães tinham mais de 35 anos de idade e grau de instrução inferior ao primeiro grau completo. Os recém-nascidos PIG apresentam maior risco de morte neonatal que aqueles que não apresentavam sinais de retardo de crescimento intra-uterino. CONCLUSÕES: Em áreas com menor freqüência de baixo peso ao nascer, é importante investigar a presença de retardo de crescimento intra-uterino entre os nascimentos prematuros e não apenas nos nascimentos de termo. O registro da data da última menstruação (ou da idade gestacional em semanas não agregadas na DN facilitaria a detecção de PIGs na população de recém-nascidos.

  14. Para onde vai a Geografia?

    Directory of Open Access Journals (Sweden)

    Angélica Karina Dillenburg Horii

    2015-12-01

    Full Text Available O presente artigo aborda a evolução da Geografia enquanto pensamento científico, analisando seu objeto de estudo e suas categorias de análise durante todo o percurso da criação desse saber. Observa primeiramente a formação da Geografia Clássica, que teve seus princípios já instituídos na Antiguidade com Ptolomeu e Estrabão, desdobrando-se no período Iluminista com Ritter e Humboldt que fornecerão uma nova temporalidade a essa ciência. Atinge seu ápice na Modernidade Industrial com a racionalidade de Kant, onde Ratzel e La Blache utilizarão o determinismo e o possibilismo para constituir um discurso científico para a Geografia. Finaliza apontando a nova compreensão do mundo, conhecida como pós-modernismo por David Harvey (1992 ou por Milton Santos (1996 como Globalização, que junto a outros geógrafos e pesquisadores, indicam caminhos de análise dessa ciência na compreensão do seu objeto de estudo. Um diálogo entre os autores na construção do pensamento geográfico.

  15. Spectral Analysis Code: PARAS SPEC

    CERN Document Server

    Chaturvedi, Priyanka; Anandarao, B G

    2016-01-01

    The light emitted from the stellar photosphere serves as a unique signature for the nature of stars. The behaviour of these stellar lines depend upon the surface temperature, mass, evolutionary status and chemical composition of the star. With the advent of high-resolution spectrographs coupled with medium to large aperture telescopes around the globe, there is plenty of high-resolution and high signal-to-noise ratio data available to the astronomy community. Apart from radial velocity (RV) studies, such data offer us the unique opportunity to study chemical composition and atmospheric properties of the star. The procedure used to derive these parameters must be automated and well adaptable to data available from any high-resolution spectrograph. We hereby present an IDL code, PARAS SPEC, which was primary designed to handle high-resolution spectroscopy data from PARAS spectrograph coupled with the 1.2~m telescope at Mt. Abu, India. This code is designed to adapt with data from other spectrographs as well. Th...

  16. Aprender para la vida o para el placer

    Directory of Open Access Journals (Sweden)

    Diobaldo César Heredia Gutiérrez

    2011-07-01

    Full Text Available El proceso enseñanza aprendizaje, se corresponde con un sistema comunicativo por excelenciaque requiere una alta dosis de amor que garantice el disfrute o goce de los participantes, enun interactuar de búsqueda y descubrimiento satisfactorio. Para imprimirle un alto grado de calidad, esdeseable la participación de estudiantes y docentes más emprendedores y críticos y menos académicoso dependientes, por ello el aprendizaje autónomo es clave, el logro u objetivo, entonces, es estudiantesque aprendan como si fueran a enseñar y docentes investigadores, proactivos y expertos en las materiasque enseñan.

  17. Infraestructura para laboratorios de acceso remoto

    Directory of Open Access Journals (Sweden)

    López Luro, Francisco

    2009-01-01

    Full Text Available Las tecnologías de Internet permiten el uso de sistemas de software distribuido para el acceso en forma remota a laboratorios físicos y virtuales, para llevar a cabo actividades de investigación experimental a distancia. A partir de los marcos teóricos que definen los estructurantes de los laboratorios, los implementadores de laboratorios de acceso remoto deben diseñar y desarrollar arquitecturas de servicios que permitan un acceso flexible y controlado. Este trabajo define una infraestructura para la implementación de aplicaciones para el acceso remoto a laboratorios físicos y virtuales y para la gestión de los mismos. Se presentan conceptos que permiten extender la modalidad tradicional de conexión con un dispositivo, para llevar adelante actividades prácticas de laboratorio colaborativas y concurrentes.

  18. Internet como instrumento para la Yihad

    Directory of Open Access Journals (Sweden)

    Alfonso Merlos García

    2006-01-01

    Full Text Available Las extraordinarias ventajas que ofrece Internet lo han convertido en un instrumento clave y dinámico en la estrategia de los yihadistas. Los medios de comunicación, la clase política y las agencias de seguridad e información han tendido a concentrar sus esfuerzos en la neutralización del ciberterrorismo sin prestar suficiente atención a los múltiples usos de Internet que están haciendo los neosalafistas: para la propaganda y para la guerra psicológica, para el reclutamiento y para la financiación, para la documentación y para la planificación de atentados. Las democracias deberían considerar el coste que tendrá la derrota frente al movimiento yihadista globalizado en la batalla por el ciberespacio

  19. Inteligencia Emocional para tiempos de crisis

    OpenAIRE

    Fernandez-Berrocal, Pablo

    2014-01-01

    La Inteligencia Emocional se concibe como un conjunto de habilidades, tanto básicas como complejas, dirigidas a “unificar las emociones y el razonamiento”, esto es, usar las emociones para facilitar el razonamiento y los procesos de pensamiento, y usar nuestro razonamiento para pensar de forma inteligente acerca de nuestras emociones (Mayer y Salovey, 1997). En concreto, la IE se define como una habilidad mental que incluye “la capacidad para percibir, valorar y expresar las emociones con...

  20. Paisajes para un desarrollo sustentable y participativo

    Directory of Open Access Journals (Sweden)

    Rafael Mata Olmo

    2014-11-01

    Para terminar, el texto recoge una experiencia de proyecto territorial de paisaje, la del Plan Insular de Menorca (Islas Baleares, España, aprobado en 2003. Se sintetizan sus determinaciones sobre la protección de determinados terrenos por sus altos valores paisajísticos, sus directrices para que las políticas sectoriales (turismo, agricultura, infraestructuras, etc. incorporen criterios paisajísticos, y sus iniciativas para la gestión y mejora del paisaje y para el fomento del acceso público a su contemplación y disfrute.

  1. Guias ópticos para sensores

    OpenAIRE

    Marcos de Castro Pacitti

    1993-01-01

    Neste trabalho foram estudados guias ópticos para atuarem como sensores ou em sistemas sensores. Ênfase especial foi dada em guias ópticos retangulares, para dispositivos ópticos integrados, e fibras ópticas elípticas. A analise de fibras ópticas elípticas resultou em um modelamento pratico para projeto das mesmas em aplicações onde se deseja operar com dois modos guiados, situação esta que se mostra muito atraente para implementação de diversos tipos de sensores a fibra óptica. A seguir es...

  2. Algoritmos array para filtragem de sistemas lineares

    OpenAIRE

    Gildson Queiroz de Jesus

    2007-01-01

    Esta dissertação desenvolve filtro de informação, algoritmos array para estimador do erro médio mínimo quadrático para sistemas lineares sujeitos a saltos Markovianos e algoritmos array rápidos para filtragem de sistemas singulares convencionais. Exemplos numéricos serão apresentados para mostrarem as vantagens dos algoritmos array deduzidos. Parte dos resultados obtidos nesta pesquisa serão publicados no seguinte artigo: Terra et al. (2007). Terra, M. H., Ishihara, J. Y. and Jesus, G. Q. (20...

  3. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  4. Tipologia para a contabilidade ambiental

    Directory of Open Access Journals (Sweden)

    Nazlhe Faride Chein Schekaiban

    2007-06-01

    Full Text Available Este artigo revê a visão, as propostas e o desenvolvimento da contabilidade ambiental, refletindo sobre suas implicações, com a finalidade de descobrir e encontrar sua importância e situação. Para se chegar a esse resultado foi preciso realizar uma revisão epistemológica moldada e processo reflexivo de sustentabilidade e da aproximação ao usuário, da percepção da realidade contábil no México e da gerência interna das organizações. As conclusões mostram a contabilidade ambiental no México fora da re-alidade operativa do modelo contábil regional, aumentando a importância de se criar uma cultura capaz de examinar o controle da missão deste tipo de contabilidade.

  5. Radionovelas para el cambio social

    OpenAIRE

    2014-01-01

    O artigo relata uma experiência de produção de novelas radiofônicas como estratégia de trabalho comunitário. O autor menciona as balizas teóricas (que combina estudos do campo da comunicação, com teorias da aprendizagem e psicológicas) do método que desenvolve para possibilitar o envolvimento das populações com a resolução de problemas ambientais locais, combinando entretenimento com mobilização social. Também são descritas experiências que foram realizadas em vários países da América do Sul....

  6. para su puesta en marcha

    Directory of Open Access Journals (Sweden)

    Sergio Franco Maass

    2004-01-01

    Full Text Available Los sistemas de información geográfica (SIG tienen una gran aplicación en la gestión municipal; permiten cumplir con dos objetivos fundamentales: el registro de información territorial y el análisis de problemas territoriales específicos. Con el fin de determinar la viabilidad de este tipo de tecnologías en el ámbito municipal, se enfrentó el problema de la localización de instalaciones para la disposición final de residuos sólidos urbanos en el municipio de Toluca, Estado de México. Se identifican ciertos aspectos que limitan la práctica de los SIG: la diversidad entre los municipios, los problemas administrativos, las deficiencias de la información y la carencia de recursos humanos, técnicos y financieros.

  7. Quatro passos para a escrita

    OpenAIRE

    2012-01-01

    Relatório da prática de ensino supervisionada, Ensino de Inglês e Alemão, Universidade de Lisboa, 2012 O presente trabalho teve como objetivo a utilização de uma estratégia, “Quatro Passos para a Escrita”, baseada no livro How to Teach Writing de Jeremy Harmer (2004), que envolve um processo com quatro etapas: planificação, primeira versão, edição e versão final. Esta estratégia foi aplicada a uma turma de sétimo ano, no âmbito de língua estrangeira, na disciplina de Inglês. Durante cinco ...

  8. Entre velos: Maya para contrabajo

    Directory of Open Access Journals (Sweden)

    Rosa María Rodríguez Hernández

    2014-01-01

    Full Text Available Maya para contrabajo se materializa a partir de una imagen de Pepe Romero, cuyo texto interpreta a La decadencia de la mentira de Oscar Wilde. La estructura de Maya es binaria, especular y asimétrica; su poética obedece al juego verdad/mentira que subyace en la obra artística y en la vivencia del artista. Maya trae a la memoria las voces de los Upanishad, Schopenhauer, Shakespeare y Beethoven, influencias éstas en la obra de Wagner y, todas ellas, en la de Eliot. Los aspectos gestuales y visuales de Maya entrelazan con la danza de Pina Bausch y con la retórica (hypotiposis.

  9. Una minga para el posdesarrollo

    Directory of Open Access Journals (Sweden)

    Arturo Escobar

    2011-01-01

    Full Text Available El artículo sintetiza algunas conclusiones a las que han llegado movimientos sociales y académicos en las últimas dos décadas al reflexionar sobre la globalización y sus implicaciones; el modelo dominante, basado en las nociones de "desarrollo" y "modernidad", ha entrado en crisis. Por lo tanto, se hace necesario avanzar en una transición cultural que se pueda comprender como un cambio de época y no sólo como una época de cambios. Para llevar a cabo esta transformación, se deben resolver las con-tradicciones existentes entre el neodesarrollismo y el postdesarrollo, por supuesto, a favor de éste último.

  10. Rational use of energy and cogeneration in Argentina; Uso racional de la energia y la cogeneracion en Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Sosa, M.I. [Universidad Nacional de La Plata (GECCU/UNLP), Buenos Aires (Argentina). Fac. de Ingenieria. Sistemas de Generacion de Energia, Cogeneracion, Ciclos Combinados, Uso Racional de la Energia], E-mail: misosa@ing.unlp.edu.ar

    2009-07-01

    In this paper we discuss the energy situation in Argentina and indicates possibilities for the implementation of cogeneration projects in the industrial sector, which would include energy generated by a centralized system, without additional consumption of primary resources. We discuss the physical potential of cogeneration and regulatory barriers that do not assist in its implementation. Mentioned government measures on rational and efficient use of energy.

  11. Trabalhar para estudar/estudar para trabalhar: realidade e possibilidades

    Directory of Open Access Journals (Sweden)

    Janes Teresinha fraga Siqueira

    2011-01-01

    Full Text Available O trabalho que apresentamos é parte da pesquisa, ainda não concluída, com os estudantes das licenciaturas e da pedagogia da Universidade de Santa Cruz do Sul- UNISC-RS-Brasil. Este está inserido na linha de pesquisa: educação, trabalho e emancipação do mestrado em educação desta Universidade. Queremos compreender, à luz do materialismo histórico e dialético e das categorias da crítica da economia política, os significados atribuídos pelos estudantes universitários ao fenômeno trabalho e estudo. É uma pesquisa preferentemente qualitativa de natureza dialética. Para Marx, a essência da realidade humana reside no trabalho, mas a fonte de toda a riqueza está na natureza. Logo trabalho, natureza e sociedade estão em relação dialética. Trabalho, portanto, é a ideia central articuladora, e natureza e sociedade devem ser estudadas em conexão com o trabalho. Marx trata o trabalho, no modo de produção capitalista, como um impedimento ao desenvolvimento humano. Propõe omesmo como um ato de criação e auto-expressão humana que não deve ter um valor. A compreensão dessa premissa é necessária para que os trabalhadores possam significar e ressignificar o trabalho para além da ideologia dominante. Algumas categorias aparecem como relevantes para a análise: condições de trabalho e de estudo, necessidade de formação, predominância do trabalho sobre o estudo, dificuldade deconciliar tempo de estudo e de trabalho. Na relação com o objeto de estudo, ressaltaremos a crise estrutural do capital, a desregulamentação das leis do trabalho e sua flexibilização e as contradições entre trabalho e estudo bem como quais possibilidades emancipatórias são visualizadas ou sonhadas pelos trabalhadores estudantes.Resume Ce travail constitue une partie de la recherche entreprise avec les étudiants du cours de pédagogie de l´Universidade de Santa Cruz do Sul – UNISC – RS – Brésil. Il est intégré dans le champ de

  12. Recursos para un aprendizaje significativo

    Directory of Open Access Journals (Sweden)

    Juan LARA GUERRERO

    2009-11-01

    Full Text Available RESUMEN: Partimos del supuesto de que una de las cuestiones que más preocupa al profesorado en su práctica educativa radica en que el aprendizaje de sus alumnos sea significativo. Somos conscientes de que, para conseguir este tipo de aprendizaje, es necesario introducir una serie de cambios en la dinámica de la clase. Comenzamos diferenciando el aprendizaje maquinal del significativo. Continuamos aclarando una confusión muy extendida entre muchos educadores, que creen que el aprendizaje por recepción es repetitivo y que el efectuado por descubrimiento es forzosamente significativo. Posteriormente, planteamos una serie de interrogantes para aclarar algunas cuestiones que le pueden ser útiles a los educadores en su práctica cotidiana. Terminamos presentando la estrategia de organización, que cuenta con dos instrumentos, a nuestro juicio muy eficaces, para ayudar a los estudiantes, a aprender de manera significativa: los mapas conceptuales y la técnica heurística V.ABSTRACT: We start from the assumption that one of the questions that most worry the teaching staff in its educational practice consists in that its pupils' learning is significant. We are aware that, to obtain this kind of learning, it is necessary to introduce a series of changes in the classroom dynamics. We begin by making a distinction between mechanical and significant learning. We continué making clear a very extended confusión amongst many teachers, who believe that learning by reception is repetitive and that the one done by serendipity is necessarily significant. Afterwards, we créate a series of questions to clarify with some answers that can be useful to teachers in their everyday practice. We finish showing the organization strategy, which has two instruments, that in our opinión are very effective, to help students learning in a significant way: conceptual maps and the V heuristic technique.RÉSUMÉ: Nous partons de la supposition de qu'une des questions que

  13. El Ensayo, Para Formar Profesionales Reflexivos

    Directory of Open Access Journals (Sweden)

    Nestor Perico-Granados

    2015-07-01

    Full Text Available El presente artículo es producto de investigación, como resultado de la reflexión hecha a lo largo de muchos años de experiencia profesional y docente en diferentes universidades estudiando, redactando y evaluando ensayos. Presenta la importancia del ensayo como instrumento y dispositivo de la formación en la educación y especialmente se hace hincapié en la incidencia que tiene cuando se trabaja de manera apropiada, para prestar un servicio en la formación reflexiva. Se dan unas pautas para una aproximación a su definición y precisa los elementos fundamentales y otros complementarios para su elaboración. Desarrolla un primer proceso para escribir un ensayo, a través de la jerarquización de las ideas. Finalmente, se proponen unas conclusiones que pueden ser útiles para quienes quieran escribir ensayos.

  14. Una red para la gente

    Directory of Open Access Journals (Sweden)

    Raúl Trejo Delarbre

    2004-02-01

    Full Text Available La próxima Cumbre Mundial de la Sociedad de la Información ha revitalizado, en numerosos países, el debate acerca de las nuevas tecnologías de la comunicación y los usos que pueden tener. Lamentablemente en México hemos estado casi del todo ajenos a esa intensa, extensa y en otras latitudes fructífera discusión. Ni los especialistas interesados en estos temas, ni la sociedad que es a la postre beneficiaria o damnificada según sea el empleo de tales tecnologías, ni los organismos del Estado a cargo de tales asuntos, han propiciado la reflexión colectiva que nos podría permitir tanto afinar las posiciones de nuestro país rumbo a la cumbre de Ginebra y Túnez como deliberar, en ese contexto, acerca de lo mucho que nos falta para tener un país auténticamente imbricado en la construcción de una auténtica Sociedad de la Información.

  15. Residencia para familias - Anglet (Francia

    Directory of Open Access Journals (Sweden)

    Hébrard, J. R.

    1971-11-01

    Full Text Available This residential hotel has 806 beds, which can be increased to 1,100 by adding some double beds. Its size and colour blends well with the picturesque surrounding, known as «Chambre d'Amour». The hotel involves 120 large apartments, and 50 smaller one, as well as 25 rooms for the staff, and flats for the manager and other senior officials. There is a hall, large living room, bar, rooms for playing games, nursery, and an additional hostel with 40 flats and staff rooms. The design is of a linear, continuous style, emphasizing its horizontal extension, though contrast is provided by a higher block, housing the vertical circulation facilities.Con un total de 806 plazas hoteleras, ampliables a 1.100 (si se utilizan literas, este conjunto, por su volumen y color se integra en el pintoresco paisaje del paraje conocido por «Chambre d'Amour». Comprende: 120 apartamentos; 50 más pequeños; 25 habitaciones para empleados; los apartamentos del director, gobernanta y recepcionistas; las zonas de vida en común: hall, salón, bar, sala de juegos y guardería; un albergue con 40 apartamentos; y las dependencias de la administración. Presenta un volumen lineal y continuo, modelando una composición de ritmo horizontal predominante, a la que le imprime gran variedad el cuerpo vertical de hormigón visto que contiene las circulaciones verticales.

  16. Viviendas para ancianos en Londres

    Directory of Open Access Journals (Sweden)

    Moffet, N.

    1969-09-01

    Full Text Available This group of buildings to house aged persons has been designed on the basis of a primary or hexagon shaped module. The Initial research on the best possible orientation, interior fittings, furnishings, etc., has been of great help in making it possible for the inmates of this home to enjoy the maximum possible comfort, such as they might have in their own homes, and make them forget that they occupy a communal building.Partiendo como «forma modular primaria» del hexágono, ha sido diseñado este conjunto de viviendas destinadas a alojamiento permanente para personas mayores. Los estudios realizados sobre su orientación óptima, acondicionamiento y amueblamiento interior, etc., han influido notablemente a que sus usuarios, además de disfrutar del máximo confort, experimenten la sensación de que viven en su propio hogar y no en celdas de un bloque monótono de tipo cajón.

  17. pipetas usadas para I. A.

    Directory of Open Access Journals (Sweden)

    J. Castañeda

    2004-01-01

    Full Text Available La vagina y cerviz de las cerdas son estimuladas físicamente durante la inseminación. Este contacto puede afectar características reproductivas tales como el transporte espermático y el proceso de ovulación. En el presente trabajo se evaluaron desde el punto de vista económico y reproductivo, tres tipos de pipetas utilizadas para I. A. de cerdas de diferente material y forma. Se utilizaron 120 animales multíparos asignados de acuerdo a su orden de entrada al celo, en forma sucesiva a uno de tres grupos experimentales: 1 I. A. mediante pipeta reusable de hule tipo Melrose ( Medata, 2 I. A. con pipeta desechable de punta plástica en espiral y 3 I. A. con pipeta desechable con punta de poliestireno redonda (Medi chimica. No se encontró diferencia (P>0.05 entre los porcentajes de gestación, parición y promedio de lechones nacidos vivos por parto, en el tiempo de aplicación del semen, ni en el volumen del mismo, arrojado por las cerdas en los 10 min. posteriores a la I. A. Los valores promedio fueron de: 91.7%, 86.7%, 10.4 ± 2.8, 7.8 ± 2.6 min. y 10.4 ± 11.3 ml, respectivamente. El análisis de regresión, no mostró significancia en cuanto a paridad en ninguna de las variables estudiadas (P>0.05. Se concluye que las pipetas evaluadas no difieren en su efecto sobre el desarrollo reproductivo de la piara. Sin embargo, la pipeta reusable tipo Melrose ofrece ventaja económica bajo las condiciones del presente estudio

  18. Educación para la lactancia

    OpenAIRE

    Azanza Neri, Itziar

    2014-01-01

    Este proyecto desarrolla los principales aspectos de la lactancia materna y artificial. Puesto que este periodo de la vida es de gran importancia para los recién nacidos, ya que sientan las bases para su correcto desarrollo y crecimiento. Este trabajo propone la creación de un plan de educación sobre la lactancia, con el objetivo de capacitar a las mujeres en la adecuada alimentación de sus hijos durante sus primeros meses de vida. Así como para la toma de una decisión, libremente escogid...

  19. Diretrizes para o desenvolvimento de Ecovilas Urbanas

    OpenAIRE

    Flávio Januário José

    2014-01-01

    A pesquisa organizada em quatro partes a partir do sistema de planejamento denominado Dragon Dreaming teve como objetivo a elaboração de um modelo de diretrizes para o desenvolvimento de ecovilas urbanas que possam ser utilizadas como opção para a transformação de bairros existentes ou a criação de novos assentamentos urbanos sustentáveis. Para isso foram abordados aspectos teóricos, visitas técnicas e participação em eventos sobre o tema que, a partir de métodos colaborativos, fundamentaram ...

  20. Elementos vegetales: proyectar para la incertidumbre

    OpenAIRE

    2011-01-01

    Es cierto que la incertidumbre nos atenaza a la hora de proyectar. Y esa inquietud se agranda cuando la materia viva se nos ofrece generosa y múltiple para ser empleada. Por ello son tan pocos los profesionales que han podido emplear mucho tiempo y sentido común para conocer la amplitud de los aspectos a tener en cuenta y la modestia para estar siempre observando y aprendiendo de la naturaleza. A Leandro Silva (1930 Salto, Uruguay - 2000 Segovia, España) se le puede imaginar como un pionero d...

  1. Indicadores de risco para o parto prematuro

    OpenAIRE

    Bittar,Roberto Eduardo; Zugaib, Marcelo

    2009-01-01

    Entre os vários fatores clínicos para o parto prematuro, alguns apresentam riscos substanciais, tais como história de parto prematuro, gemelidade e sangramento vaginal do segundo trimestre. No entanto, tais fatores estão presentes na minoria das mulheres que evoluem para o parto prematuro e, portanto, possuem baixa sensibilidade. A dilatação, o esvaecimento e a posição do colo uterino diagnosticados pelo toque vaginal têm sido relacionados ao aumento do risco para o parto prematuro, mas possu...

  2. Los videojuegos: conectar alumnos para aprender

    OpenAIRE

    José Antonio Valderrama Ramos

    2012-01-01

    Este artículo explora la utilidad que presentan los videojuegos comerciales actuales para educar a los jugadores y ayudarlos a adquirir habilidades necesarias para desempeñarse mejor en nuestra sociedad. Aborda el problema de la educación formal, la cual no está respondiendo a la situación de complejidad de nuestro entorno y usa el paradigma del pensamiento complejo y siete saberes para la educación propuestas por Edgar Morin. También, describe algunas ideas que le pueden ser de utilidad a do...

  3. Estereoscopio com tela holografica para ver tomografias

    CERN Document Server

    Lunazzi, J J; Magalhaes, D S F

    2010-01-01

    A estereoscopia eh uma tecnica que permite a observacao de imagens tridimensionais, mas estah sempre associada com o uso de algum equipamento especial para visualizacao, como oculos bicolores ou polarizados. Para o uso em aplicacoes medicas o emprego de tais equipamentos pode inviabilizar sua utilizacao durante procedimentos cirurgicos, por exemplo. Neste trabalho apresentamos um novo tipo de estereoscopio que utiliza uma tela holografica para geracao de imagens tridimensionais sem o uso de qualquer equipamento adicional. Apresentamos a descricao do equipamento utilizado e resultados das imagens visualizadas.

  4. Hypersurfaces with Isotropic Para-Blaschke Tensor

    Institute of Scientific and Technical Information of China (English)

    Jian Bo FANG; Kun ZHANG

    2014-01-01

    Let Mn be an n-dimensional submanifold without umbilical points in the (n+1)-dimen-sional unit sphere Sn+1. Four basic invariants of Mn under the Moebius transformation group of Sn+1 are a1-form Φ called moebius form, a symmetric (0, 2) tensor A called Blaschke tensor, a symmetric (0, 2) tensor B called Moebius second fundamental form and a positive definite (0, 2) tensor g called Moebius metric. A symmetric (0, 2) tensor D = A+μB called para-Blaschke tensor, where μ is constant, is also an Moebius invariant. We call the para-Blaschke tensor is isotropic if there exists a function λ such that D = λg. One of the basic questions in Moebius geometry is to classify the hypersurfaces with isotropic para-Blaschke tensor. When λ is not constant, all hypersurfaces with isotropic para-Blaschke tensor are explicitly expressed in this paper.

  5. Actitud Positiva: la base para la competitividad

    Directory of Open Access Journals (Sweden)

    Marco Anderson Espinoza

    2008-04-01

    Full Text Available Una estrategia empresarial enfocado en el mejoramiento continuo de la productividad para la competitividad, depende significativamente del manejo inteligente de tres variables visibles:Calidad, Entrega oportuna y Costo. No obstante, estas tres variables no suelen sersuficientes. La estrategia debe ser complementada con el manejo adecuado de variables intangibles como la Motivación y las Condiciones de Trabajo, con la aplicación de Tecnología Ambientalmente Amigable, en un marco de Actitud Positiva.A final de cuentas, la Actitud Positiva es fundamental para el recurso humano de cualquier organización, a fin de construir una plataforma sólida y estable que sirva de base para soportar un proceso sostenible de mejoramiento de la productividad, para aumentar la competitividad como estrategia empresarial exitosa.

  6. Neurocisticercosis: Afiches para Capacitación

    Directory of Open Access Journals (Sweden)

    MARCELO ROJAS C

    2007-02-01

    Full Text Available En el sistema universitario (me atrevo a decir, de todo el mundo, es poco el contenido educativo relativo a la Transferencia tecnológica para efectos de la capacitación de la sociedad sobre problemas de salud (claros ejemplos desafiantes para los veterinarios son la hidatidosis y cisticercosis y otros; manejados en términos de cambios de conducta. Los términos de control y prevención están dados en un lenguaje académico, muy abstracto y obviamente intrascedente en la comunidad. Al punto que que las recomendaciones que manejan los Profesionales, resultan imprácticos en el ámbito social. Cada vez que voy a Provincias (interior del país y tengo la oportunidad de hablar sobre el control de las citadas metocestodiadis: mis auditorios quedan impactado y entendiendo la gravedad del Problema, y la tarea para solucionarlo. Los Técnicos Agropecuarios, los de las ONGs, los mismos Profesionales del Ministerio de Agricultura (SENASA, quedan impresionados del mensaje y contenido de los Afiches. Muchísimas veces me las han pedido (los afiches, pero les ofrecí publicarlos; porque considero que tiene gran creatividad y propiedad intelectual. He visto muchísimas imágenes de Capacitación; que en lugar de simplificar el mensaje, los complican. Es pues, una herramienta de trabajo para los capacitadores, para Veterinarios jóvenes e inexpertos, para la gente que está en contacto directo con el problema (pobladores; pero también lo será para tantos nuevos Profesores universitarios, sin experiencia de campo. Puede que impresione negativamente el lenguaje de los afiches; pero casualmente está hecho en el lenguaje popular que conoce la comunidad rural. La publicación persigue entregar a usarios capacitadores de una herramienta para publicitarlos masivamente.

  7. Un almuerzo para llevar saludable (Packing Smart)

    Centers for Disease Control (CDC) Podcasts

    2011-08-22

    En este podcast para niños, los chicos de Kidtastics hablan sobre almuerzos creativos para llevarse a la escuela, que ayuden a mantenerse con energía el resto del día.  Created: 8/22/2011 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 1/3/2012.

  8. Matemática para la familia

    OpenAIRE

    1994-01-01

    Para muchos profesores de matemáticas ha sido de primordial interés encontrar estrategias didácticas apropiadas para orientar el aprendizaje de las matemáticas escolares de los niños (as) y jóvenes de manera que las clases se conviertan en encuentros agradables y la relación matemática-aprendizaje- profesor sea la mejor.

  9. Elementos para uma psicologia do sujeito cativo

    OpenAIRE

    Ramos Conrado

    1999-01-01

    Este artigo reflete sobre a autodestruição do esclarecimento e as relações entre sociologia e psicologia a partir da teoria crítica. Aponta a necessidade do estudo da sociedade para a compreensão do indivíduo contemporâneo. Defende também a importância da investigação da subjetividade para a crítica das mediações sociais.

  10. Learning Parallel Computations with ParaLab

    OpenAIRE

    Kozinov, E.; Shtanyuk, A.

    2015-01-01

    In this paper, we present the ParaLab teachware system, which can be used for learning the parallel computation methods. ParaLab provides the tools for simulating the multiprocessor computational systems with various network topologies, for carrying out the computational experiments in the simulation mode, and for evaluating the efficiency of the parallel computation methods. The visual presentation of the parallel computations taking place in the computational experiments is the key feature ...

  11. Conceptos para pensar lo urbano

    Directory of Open Access Journals (Sweden)

    Marta Rizo

    2006-03-01

    Full Text Available Identidad, habitus y representaciones sociales son tres conceptos de procedencia disciplinar distinta: los dos primeros han sido abordados por la sociología, mientras que el tercero es de corte psico-social. El presente artículo explora las posibilidades de diálogo conceptual que existen entre los tres términos, y concretamente, sus posibles aportaciones al abordaje de la ciudad y lo urbano. El texto se estructura en tres grandes partes: en la primera se presenta una revisión de cada uno de los tres conceptos eje de la reflexión; en la segunda se establecen los vínculos conceptuales posibles entre ellos; y en la tercera, más que presentar conclusiones cerradas, se sugieren algunas líneas de reflexión teórica para penar la relación entre identidad, representaciones sociales y habitus en el contexto específico de las ciudades. Se señalan asimismo algunas líneas de investigación posibles, y finalmente, se exploran algunas reflexiones ya realizadas desde la sociología, la psicología social y la ciencia de la comunicación. --- Identity, habitus and social representations are concepts that a have different disciplinary origin: the first and the second one have been covered by sociology, while the third one has a psycho-social feature. This article explores the possibilities of conceptual dialogue among these three terms, and in particular, their possible contributions to approaching both the city and the urban. The text is organized in three main parts. In the first one, a review of each one of these concepts is presented. In the second one, possible conceptual links among them are established. In the third one, and more than presenting closed conclusions, some theoretical reflection lines are suggested, aimed to think the relation among identity, social representations and habitus , in the specific context of the cities. At the same time, some possible research lines are indicated, and reflections already carried out by sociology

  12. UM TRATADO PARA O AMOR

    Directory of Open Access Journals (Sweden)

    Maria José Caldeira do Amaral

    2015-07-01

    Full Text Available No Tratado do Amor Cortês - Tractatus de Amore - André Capelão deseja oferecer ao leitor a arte cortês de amar, a beleza do desejo erótico e a disciplina da paixão constitutiva dessa arte que é amar. O maior argumento dessa obra é efetivar o suspiro fundo que a dimensão amorosa infunde na alma do homem e da mulher aos quais foi concedida a virtude. Para esse autor, escriba da chancelaria real e talvez, não se sabe com certeza, um Ordo Sacratus, o amor é a raiz de toda cortesia, a fonte de todo bem. Nosso objetivo, então, é encontrar nessa suma amorosa construída nos enlaces da Literatura de Cavalaria Medieval, os desdobramentos essenciais dessa vida afetiva bela e virtuosa no enredo profundo do qual emerge o afeto, a fé e a contradição da experiência humana do sofrimento amoroso. Palavras Chave: Literatura Medieval. Amor Cortês, André Capelão, virtude, desejo. Abstract: With the treaty toward the love - Tractatus de Amore – André Capelão offers to the reader the courteous’ art for love, the erotic desire’s beauty and the  suffering discipline belong this love’s art  is. The best reason of this literary composition is to achieve the depth sigh that the loving dimension infuses into the lovers’s soul, the man and the woman wich this virtue was conceded. For this author, the royal chancery scribe and perhaps, no one knows for sure, a Sacratus Ordo, love is the root of all free, the source of all good. Our goal, then, is to find this sum loving built in interlacing of Medieval Knights literature, the essential developments of this beautiful and virtuous love life in the deep storyline which emerges affection, faith and the contradiction of the human experience of love suffering. Key words: Medieval Literature. Courteous Love. André Capelão. Virtue.

  13. Estrategia para elevar la motivación laboral; factor imprescindible para mejorar nuestra productividad.

    OpenAIRE

    Reina de los Ángeles Carballé Piñón

    2015-01-01

    Este trabajo "Estrategia para elevar la motivación laboral; factor imprescindible para mejorar nuestra productividad" resulta de la investigación realizada para tesis de maestría; se realizó el estudio de 2 entidades, nos permitió conocer las principales posiciones que sobre motivación existen, factores que la influencian, cómo incide en el desempeño laboral y que acciones diseñar para elevarla. Las 2 entidades seleccionadas, claves en el desempeño empresarial son un centro de interfase y un...

  14. Arrendamiento y préstamo para equipo: Guía para el microfinanciamiento

    OpenAIRE

    Glenn D. Westley

    2003-01-01

    En este trabajo se describe la manera de otorgar financiamiento para equipo --arrendamiento y préstamo-- para los microempresarios objeto del estudio, es decir, los que necesitan aproximadamente entre 50 y 2.500 dólares para adquirir equipo. El trabajo examina los pro y los contra de las dos principales alternativas de financiamiento: préstamos y arrendamientos. También proporciona una serie de recomendaciones en cuanto a las mejores prácticas para que las instituciones microfinancieras (IMF)...

  15. PLAN DE EMPRESA PARA UN RESTAURANTE DE COMIDA PARA LLEVAR EN EL MUNICIPIO DE NULES

    OpenAIRE

    VEDRI PEIRATS, MARTA

    2014-01-01

    El objeto del presente proyecto es la realización de un plan de empresa para un establecimiento de comidas para llevar, y estimar la viabilidad del proyecto. A pesar de que el panorama económico que sufre este país no es muy alentador, se pretende averiguar si puede ser rentable la apertura de un negocio de este tipo, con las condiciones de las que disponemos. Vedri Peirats, M. (2014). PLAN DE EMPRESA PARA UN RESTAURANTE DE COMIDA PARA LLEVAR EN EL MUNICIPIO DE NULES. http://hdl.handle.net...

  16. Alimentos balanceados para perros en Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth Vargas

    2001-01-01

    Full Text Available Diagnóstico de la comercialización de alimentos balanceados para perros en Costa Rica. Para ampliar los reportes oficiales de la comercialización de alimentos para perros se creó una base de datos que incluyó cantidad, costo, empaque y formulación durante el período 1998 a agosto del 2000. De 1995 a 1998 y de 1996 a 1999 la producción nacional incrementó un 90,4% y la importación un 42,56% respectivamente, ocupando los alimentos nacionales un 72% del tonelaje y un 70% del valor en dólares americanos. No fue posible determinar cuál es el empaque más comercializado, pero si que los alimentos extrusados son los que ocupan el primer lugar y que los alimentos recomendados para cachorros y adultos son los que más se comercializan. La ausencia de datos en las declaraciones sugiere la necesidad de incrementar el control en las mismas en caso de requerirse un estudio de mercado, ya que contrariamente a esta situación el mayor número de garantías inscritas corresponden separadamente para las fases de cachorros y adultos. Merece también atención que las garantías indican mayores porcentajes de proteína cruda que los recomendados por la AAFCO y que al menos 36 fórmulas son recomendadas para estados sanitarios específicos (p.e. para perros con problemas de alergias, cálculos renales, pérdidas de pelo, etc. sin que oficialmente se encuentre registrada ninguna fórmula medicada

  17. ¿Qué literatura para jóvenes?

    OpenAIRE

    Mira, António Ricardo

    2007-01-01

    En el artículo se presentan algunos indicadores disponibles para la selección de literatura para jóvenes, se indican algunos aspectos a tener en cuenta en la elección de literatura para ellos y se presenta un criterio de elección acertada de literatura para ese grupo de edades.

  18. Para-product operators and para-linearization on locally compact Vilenkin groups

    Institute of Scientific and Technical Information of China (English)

    苏维宜

    1995-01-01

    The concept of para-product operators over locally compact Vilenkin groups is established and the applications to the para-linearization in nonlinear problems are studied. This kind of operators plays a special role in dealing with those functions which do not have the classical derivatives.

  19. The ParaScope parallel programming environment

    Science.gov (United States)

    Cooper, Keith D.; Hall, Mary W.; Hood, Robert T.; Kennedy, Ken; Mckinley, Kathryn S.; Mellor-Crummey, John M.; Torczon, Linda; Warren, Scott K.

    1993-01-01

    The ParaScope parallel programming environment, developed to support scientific programming of shared-memory multiprocessors, includes a collection of tools that use global program analysis to help users develop and debug parallel programs. This paper focuses on ParaScope's compilation system, its parallel program editor, and its parallel debugging system. The compilation system extends the traditional single-procedure compiler by providing a mechanism for managing the compilation of complete programs. Thus, ParaScope can support both traditional single-procedure optimization and optimization across procedure boundaries. The ParaScope editor brings both compiler analysis and user expertise to bear on program parallelization. It assists the knowledgeable user by displaying and managing analysis and by providing a variety of interactive program transformations that are effective in exposing parallelism. The debugging system detects and reports timing-dependent errors, called data races, in execution of parallel programs. The system combines static analysis, program instrumentation, and run-time reporting to provide a mechanical system for isolating errors in parallel program executions. Finally, we describe a new project to extend ParaScope to support programming in FORTRAN D, a machine-independent parallel programming language intended for use with both distributed-memory and shared-memory parallel computers.

  20. La importancia de FOCALAE para Colombia

    Directory of Open Access Journals (Sweden)

    Pío García

    2011-11-01

    Full Text Available Las asociaciones regionales están condicionadas por la dinámica del poder global; no obstante, desempeñan un papel decisivo para afrontar el reto de establecer un orden mundial convenido y equitativo. El mecanismo idóneo de la relación transpacífica latinoamericana es FOCALAE, un foro de cooperación múltiple extendida al ámbito económico, social, cultural, educativo y deportivo. Los resultados de su primera década de existencia fueron magros, en razón, entre otros motivos, de la ausencia de proyectos atractivos para los países asiáticos y para América Latina, y de la fractura ideológica profunda que ha soportado esta última. Con el potencial inocultable para contribuir al bienestar de Asia Pacífico y de Latinoamérica por medio del intercambio extenso, el Foro tendrá que esperar tiempos más favorables para su despliegue, cuando ciertos liderazgos regionales, en los que el colombiano ha de estar presente, vuelvan a impulsar la concertación latinoamericana.

  1. Modelo para el análisis de una aptitud cognitiva para el aprendizaje

    Directory of Open Access Journals (Sweden)

    Clara Cecilia Uribe Hernández

    2009-01-01

    Full Text Available La investigación en el campo de las aptitudes cognitivas para el aprendizaje requiere una forma de abordarlas y definir sus características y componentes. A su vez, esta definición debe conducir al investigador a la creación de pruebas de medición que ayuden al análisis de este tipo de aptitudes y su relación con otras variables del aprendizaje. Para dar respuesta a esas necesidades, el objetivo de este artículo es proponer la creación de un modelo para el análisis de una aptitud cognitiva para el aprendizaje, cuya estructura conste de cuatro elementos principales. Dos de ellos relacionados con los enfoques y consideraciones para emprender su estudio; los otros dos, con la definición de la aptitud, a través de sus características y sus componentes.

  2. Los videojuegos: conectar alumnos para aprender

    Directory of Open Access Journals (Sweden)

    José Antonio Valderrama Ramos

    2012-01-01

    Full Text Available Este artículo explora la utilidad que presentan los videojuegos comerciales actuales para educar a los jugadores y ayudarlos a adquirir habilidades necesarias para desempeñarse mejor en nuestra sociedad. Aborda el problema de la educación formal, la cual no está respondiendo a la situación de complejidad de nuestro entorno y usa el paradigma del pensamiento complejo y siete saberes para la educación propuestas por Edgar Morin. También, describe algunas ideas que le pueden ser de utilidad a docentes interesados en usar videojuegos como herramientas pedagógicas en el salón de clases.

  3. Temas para la asistencia al adulto mayor

    OpenAIRE

    Romero Cabrera, Ángel Julio

    2008-01-01

    El reto del envejecimiento demográfico y los complejos y peculiares problemas clínicos de los adultos mayores justifican la formación y capacitación de los profesionales para la asistencia médica a estas personas. El resultado consiste en un libro con información sistematizada sobre temas básicos para ofrecer una adecuada atención clínica a los ancianos, conjugando los elementos del método clínico con los de la evaluación geriátrica, a lo que se añade un instrumento evaluativo para retroalime...

  4. Rutina AUTOLISP para el despiece de columnas

    Directory of Open Access Journals (Sweden)

    Lorena Cocunubo Carreño

    2014-06-01

    Full Text Available El proyecto de creación de una herramienta Autolisp para el dibujo automático de los despieces de vigas sometidas a flexión y a cortante se desarrolla en un ambiente de programación informática LISP. Se inicia con la programación en el Visual Lisp de AutoCAD del algoritmo que permite tomar información de anchos de luz, sección transversal y momentos resistentes la viga para que automáticamente ejecute los comandos y el resultado final sea un despiece detallado de los hierros por flexión junto con los estribos por cortante separados adecuadamente. Los resultados están sujetos a criterios de diseños de la NSR-10 para así garantizar la seguridad del diseño sísmico.

  5. Oxitocina: nuevas perspectivas para una droga antigua

    Directory of Open Access Journals (Sweden)

    Steven L. CLARK

    2010-12-01

    Full Text Available La oxitocina es el medicamento más comúnmente asociada con la prevención de complicaciones perinatales y recientemente fue incluida por el Instituto para la Administración Medicamentosa Segura (Institute for Safe Medication Practices - ISMP en una pequeña lista de medicamentos “con alto grado de riesgos”, lo que puede “necesitar salvaguardas especiales para reducir el riesgo de error”. Las recomendaciones actuales para administrar este medicamento son vagas en relación a la indicación, tiempo de uso, dosis y el monitoreo de los efectos maternos y fetales. Una revisión de los datos clínicos y farmacológicos disponibles sugiere que las orientaciones específicas y basadas en evidencias para administrar oxitocina durante el parto puede derivarse de datos disponibles. Si implementadas, estas prácticas pueden reducir la probabilidad de daños al paciente. Esto sugiere el foco de las orientaciones para la administración electiva limitada de oxitocina, considerar estrategias que disminuyan la necesidad de usar oxitocina, confiar en terapéuticas de bajas dosis de oxitocina, la adhesión a definiciones semicuantitativas específicas sobre parto adecuado e inadecuado, y la aceptación de que, una vez que la actividad uterina adecuada sea alcanzada, es generalmente preferible esperar más tiempo que aumentar la infusión de oxitocina. El uso de protocolos conservadores y específicos para monitorear los efectos de la oxitocina en la madre y en el bebé tiende no sólo a aumentar los resultados, mas también a reducir los conflictos entre miembros del equipo obstétrico. Implementar estas orientaciones parece ser apropiada en una cultura cada vez más focalizada en la seguridad del paciente.

  6. Estrategias de mercado para el frijol centroamericano

    Directory of Open Access Journals (Sweden)

    Lourdes Mart\\u00EDnez

    2004-01-01

    Full Text Available Estrategias de mercado para el frijol centroamericano. En los últimos años, el sub-sector de frijol en Centro América ha sido testigo de varios cambios dinámicos. Si no se encuentran medidas para incrementar la competitividad regional de este sub-sector, los países centroamericanos experimentarán impactos negativos en las áreas sociales y económicas de considerable magnitud, especialmente ahora que Centro América necesita ajustar su economía a los nuevos requerimientos de mercados mas abiertos, como el Tratado Centroamericano de Libre Comercio con USA (TLC. Vendedores de frijoles a nivel intermediario y de consumo final, así como técnicos de oficinas gubernamentales dedicadas al mercadeo de frijoles en Centro América fueron entrevistados para documentar los cambios experimentados, identificar los obstáculos que frenan la viabilidad del sub-sector e identificar las oportunidades de incremento de mercados en el futuro para los productores y vendedores de frijol. Los resultados muestran que para que continúen siendo competitivos, los países centroamericanos deben incrementar la productividad a través del apoyo a las investigaciones para el mejoramiento de variedades de frijol, especialmente aquellas que los consumidores prefieren por características específicas (e.g. color. También es imprescindible el fortalecimiento de los programas de distribución de variedades mejoradas a los productores; las mejoras en la transmisión de información de mercado a los productores; el fortalecimiento de los contactos entre productores, comercializadores a nivel mayorista y supermercados; y una política más específica de apertura de mercados de exportación, especialmente con los Estados Unidos.

  7. Medidas de Seguridad para Incapaces de Culpabilidad

    OpenAIRE

    Saltos Duran, María Patricia

    2013-01-01

    La tesina realizada con el tema “Medidas de seguridad para incapaces de culpabilidad” dentro del derecho penal es uno de los aspectos más controvertidos. Para comprenderlo, se definió y se caracterizó qué son las medidas de seguridad, hacia quiénes van dirigidas y cuál es su fundamento filosófico, político y social. En la situación procesal en la cual, el individuo es puesto por primera vez a disposición del Juez, cuando un inimputable haya realizado un hecho tipificado como delito y demuestr...

  8. Un modelo setar para el pib colombiano

    OpenAIRE

    Vivas Lorena; Ramos Johanna; Hoyos Milena

    2009-01-01

    En este artículo se estudia el comportamiento de la tasa de crecimiento del PIB colombiano durante el período 1982-2008 a partir de un modelo SETAR (Self-Exciting Threshold Autoregressive), con base en la metodología propuesta por Tsay (1989) y Tong (1990) para la detección de no linealidades relacionadas con la existencia de regímenes cambiantes. Adicionalmente, se evalúa el desempeño de los pronósticos generados en relación a los obtenidos con un modelo autorregresivos lineal para diferente...

  9. Un cuaderno virtual para Ciencias Sociales

    OpenAIRE

    Montolío Tena, Mari Carmen

    2010-01-01

    Esta experiencia se basa en la utilización de blogs para la mejora del proceso de enseñanza-aprendizaje en el ámbito de la Educación Secundaria y el desarrollo constructivista de conocimiento haciendo al alumno responsable de su propio aprendizaje dentro del marco establecido por las nuevas directrices del Programa Escuela 2.0. Esta herramienta oferta posibilidades innovadoras para la gestión efectiva del conocimiento. Un grupo de alumnos de 1º de ESO trabajan parte de la asignatura de Cienci...

  10. Vivienda sostenible para un consumo casi nulo

    OpenAIRE

    MENDOZA GÓMEZ, CLAUDIA MARÍA

    2014-01-01

    Este TFG pretende aplicar los conceptos de eficiencia energética y sostenibilidad en la edificación para conseguir una vivienda con un consumo casi nulo. Para ello, es necesario reducir la demanda y los consumos así como las emisiones de CO2, contribuyendo de esa forma a cuidar el medio ambiente, a reducir los gases de efecto invernadero y la huella de carbono de la vivienda. El propósito es conseguir una vivienda sostenible que aproveche todo el potencial de las energías renovables y, ello i...

  11. Interfaces para dispositivos móveis

    OpenAIRE

    Santos, Jefferson dos

    2013-01-01

    Os dispositivos móveis tem se afirmado nos últimos anos como acessórios indispensáveis para o homem contemporâneo. Insinuando-se como omnipresentes e vendendo-se como onipotentes, eles constituem uma parcela significativa do mercado eletrônico e computacional. Prometendo substituir a médio e longo prazo os computadores pessoais, os dispositivos móveis são investidos de cada vez mais funcionalidades que os transformam, às vezes, em equipamentos altamente sofisticados e para o...

  12. Infraestructura para laboratorios de acceso remoto

    OpenAIRE

    2009-01-01

    Las tecnologías de Internet permiten el uso de sistemas de software distribuido para el acceso en forma remota a laboratorios físicos y virtuales, para llevar a cabo actividades de investigación experimental a distancia. A partir de los marcos teóricos que definen los estructurantes de los laboratorios, los implementadores de laboratorios de acceso remoto deben diseñar y desarrollar arquitecturas de servicios que permitan un acceso flexible y controlado. Este trabajo define una infraestructur...

  13. Propuestas para combatir la contabilidad creativa

    OpenAIRE

    Oriol Amat Salas; Ester Oliveras

    2004-01-01

    Los escándalos contables han reavivado el interés en combatir la contabilidad creativa. Este artículo analiza la naturaleza de esta problemática y los aspectos de la normativa que la afectan. Incluye el ejemplo de una empresa real para visualizar los efectos que los maquillajes contables, amparados en la normativa contable española y en las Normas Internacionales de Contabilidad, pueden provocar en el resultado. Al final, se proponen medidas para mejorar la credibil...

  14. Valores de referência para carboxiemoglobina

    Directory of Open Access Journals (Sweden)

    Siqueira Maria Elisa P. B. de

    1997-01-01

    Full Text Available INTRODUÇÃO: Os valores de referência de indicadores biológicos são utilizados como parâmetros para interpretação de resultados de valores obtidos em indivíduos expostos ocupacionalmente aos agentes químicos. O Grupo Brasileiro para Estabelecimento dos Valores de Referência tem se dedicado a estas determinações objetivando estabelecer valores de referência para os diferentes bioindicadores em diversas regiões do País. Determinaram-se os valores de referência para a carboxiemoglobina (COHb no Sul de Minas Gerais. MATERIAL E MÉTODO: A COHb foi analisada pelo método espectrofométrico, otimizado no laboratório de análises toxicológicas. Em todas as amostras também foram realizadas análises de alguns parâmetros bioquímicos e hematológicos para atestar o estado de saúde da população, constituída de 200 voluntários não-fumantes e não-expostos, por motivo profissional, ao monóxido de carbono. Cada indivíduo respondeu um questionário para levantamento de dados relevantes à interpretação dos resultados. Os valores de referência foram expressos em termos da média ± desvio-padrão, intervalo de confiança 95% e valor de referência superior. A distribuição estatística dos resultados obtidos foi realizada para possibilitar sua comparação com grupos de trabalhadores, preferentemente à avaliação individual. RESULTADOS E CONCLUSÕES: O valor médio ± desvio-padrão para a carboxiemoglobina foi de 1,0 % ± 0,75; o intervalo de confiança 95%, entre 0,9 e 1,1 % e o valor de referência superior, de 2,5%. Através do teste t de Student (p < 0,05 não foi detectada diferença nos valores de acordo com o sexo, idade ou uso de bebidas alcoólicas. Os valores de referência encontrados foram similares aos reportados em outros países.

  15. Valores de referência para carboxiemoglobina

    Directory of Open Access Journals (Sweden)

    Maria Elisa P. B. de Siqueira

    1997-12-01

    Full Text Available INTRODUÇÃO: Os valores de referência de indicadores biológicos são utilizados como parâmetros para interpretação de resultados de valores obtidos em indivíduos expostos ocupacionalmente aos agentes químicos. O Grupo Brasileiro para Estabelecimento dos Valores de Referência tem se dedicado a estas determinações objetivando estabelecer valores de referência para os diferentes bioindicadores em diversas regiões do País. Determinaram-se os valores de referência para a carboxiemoglobina (COHb no Sul de Minas Gerais. MATERIAL E MÉTODO: A COHb foi analisada pelo método espectrofométrico, otimizado no laboratório de análises toxicológicas. Em todas as amostras também foram realizadas análises de alguns parâmetros bioquímicos e hematológicos para atestar o estado de saúde da população, constituída de 200 voluntários não-fumantes e não-expostos, por motivo profissional, ao monóxido de carbono. Cada indivíduo respondeu um questionário para levantamento de dados relevantes à interpretação dos resultados. Os valores de referência foram expressos em termos da média ± desvio-padrão, intervalo de confiança 95% e valor de referência superior. A distribuição estatística dos resultados obtidos foi realizada para possibilitar sua comparação com grupos de trabalhadores, preferentemente à avaliação individual. RESULTADOS E CONCLUSÕES: O valor médio ± desvio-padrão para a carboxiemoglobina foi de 1,0 % ± 0,75; o intervalo de confiança 95%, entre 0,9 e 1,1 % e o valor de referência superior, de 2,5%. Através do teste t de Student (p < 0,05 não foi detectada diferença nos valores de acordo com o sexo, idade ou uso de bebidas alcoólicas. Os valores de referência encontrados foram similares aos reportados em outros países.

  16. Estrategias de mercado para el frijol centroamericano

    OpenAIRE

    Lourdes Mart\\u00EDnez; Richard Bernsten; Miguel Zamora

    2004-01-01

    Estrategias de mercado para el frijol centroamericano. En los últimos años, el sub-sector de frijol en Centro América ha sido testigo de varios cambios dinámicos. Si no se encuentran medidas para incrementar la competitividad regional de este sub-sector, los países centroamericanos experimentarán impactos negativos en las áreas sociales y económicas de considerable magnitud, especialmente ahora que Centro América necesita ajustar su economía a los nuevos requerimientos ...

  17. Calibración para medidas experimentales

    OpenAIRE

    Calahorra Martínez, María Elena; García Arrona, Rosa

    2014-01-01

    Nivel educativo: Grado. Duración (en horas): Más de 50 horas Los estudiantes deben resolver un problema situado en un contexto real, para lo cual deben comprender que las medidas en Química están afectadas siempre de un error inherente al propio método de medida, al instrumental comercial utilizado o a las incapacidades del experimentador. La resolución del problema exige diseñar experimentos para calibrar material volumétrico y termómetros comerciales y llevarlos a la práctica en el labor...

  18. Espacio urbano para el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Guillermo Malca Obregoso

    2004-01-01

    Full Text Available Este artículo ilustra una Metodología de Análisis-Propuesta Urbana Sostenible para la enseñanza-aprendizaje del diseño urbano-arquitectónico conciente de su entorno socio-cultural-ambiental. Se presenta como alternativa a los métodos convencionales de intervención urbana. Pretende, a partir de la visión dialéctica, entender los problemas originados por el crecimiento de las ciudades de modo INTEGRAL, sin segmentarlos para su estudio parcializado y parcelado.

  19. Espacio urbano para el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Guillermo Malca Obregoso

    2015-04-01

    Full Text Available Este artículo ilustra una Metodología de Análisis-Propuesta Urbana Sostenible para la enseñanza-aprendizaje del diseño urbano-arquitectónico conciente de su entorno socio-cultural-ambiental. Se presenta como alternativa a los métodos convencionales de intervención urbana. Pretende, a partir de la visión dialéctica, entender los problemas originados por el crecimiento de las ciudades de modo INTEGRAL, sin segmentarlos para su estudio parcializado y parcelado.

  20. USO DE GEOTECNOLOGIAS PARA O ESTABELECIMENTO DE ÁREAS PARA CORREDORES DE BIODIVERSIDADE

    Directory of Open Access Journals (Sweden)

    Ana Paula Garcia Oliveira

    2015-08-01

    Full Text Available RESUMOCorredores de biodiversidade são estruturas ambientais com a finalidade de conservar e recuperar a biodiversidade. Aplicam-se, principalmente, a áreas degradadas pelo desenvolvimento humano desordenado, que favorece a fragmentação florestal e a perda da conectividade entre os diversos hábitats. Utilizando o sensoriamento remoto e sistemas de informações geográficas, buscou-se identificar áreas para atuarem como corredores de biodiversidade, possibilitando, assim, o fluxo gênico entre os fragmentos remanescentes e as áreas de preservação permanente. Para tanto, foi realizada uma análise espacial dos fragmentos remanescentes em São Gabriel do Oeste, Mato Grosso do Sul, através de sua forma, tamanho e localização. Foram identificadas as áreas para os corredores a partir da localização de fragmentos com potencial, ou seja, de tamanho e conservação adequados, além de considerar a carta de classes das terras para mecanização e o mapa de áreas prioritárias para a conservação do Ministério do Meio Ambiente, permitindo a escolha de melhores áreas para corredores de biodiversidade. Verificou-se que as geotecnologias são importantes ferramentas de auxílio na determinação de áreas propícias para a análise integrada da paisagem, bem como de áreas propícias para implantação de corredores, gerando um cenário alternativo para a recuperação ambiental, o zoneamento ecológico e a conservação ambiental.

  1. Procedimiento para el cierre de canteras de materiales para construcción en Cuba

    OpenAIRE

    2016-01-01

    Con el propósito de facilitar a los concesionarios de canteras de materiales para la construcción una herramienta metodológica para efectuar el cierre de estas y garantizar una minería sostenible se propuso un procedimiento en seis etapas a partir del diagnóstico realizado en 22 canteras, ubicadas en tres regiones mineras cubanas. El procedimiento busca disminuir los impactos ambientales provocados por la explotación de las canteras y ofrecer a la industria un estándar para lograr uniformidad...

  2. Recursos informativos para Terapia Ocupacional Basada en la Evidencia, informe para profesionales de Terapia Ocupacional

    OpenAIRE

    Ortega-Valdivieso, Azucena

    2015-01-01

    Se ofrece un directorio de recursos y fuentes de informaci??n de inter??s para localizar evidencias para la toma de decisiones cl??nicas de los terapeutas ocupacionales. Se identifica un conjunto de recursos ??tiles para realizar la fase dos de la Terapia Ocupacional Basada en la Evidencia correspondiente a la b??squeda bibliogr??fica en fuentes de informaci??n. La selecci??n de las fuentes se ha realizado con visi??n amplia y hol??stica de las variadas necesidades de informaci??n que un tera...

  3. Consumo de bebidas para una vida saludable: recomendaciones para la población mexicana

    OpenAIRE

    Rivera, Juan A.; Onofre Muñoz-Hernández; Martín Rosas-Peralta; Aguilar-Salinas, Carlos A.; Willett, Walter C; Popkin, Barry M.

    2008-01-01

    El secretario de Salud convocó al Comité de Expertos para la elaboración de las Recomendaciones sobre el consumo de bebidas para la población mexicana ; la finalidad fue desarrollar lineamientos basados en evidencia científica para los consumidores, los profesionales de la salud y el sector gubernamental. Las prevalencias de sobrepeso, obesidad y diabetes han aumentado con rapidez en México y las bebidas representan la quinta parte de la energía que consumen los mexicanos. La evidencia señal...

  4. Para-grassmann variables and coherent states

    CERN Document Server

    Cabra, D C; Tanasa, A; Cabra, Daniel C.; Moreno, Enrique F.; Tanasa, Adrian

    2006-01-01

    The definitions of para-grassmann variables and $q-$oscillator algebras are recalled. Some new properties are given. We then introduce appropriate coherent states as well as their dual states. This allows us to obtain a formula for the trace of a operator expressed as a function of the creation and annihilation operators.

  5. A etnomusicologia serve ainda para alguma coisa?

    OpenAIRE

    Laborde, Denis E.; Castro,Beatriz Magalhães

    2008-01-01

    Cinquenta anos, para uma disciplina científica, é muito pouco. A etnomusicologia é, portanto, uma disciplina jovem. Se comparadas à etnomusicologia, a sociologia e a etnologia – estas disciplinas sob o embaraçoso apadrinhamento das quais a etnomusicologia tem tentado se desenvolver – exercem papel de patriarcas.

  6. ¿Para que la historia?

    Directory of Open Access Journals (Sweden)

    Jaime Jaramillo Uribe

    1998-08-01

    Full Text Available Para qué sirve la historia?. ¿Puede el conocimiento del pasado darnos pautas para comprender el presente? Sobre este, como sobre tantos problemas teóricos de la historia, se han realizado largos e inacabados debates entre historiadores y filósofos. En este ensayo se acepta como eficaz la hipótesis de que conocer el origen y el desarrollo de un proceso es buen fundamento para explicarse una situación final. En el caso de la historia colombiana, se parte de la base de que al producirse la independencia nacional en 1820, para quienes tenían la responsabilidad de dirigir el nuevo país había cuatro problemas o retos fundamentales: 1. Dar una organización política al nuevo Estado; 2. Reorientar el proceso de la economía nacional; 3. Crear un sistema educativo y darle un nuevo contenido a la enseñanza; 4. Transformar una sociedad de castas heredadas de la época colonial en una sociedad de ciudadanos en sentido moderno. Dentro de una visión sintética de esos cuatro procesos, se trata de ver qué cambios se han verificado en el transcurso de 150 años y qué queda pendiente del intento de responderá esos cuatro retos históricos.

  7. Música Cuatro abstracciones para cobres (1992)

    OpenAIRE

    Marulanda López, Juan Carlos

    2004-01-01

    "Cuatro Abstracciones para Cobres", está cons­truida con un diseño similar a la "Sonata de Chiesa" del período barroco (lento - rápido - lento - rápido), pero utilizando lenguaje y técnica del siglo XX.

  8. Productos y Servicios para Residentes Extranjeros

    OpenAIRE

    2003-01-01

    Da a conocer los productos y servicios del Grupo La Caixa, para residentes extranjeros. Presenta las características más relevantes, acuerdos con entidades financieras Latinoamericanas, información del servicio de transferencias, así como los resultados del uso de las remesas.

  9. Protocolo de Enfermagem para consulta de puericultura

    Directory of Open Access Journals (Sweden)

    Fabiane do Amaral Gubert

    2015-01-01

    Full Text Available presentar un protocolo de Enfermería para consulta de puericultura, basado en el Modelo de Enfermería de Roper-Logan-Tierney. Método: para construir el protocolo, se realizaron: revisión de la literatura, selección y lectura de los documentos relevantes para el área de salud del niño. Resultados: el desarrollo textual del protocolo, dividido en cinco capítulos según los marcos del crecimiento y desarrollo del lactante; inserción de las variables – cuestiones del protocolo, dispuestas de acuerdo con las actividades de vida propuestas en el modelo de Enfermería; y evaluación del contenido por nove investigadores a través del Índice de Validez de Contenido, con la mayoría de los artículos superior al 0,80. Conclusión: el protocolo producido se señaló como útil para orientar la atención de Enfermería en puericultura, lo que permite atención estandarizada y dirigida a la atención integral de la salud de niños en sus primeros meses de vida.

  10. Educación para la paz

    Directory of Open Access Journals (Sweden)

    Federico Mayor Zaragoza

    2003-01-01

    Full Text Available La educación para la paz ha experimentado un desarrollo importante en los últimos 20 años, y el 2000 ha sido declarado Año Internacional para la Cultura de Paz. Exige un esfuerzo de pariicipación y una capacidad crítica para facilitar el paso de una cultura de guerra a un cultura de paz. Se trata de ayudar a todos los ciudadanos a observar y reflexionar sobre el conjunto de la tierra y de quienes la habitan. De escuchar a los jóvenes y ser escuchado. La educación para la paz ha de ser considerada como contenido transversal de la educación. La situación actual, los conflictos interétnicos e interculturales , la exclusión y la marginalidad, las sociedades pobres y las ricas son cuestiones que reclaman una educación par la paz. De la cultura de imposición hemos de pasar a la cultura del diálogo y parti-cipación, solidaridad, compromiso, tolerancia y respeto. Es necesario construir otro mundo en el que podamos asegurar a nuestros descendientes el futuro. La paz es un comportamiento, es traducir a la práctica los principios de con-vivencia, de solidaridad, de fraternidad. Sólo así «vendrá el amanecer (y brilla-rá mucha luz en nuestro camino»

  11. Vendaje funcional para la ''mano abierta''

    OpenAIRE

    Rochina, Iván

    2013-01-01

    Se muestra la aplicación de un vendaje funcional para el tratamiento de las molestias ocasionadas por la distensión de los ligamentos propios de los huesos del carpo; Producción: SFPIE(www.uv.es/sfpie)|VLC Campus (www.vlc-campus.com)

  12. novos elementos e horizontes para o cuidado

    Directory of Open Access Journals (Sweden)

    Rosa Lúcia Rocha Ribeiro

    2007-01-01

    Full Text Available La condición crónica ha sido un tema de importancia extrema para la reflexión del proceso de vivir humano. En el artículo se presenta la síntesis de una investigación realizada con la finalidad de comprender cómo los niños con Síndrome Nefrótico son cuidados, buscando identificar nuevos elementos y horizontes para reconstruir el cuidado de enfermería, teniendo como foco la familia. Para la presente investigación, se realizó un estudio cualitativo que utilizó como referente teórico metodológico, la hermenéutica basada en Gadamer y Ricouer. De la investigación realizada en 2004, participaron 42 personas pertenecientes a las familias de niños y adolescentes con Síndrome Nefrótico, usuarias del Servicio de Nefrología Pediátrica del Hospital Universitario Júlio Müller, en Cuiabá, Brasil. En la discusión son presentadas: una síntesis de las familias, sus proyectos, personajes y contexto; la trayectoria de la enfermedad del niño en la familia, y el cuidado del niño nefrótico en la familia. Se muestran también los horizontes de los cuidadores, familiares y profesionales de salud, y el cuidado posible a partir de los arreglos de la familia. Se puede concluir que el diálogo es la primera condición para la comprensión y también para el cuidado.

  13. PAISAJES PARA UN DESARROLLO SUSTENTABLE Y PARTICIPATIVO

    Directory of Open Access Journals (Sweden)

    RAFAEL MATA OLMO

    2014-01-01

    Full Text Available El texto se ocupa del renovado sentido del paisaje que, a partir de diversas tradiciones disciplinares contemporáneas, ha adoptado el Convenio del Paisaje, un tratado internacional promulgado por el Consejo de Europa en el año 2000. La primera parte trata del concepto adoptado por el citado Convenio, que entiende el paisaje como el carácter de cada territorio, percibido socialmente y resultado de la interacción de hechos y procesos naturales y/o humanos. La segunda aborda las bases metodológicas de la caracterización y valoración del paisaje, destacando los planteamientos del método británico de Landscape Character Assessment y algunos resultados empíricos de esta metodología. La tercera parte trata de las políticas de paisaje, incidiendo en las potencialidades de los instrumentos de planificación territorial y urbanística para incorporar objetivos, directrices y acciones dirigidos a la salvaguarda, gestión, recualificación y acceso público al paisaje. Para terminar, el texto recoge una experiencia de proyecto territorial de paisaje, la del Plan Insular de Menorca (Islas Baleares, España, aprobado en 2003. Se sintetizan sus determinaciones sobre la protección de determinados terrenos por sus altos valores paisajísticos, sus directrices para que las políticas sectoriales (turismo, agricultura, infraestructuras, etc. incorporen criterios paisajísticos, y sus iniciativas para la gestión y mejora del paisaje y para el fomento del acceso público a su contemplación y disfrute.

  14. Contenidos orientacionales para la preparación de los adolescentes para la convivencia intergeneracional

    Directory of Open Access Journals (Sweden)

    Dania Ondina Feria-González

    2012-01-01

    multigeneracionales donde conviven adolescentes y personas ancianas y longevas. Abordó características relacionadas con estos grupos etáreos y recomendaciones para la orientación de los adolescentes y sus familias para la convivencia con personas ancianas y longevas. Se planteó la necesidad de que la orientación para la convivencia con personas ancianas y longevas se lleve a cabo mediante la contextualización de situaciones reales de las familias en el proceso de orientación familiar en la secundaria básica para influir en la educación en valores en los adolescentes como la solidaridad, el humanismo y la dignidad.

  15. FINANCIAMIENTO ESTATAL PARA LOS PROCESOS ELECTORALES MUNICIPALES

    Directory of Open Access Journals (Sweden)

    Alejandro Robles Leal

    2012-01-01

    Full Text Available A partir de un breve repaso de las últimas reformas jurídicas al régimen electoral, tanto del Código Municipal como del Código Electoral, el artículo describe el nuevo sistema de financiamiento estatal que se ha dispuesto para apoyar económicamente a los partidos políticos que participan en los procesos electorales municipales y que, antes de la entrada en vigencia del nuevo Código Electoral, no existía. Haciendo énfasis en las características legales de ese nuevo sistema de financiamiento, a partir de las diferencias con el sistema de financiamiento estatal para los partidos políticos que participan en los procesos electorales nacionales, refiere la jurisprudencia del TSE en la materia, destacando que la primera resolución del Tribunal, que ordenó girar recursos del Estado, fue precisamente para un partido político inscrito en el nivel cantonal. Finalmente, partiendo de la tesis de que la ausencia de financiamiento estatal para los procesos electorales municipales constituyó una barrera para la profundización democrática costarricense, por lo que su inclusión representa un avance en el fortalecimiento de los derechos políticos de la ciudadanía, los autores concluyen con algunas recomendaciones de carácter legislativo, con el fin de fortalecer este régimen de financiamiento, principalmente por la vía de su sistematización y equiparación con el financiamiento para procesos electorales nacionales, con la expectativa de robustecer las plataformas partidarias y profundizar, así, nuestra cultura democrática en el nivel local. Se anexa cuadro con la lista de los partidos políticos a los que ya se ordenó girar el financiamiento indicado, que desglosa los montos totales y porcentuales, así como los montos que no pudieron ser liquidados y que regresan al erario.

  16. Modelo estocástico multivariado para valuar opciones financieras

    OpenAIRE

    Fuentes de Maria C., Marco A.

    1998-01-01

    La presente tesis expone un modelo multivariado estocástico para el proceso de precios de activos financieros, en particular, acciones, con el propósito de utilizarlo para la valuación de opciones.

  17. The Center for Excellence in Disaster Management and Humanitarian Assistance (CFE-DMHA): An Assessment of Roles and Missions

    Science.gov (United States)

    2016-01-01

    The report finds that while the Asia-Pacific presents a large proportion of the global challenge in preparing for and managing natural disasters...course. 22 The Center for Excellence in Disaster Management and Humanitarian Assistance The classroom HART course takes place approximately 12 times...staff, 2015. 20 “Health Emergencies in Large Populations (H.E.L.P.) Course,” Center for Excellence in Disaster Management and Humanitarian Assistance

  18. Aplicaciones de Kinect para neurohabilitación

    OpenAIRE

    De la Fuente Garrido, David

    2012-01-01

    Kinect para Xbox 360, o simplemente Kinect es un dispositivo controlador para videojuegos desarrollado por Microsoft para la videoconsola Xbox 360, y desde junio del 2011 para PC con sistema operativo Windows 7 o Windows 8. Kinect permite a los usuarios controlar e interactuar con la consola sin necesidad de tener contacto físico con un controlador de videojuegos tradicional, mediante una interfaz natural de usuario que reconoce gestos, comandos de voz, y objetos e imágenes. La neurohabili...

  19. Alternativas fundamentales para cuantificar el riesgo operacional

    OpenAIRE

    Ermilson Velasquez Ceballos; Luis Ceferino Franco Arbeláez

    2010-01-01

    El presente artículo es uno de los resultados de un proyecto de investigación financiado por la Universidad EAFIT en el año 2009. En el contexto del riesgo operacional, se hace un desarrollo formal de los métodos de Simulación Montecarlo, el algoritmo de recursión de Panjer y la Aproximación Analítica de Böcker y Klüppelberg, que son tres de las técnicas más utilizados para cuantificar ese riesgo en entidades financieras en el ámbito mundial. Luego se desarrolla una aplicación para un caso pr...

  20. GUÍAS PARA LOS AUTORES

    Directory of Open Access Journals (Sweden)

    EDGAR SERNA MONTOYA

    2009-06-01

    Full Text Available NORMAS PARA PUBLICACIÓN DE ARTÍCULOSLa revista Lámpsakos es una publicación semestral de la facultad de Ingenierías de la Fundación Universitaria Luis Amigó. Estádestinada a difundir, dentro y fuera del país, las realizaciones científicas, ingenieriles, tecnológicas y de innovación que se producen en las universidades y centros de investigación en el país y el exterior. Los aportes que se reciban para estudio de publicación deberán estar enmarcados en la normatividad fijada por la presente norma y aceptada por el Comité Editorial

  1. para la república Argentina

    Directory of Open Access Journals (Sweden)

    Adriana I. Hladki

    2007-01-01

    Full Text Available Se describen doce especies del género Xylaria que se citan por primera vez para la Argentina: Xylaria adscendens, X. allantoidea, X. coccophora, X. cubensis, X. fissilis, X. gracillima, X. luxurians, X. melanura, X. multiplex, X. myosurus, X. kretschmarioidea y X. pseudoapiculata. El registro de las últimas dos especies es el segundo a nivel mundial. Se describen por primera vez los estromas anamórficos o estériles obtenidos en cultivo de X. kretschmarioidea, X. luxurians y X. melanura, y los cultivos en agar-avena de X. pseudoapiculata. Se sinominiza X. torulosa con X. coccophora, y se citan nuevos sustratos u hospedantes para la mayoría de las especies.

  2. Novos tempos para nossa jovem Tempus

    Directory of Open Access Journals (Sweden)

    Ana Valéria Machado MENDONÇA

    2014-12-01

    Full Text Available A Revista Tempus Actas em Saúde Coletiva chega ao final de 2014 com muitos motivos para comemorar, muitas foram as vitórias, entre elas, o lançamento dos seus dois últimos números do ano. Ao lançarmos os Números 3 e 4, o primeiro nesta semana e o segundo na próxima, trazemos uma nova formatação visual, normativa e editorial, segundo as exigências da base de dados LILACS - Literatura Latino-Americana e do Caribe em Ciências da Saúde, um dos mais expressivosindexadoresda América Latina e Caribe.Isso mesmo, fomos avaliados positivamente e estamos a um passo de mais uma importante indexação para nosso periódico científico.

  3. ESPECIFICANDO FORMALMENTE TOPOLOGIAS PARA REDES EM CHIP

    Directory of Open Access Journals (Sweden)

    Eliselma Vieira dos Santos

    2012-03-01

    Full Text Available Este artigo trata da utilização de métodos formais na especificação de topologias para redes em chip. As redes em chip apresentam similaridades com as redes tradicionais, entretanto, por estarem inseridas em sistemas embarcados apresentam características mais restritivas do ponto de vista de espaço, consumo de energia e latência. A topologia descreve o fluxo de dados através da rede e a estrutura física de como os dispositivos estão conectados, bem como, pode determinar o grau de escalabilidade e o desempenho de um sistema como todo. Este artigo apresenta especificações de topologias de redes em chip, relevantes para o projeto de sistemas embarcados, as quais poderão ser utilizadas no processo de síntese de alto nível.

  4. Ecuaciones de diferencias mejoradas para ecuaciones diferenciales

    OpenAIRE

    Lick, Wilbert

    2009-01-01

    Se presenta en este artículo una resena sobre el uso del método integral para derivar ecuaciones de diferencias a partir de ecuaciones diferenciales. El método se aplica a varios tipos de ecuaciones diferenciales ordinarias correspondientes a problemas de valores de contorno y a problemas de valores iniciales, ilustrándose la utilidad del método con varios ejemplos sencillos. Peer Reviewed

  5. Apontamentos para uma leitura de Georg Simmel

    Directory of Open Access Journals (Sweden)

    Simone Costa

    2010-05-01

    Full Text Available Este artigo tem por objetivo descrever e analisar algumas questões centrais para a compreensão do pensamento de Georg Simmel. Discute-se como esse importante expoente da sociologia alemã percebe a relação estabelecida entre os indivíduos e a sociedade e as influências que ele exerce sobre intelectuais como Max Weber e Erving Goffman.

  6. Factores claves para iniciar una empresa

    OpenAIRE

    Reyna, Irenarco Rueda

    2015-01-01

    RESUMENEl artículo presenta en forma esquemática los aspectos relevantes para la conformación de una empresa,  desde la planeación acertada, el mercado, los medios de producción,  personal y financiamiento. Resalta asimismo la importancia de las clasificaciones y características que debe tener el indicador  de negocios.

  7. ALGUNAS CARTAS DE CONTROL BIVARIADAS PARA ATRIBUTOS

    Directory of Open Access Journals (Sweden)

    CAROLINA OSPINA HINCAPIE

    2010-01-01

    Full Text Available Muchos procesos industriales son de naturaleza multivariada dado que la calidad de un producto depende de más de una variable. El control multivariado de procesos captura la relación en las variables asociadas al proceso, si se ignora esta correlación y se utilizan gráficos de control univariados para cada variable por separado se puede concluir erróneamente acerca del estado del proceso. En variables continuas correlacionadas se han realizado muchas investigaciones, sin embargo se encuentran pocos trabajos que traten sobre atributos correlacionados. En este trabajo se comparan tres cartas de control para variables aleatorias binomiales bivariadas, correlacionadas entre sí, las cuales miden atributos. Las cartas son: La carta de Hotelling basada en la aproximación de la distribución binomial multivariada a la distribución normal multivariada. La carta MNP la cual es una extensión de las cartas univariadas, y la carta que es una metodología no paramétrica basada en el índice de profundidad de Mahalanobis. La comparación se hace vía simulación utilizando como medida de comparación, la longitud promedio de racha (ARL. Dentro del trabajo se presenta un ejemplo aplicado de las metodologías para construir cartas de control para variables binomiales bivariadas en una empresa de telecomunicaciones. De los resultados se aprecia, en términos generales, que la carta MNP es la mejor tanto en control como fuera de control.

  8. Recogimientos para mujeres en Lima hasta 1650

    Directory of Open Access Journals (Sweden)

    Martínez Alcalde, Lidia

    2001-12-01

    Full Text Available Analysis of the different institutions that were established in Peru during the Modem Age for attendance of women, with references to the qualities and evolution of each one of them.

    Análisis de las diferentes instituciones que se crean en el Perú en la Edad Moderna para la asistencia de mujeres, especificando las características y evolución de cada una de ellas.

  9. El modelo Biasca para transformar la empresa

    Directory of Open Access Journals (Sweden)

    Rodolfo Eduardo Biasca

    2004-01-01

    Full Text Available Basado en su experiencia en el campo de la consultoría en América Latina, el autor propone un modelo para evaluar la transformación de las empresas, cuyos componentes básicos son: 1 evaluación del cambio que necesita la empresa competitiva, 2 mejoramiento cuantitativo, 3 mejoramiento incremental, 4 revolución o cambio discontinuo y 5 evolución o cambio continuo.

  10. CONFIANZA: EL RETO PARA LAS CIENCIAS SOCIALES

    Directory of Open Access Journals (Sweden)

    Juan José Plata C.

    2009-01-01

    Full Text Available El artículo presenta una reflexión sobre el papel de las ciencias sociales en el mundo moderno, resaltando como los orígenes, principios y fundamentos que la sustentan, nos permiten orientar posibles soluciones en el actual conflicto social. Para lo anterior acudimos a una metodología descriptiva entre metáforas, conocimiento y desarrollo

  11. La escuela para el siglo XXI

    Directory of Open Access Journals (Sweden)

    Juan Delval

    2013-01-01

    Full Text Available Centro Europeo de Derecho La escuela para el siglo XXI Currículo: doctor en Filosofía. Catedrático de Psicología Evolutiva y Educación en la Univer- sidad Autónoma de Madrid. Sus líneas de investigación versan sobre el desarrollo del pen- samiento infantil, especialmente en lo relativo a la lógica, a la formación del pensamiento científico y a la construcción de nociones sociales, así como a su aplicación a la formación de conocimientos en la escuela. Trabaja también sobre la historia de la psicoLa escuela debería ser un lugar privilegiado para proporcionar una formación que permita participar plenamente en la vida ciudadana y democrática, pero pode- mos percibir hoy que existe una contradicción entre el tipo de educación que se proporciona en las escuelas, y el modelo de sociedad al que formalmente se aspira. Lo que tendríamos que conseguir es constituir escuelas que sean demo- cráticas y que preparen a los individuos para actuar como auténticos ciudadanos, y no como súbditos. ¿Cómo se hace?, ¿cómo podemos llegar hacia una escuela que cumpla esas funciones?, ¿qué tendríamos que hacer en las escuelas para poder encaminarnos hacia la formación de individuos que tengan este tipo de características? Si optamos por fomentar la existencia de individuos felices y au- tónomos hay que comenzar por emprender una serie de reformas.

  12. Diagnóstico molecular para Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Ysabel Montoya

    1997-01-01

    Full Text Available El potencial diagnóstico de epitopes inmunodominantes seleccionados fue ensayado satisfactoriamente a fin de obtener una prueba serodiagnóstica alternativa para la Leishmaniasis Tegumentaria Americana. Dos proteínas recombinantes prometedoras de L. (v. peruviana referidas como T-26-U2/T26-U4 fueron reconocidas por sueros individuales de pacientes con Leishmaniasis Tegumentaria Americana usando Western Blot. La sensibilidad de la prueba fue de 86% con sueros permanentes con Leishmaniasis peruana.

  13. Plataforma e-learning para Phyton

    OpenAIRE

    Martín Sánchez, Raquel

    2015-01-01

    El proyecto pretende realizar un aula virtual para que los alumnos, de una forma sencilla puedan realizar un curso de programación de Phyton. La comunicación entre el profesor y el alumno es directa. En dicha plataforma se podrán descargar temas, ejercicios y otros recursos que puedan facilitar el aprendizaje. Existen tres roles: administrador, profesor y alumno.

  14. para el tiro de aperos de labranza

    Directory of Open Access Journals (Sweden)

    Ismael Pimentel Rivero

    2007-01-01

    Full Text Available Por la necesidad de ir logrando en el país niveles de sostenibilidad en la agricultura, que aseguren la conservación y eficiencia en el uso de los recursos disponibles, se proyecta un estudio de las fuentes energéticas que se utilizan en las tecnologías de labranza de suelos para condiciones de montaña, con el objetivo de evaluar el aprovechamiento de la fuerza de los animales durante el tiro de aperos de labranza, constituyendo esta una alternativa energética renovable, técnicamente aceptable, económicamente viable y socialmente deseable. La idea piloto comienza su desarrollo en el entorno de la Facultad de Agronomía de Montaña de San Andrés, en la Universidad de Pinar del Río, abarcando el valle de San Andrés con sus formas y sectores de producción característicos y proyectándose a la generalización en las áreas montañosas de la agricultura. Para el estudio se diseñó un experimento trifactorial donde se evaluaron parámetros como la velocidad de trabajo, resistencia al tiro y grado de fatiga o cansancio de los animales. De forma general se logró demostrar para las condiciones de montaña de San Andrés, los elementos que determinan la correcta formación de los conjuntos para la labor de aradura, garantizando su eficiencia energética, conservación del medio ambiente y factibilidad económica. De forma general con este trabajo se demostró la necesidad de reorientar la formación de conjuntos durante el uso de la energía animal en la agricultura de montaña

  15. Arquitectura Organizacional para Soluciones Empresariales de Software

    Directory of Open Access Journals (Sweden)

    Solangel Rodríguez Vázquez

    2013-09-01

    Full Text Available La arquitectura organizacional para soluciones empresariales de software es un modelo organizativo que tiene como objetivo contribuir a elevar la productividad de los procesos y el empleo adecuado de los recursos humanos de una organización productiva de software. Para la elaboración de la arquitectura se tuvo en cuenta los problemas en el flujo de trabajo actual, las deficiencias referentes a la distribución de roles, la inadecuada gestión del tiempo y la escasa utilización de componentes de software. Dicha arquitectura cuenta con una estructura formada por cinco entidades o componentes organizacionales las cuales son: la entidad Inteligencia, Gerencia de proyecto, Personas, Repositorio y Proceso. En cada una de ellas se organiza el trabajo a desarrollar a partir de procesos y actividades establecidas lo que ajusta el modelo a su objetivo fundamental para obtener productos con la calidad requerida. Estos procesos están concebidos para que sigan una línea de desarrollo que permita el buen funcionamiento entre las entidades. Es muy importante en este ámbito la comunicación, interacción e integración entre los componentes organizacionales ya que el trabajo de cada uno depende de los demás. Dicha arquitectura de factoría permite ser adaptado a cualquier organización o empresa teniendo en cuenta sus particularidades además de responsabilizar e identificar a los recursos humanos con su trabajo.

  16. Unha fermosa historia para eloxiar a diferenza

    OpenAIRE

    Silva, Sara Raquel Reis da

    2012-01-01

    Neste artigo, revisita-se uma narrativa "clássica contemporânea" vocacionada para os leitores mais novos, na qual se ficcionalizam, num registo assente na personificação e na simplicidade lexical, por exemplo, temáticas como a igualdade de género ou a condição feminina. CIEC - Centro de Investigação em Estudos da Criança, UM (UI 317 da FCT)

  17. Coherencia curricular y oportunidades para aprender Ciencias

    Directory of Open Access Journals (Sweden)

    Marcela Ruiz Zúñiga

    2014-12-01

    Full Text Available Se determinó la coherencia curricular entre oportunidades de aprendizaje y habilidades científicas ofrecidas por un texto escolar chileno y por las actividades de aula en 5º grado asociadas al contenido "Fuerza". Se realizó un análisis discursivo de la unidad didáctica del texto y de las actividades con el fin de construir matrices de contenido para tópicos y habilidades; la medición de coherencia curricular se realizó a través del índice de Porter para la coherencia. Los resultados muestran que el texto escolar promueve más observación (24.2% y menos ordenamiento de la información (0.95%. En las clases, predominó repetición de contenidos de manera oral y escrita (66.8% y menos análisis de hipótesis (1.6%. El índice de Porter entre el texto y el aula fue 0.360, entre el texto y el marco curricular fue 0.267. Se concluye que el texto y las clases ofrecen leves oportunidades para el desarrollo de las habilidades científicas.

  18. HACER PARA PENSAR: IDEAS, ESPACIOS Y HERRAMIENTAS

    Directory of Open Access Journals (Sweden)

    Claudia Urrea Giraldo

    2012-01-01

    Full Text Available Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico, como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y herramientas se pusieron a disposición de los y las participantes para la construcción de historias digitales, modelos y simulaciones. El objetivo final fue que los y las profesoras pudieran vivenciar, a través de una experiencia práctica, el ambiente de aprendizaje construccionista, las ideas y las herramientas, para que más adelante las pudieran extrapolar en sus propias disciplinas y cursos.

  19. Cuestionarios Interactivos para Autoevaluación

    Directory of Open Access Journals (Sweden)

    Sánchez García, Juan Francisco

    2007-01-01

    Full Text Available La autoevaluación es un instrumento valioso para que el propio alumno pueda medir el grado de conocimientos adquiridos de la materia en cuestión, al tiempo sirve para adiestrarlo en el tipo de prueba que se utilizará posteriormente en el examen. Por otro lado, dado que en la adaptación al Espacio Europeo de Educación Superior (E3S tiene particular importancia la labor realizada por el propio alumno, los pruebas de autoevalución adquieren, si cabe, una mayor relevancia. Por todo ello, hemos elaborado unos test interactivos con hoja de calculo, para cubrir el doble propósito de evaluar los conocimientos alcanzados por nuestros alumnos, relativos tanto a la materia, como al manejo en sí de la propia herramienta informática de la hoja de cálculo. Se muestran ejemplos concretos relacionados con las matemáticas y la hoja de cálculo Excel.

  20. EXPERIENCIA INTEGRADORA PARA EDUCACIÓN AMBIENTAL

    Directory of Open Access Journals (Sweden)

    Jorge F. Coronel

    2015-01-01

    Full Text Available En este trabajo se relacionó la práctica experimental de laboratorio co n el análisis de problemas ambientales. El objetivo de este trabajo es analizar una propuesta que vinculó el trabajo experimental con la situación del ambiente local para promover el cuidado de la naturaleza y su uso con sostenibilidad . Esta estrategia brindó un enfoque integrador aportando a los alumnos de profesorado una alternativa de aprendizaje con exper iencias sencillas para el estudio cualitativo de l ambiente local y motivar a l análisis de problemas asociad o s. Las experiencias permitieron caracterizar las muestras de suelo, agua y aire del lugar de residencia de los alumnos. La información experimental obtenida potenció la discusión de la situación ambiental actual. E l enfoque de enseñanza basado en problemas socio - científicos posibilit ó la visión interdisciplinar del tema , redimensionando valores y acciones para el cuidado ambiental y el desarrollo sustentable.

  1. Los consorcios exportadores: Estrategia para vender extralocalmente

    Directory of Open Access Journals (Sweden)

    Margot Cajigas Romero

    2006-01-01

    Full Text Available Bajo el título Los consorcios exportadores: Estrategia para vender extralocalmente,se expone cómo a través de una investigación exploratoria, realizada mediante la interacción de empresarios en una mesa de trabajo, cumplida con reuniones periódicas por más de un año, se consigue diseñar un sistema de unión entre empresas locales, para que vendan sus productos en mercados seleccionados de Colombia y algunas otrasnaciones. El comercio internacional no es unjuego de suma cero, es dable encontrar mercados externos dónde venderlos productos de economías en desarrollo, el primer mercado donde se debe competir es el propio mercado nacional y los empresarios aceptan organizarse para buscar vender en mercados seleccionados de Colombia y el mundo mediante la estrategia Coexco(Comercializadoras Extralocales de Colombia es el mensaje último del artículo.

  2. A leitura: um passaporte para a vida

    Directory of Open Access Journals (Sweden)

    Armindo Teixeira Mesquita

    2011-06-01

    Full Text Available Nas sociedades actuais, a capacidade para usar material escrito é indispensável ao acesso a todo tipo de informação, tornando o uso da leitura cada vez mais necessário à participação real do cidadão em actividades produtivas e colectivas, porque ajuda a formar seres pensantes. O contacto com os livros deve ser iniciado o mais cedo possível, não só pelo manuseio, como também pela história contada ou pelos jogos rítmicos. Com efeito, na idade da infância, toda a energia do indivíduo é dirigida para a construção da sua identidade. Logo, as primeiras leituras entram no período da formação e da fundação, isto é, consignamos à leitura uma grande força de desenvolvimento pessoal. Os livros, para além de auxiliares na aprendizagem do mundo, formam o leitor no gosto. Formar o gosto e possibilitar escolhas são realidades fundamentais na vida adulta.

  3. Rehacer los caminos para otros mundos posibles

    Directory of Open Access Journals (Sweden)

    Jaime Alberto Rendón Acevedo

    2016-05-01

    Full Text Available Se ha generado un ambiente de fracaso de las propuestas y acciones que desde la izquierda o desde sectores progresistas se hicieron en América Latina y más precisamente en Sur América. Un embate político sobre las alternativas al modelo neoliberal que se lograron instaurar en América Latina en los últimos 15 años. Este artículo contribuye a un debate que apenas comienza; una discusión en torno a los futuros posibles y al papel de los sectores progresistas y de izquierda en un continente que cada día cobra mayor importancia para los intereses de la geopolítica y la geoeconomía mundial. Para esto se empieza por analizar la coyuntura, obviamente con una perspectiva histórica, de tal manera que se posibilite entender el giro a la derecha o si se prefiere el retorno al modelo neoliberal. Luego el análisis tomará perspectivas de futuro, en donde los riesgos necesariamente aumentan para la Región por ser más visible y de mayor peso ante las presiones internacionales que ya ven en Sur América un actor importante. Por último, se presentan algunas reflexiones frente a los procesos económicos y políticos de cara al Buen Vivir en la América Latina.

  4. Competencia para desarrollar la alfabetización digital

    OpenAIRE

    González Rodríguez, José Santiago; Navarrete Aguirre, Mariana; Molina Zacate, Ma. Gabriela

    2011-01-01

    Introducción, Objetivos Generales, Temario: (1) ¿Qué significa la competencia para desarrollar la alfabetización digital? (2) ¿Por qué es relevante que adquiera la competencia para desarrollar la alfabetización digital en mi formación? (3) ¿Cómo aprendo la competencia para desarrollar la alfabetización digital? (4) ¿Cómo aplico la competencia para desarrollar la alfabetización digital? (5) ¿Cómo puedo autoevaluar mi competencia para desarrollar la alfabetización digital (...

  5. Procedimiento para el cierre de canteras de materiales para construcción en Cuba

    Directory of Open Access Journals (Sweden)

    Julio Montero-Matos

    2016-03-01

    Full Text Available Con el propósito de facilitar a los concesionarios de canteras de materiales para la construcción una herramienta metodológica para efectuar el cierre de estas y garantizar una minería sostenible se propuso un procedimiento en seis etapas a partir del diagnóstico realizado en 22 canteras, ubicadas en tres regiones mineras cubanas. El procedimiento busca disminuir los impactos ambientales provocados por la explotación de las canteras y ofrecer a la industria un estándar para lograr uniformidad en la planificación y ejecución del cierre con un costo mínimo.

  6. Metodología para el desarrollo de Hidrolizados Proteicos para Medios de Cultivo en Cuba.

    Directory of Open Access Journals (Sweden)

    Raisa Zhurbenko

    2005-01-01

    La metodología incluyó elementos científico-técnicos, de Buenas Prácticas de Laboratorio y de Manufactura y las normas ISO 9000 del 2000, entre otros. Se desarrollaron 12 bases nutritivas por nuevos métodos, que cumplen con los requisitos de calidad exigidos para estos productos. La composición físico-química, de minerales y aminoácidos, así como su reactividad biológica posibilitaron su empleo en más de 20 medios de cultivo diferentes para el control de calidad sanitaria de los alimentos. Más de 15 toneladas se han obtenido para el mantenimiento del Sistema de Vigilancia Epidemiológica del país.

  7. La estrategia educativa 2020 o las limitaciones del Banco Mundial para promover el "aprendizaje para todos"

    Directory of Open Access Journals (Sweden)

    Antoni Verger

    2011-12-01

    Full Text Available LA NUEVA Estrategia Educativa 2020 del Banco Mundial establece las prioridades de reforma educativa en países en vías de desarrollo para la década siguiente. El título explícito de la estrategia, Aprendizaje para Todos, es un claro reconocimiento de que, más allá de políticas centradas en el acceso, se debe hacer algo más para asegurar que la educación derive en experiencias positivas de aprendizaje. Sin embargo, como este artículo sostiene, las opciones de políticas explícitas y latentes en la Estrategia 2020 no son las más adecuadas para lograr el Aprendizaje para Todos. El artículo desarrolla tres tipos de argumentos al respecto. El primero se refiere al fuerte apego del Banco a un conocimiento disciplinario y un enfoque metodológico que es insuficiente para entender lo que aprenden los niños en la escuela y por qué. El segundo argumento se refiere al sesgo pro-mercado de la Estrategia por lo que respecta a la reforma del sector público y a nuevas formas de oferta educativa. En tercer lugar, el artículo señala las principales ausencias de la Estrategia, con especial atención a las omisiones relacionadas con la compleja relación entre educación y pobreza.

  8. Objeto de aprendizaje para la formación docente orientado a desarrollar competencias para usar recursos educativos abiertos

    OpenAIRE

    Ahabael LUGO LÓPEZ; Lozano Martínez, Fernando Gustavo; Ramírez Montoya, María Soledad

    2014-01-01

    1. Introducción; 2. Referente teórico; 2.1 Competencias docentes; 2.2 Definición y características de los Recursos Educativos Abiertos; 2.3 Competencias para usar recursos educativos abiertos para la práctica educativa; 2.4 Objetos de aprendizaje abiertos; 3. Marco metodológico; 3.1 Descripción del objeto de aprendizaje para desarrollar competencias para usar recursos educativos abiertos para la práctica educativa; 3.2 Competencias didácticas del objeto; 3.3 Componentes tecnológicos del objet...

  9. Análisis de alimentos para el ganado, instrucciones para la toma de muestras

    OpenAIRE

    anonymous

    2009-01-01

    La alimentación del ganado constituye uno de los aspectos claves en la rentabilidad de las explotaciones ganaderas. A tal efecto, esta guía ofrece a los ganaderos interesados aspectos básicos a tener en cuenta para efectuar una correcta toma de muestras así como los parámetros esenciales para el diseño posterior de racionamiento. Livestock's feed constitutes one of the key aspects in the profitability of livestock farms. With this in mind, this guide offers cattle farmers the basic factors...

  10. Metodología para el desarrollo de Hidrolizados Proteicos para Medios de Cultivo en Cuba.

    OpenAIRE

    Raisa Zhurbenko; Claudio Rodríguez Martínez

    2005-01-01

    Se desarrolló una nueva metodología para la obtención, desde escala de laboratorio, hasta la producción industrial en serie, de hidrolizados y extractos de proteínas para su empleo en calidad de bases nutritivas en los medios de cultivo microbiológicos. La metodología incluyó elementos científico-técnicos, de Buenas Prácticas de Laboratorio y de Manufactura y las normas ISO 9000 del 2000, entre otros. Se desarrollaron 12 bases nutritivas por nuevos métodos, que cumplen con los requisitos d...

  11. Estórias para um turismo slow. Contributos para o marketing na Serra Algarvia

    OpenAIRE

    Jesus, Ana Beatriz Bernardo de

    2016-01-01

    Dissertação de Mestrado, Marketing, Faculdade de Economia, Universidade do Algarve, 2016 Esta dissertação, desenvolvida no âmbito do Mestrado em Marketing da Faculdade de Economia da Universidade do Algarve, apresenta uma investigação cujo principal objetivo é a recolha de estórias que possam vir a contribuir para o posterior desenvolvimento de produtos slow no âmbito de uma estratégia de marketing para a Serra Algarvia. Trata-se de uma investigação de natureza exploratória e desenvolvi...

  12. PLAN DE NEGOCIO PARA UNA AGENCIA DEDICADA A MARKETING DIGITAL, ESPECIALMENTE PARA EL MERCADO CHINO

    OpenAIRE

    HUANG, JIARUI

    2014-01-01

    El presente plan de negocio analiza la viabilidad del proyecto empresarial de una Agencia de Marketing online, especialmente relacionado con el mercado Chino. Se ofrecerá a los clientes servicios marketing para introducir y/o establecer al mercado chino, tanto para mercado chino en China o en España. El proyecto surge de la tendencia del sector y la experiencia personal. El sector de marketing es un campo en permanente crecimiento y renovación, donde el perfil de clientes incorpora progres...

  13. Sistema soporte para la asignación de agua para riego y otros usos.

    OpenAIRE

    Jaramillo Alvarez, Patricia; Smith Quintero, Ricardo Agustín

    2001-01-01

    Se presenta un sistema soporte para el problema específico de asignación de agua para riego y otros usos en una cuenca, cuando se pretende alcanzar múltiples objetivos en conflicto. El sistema facilita hacer decisiones respecto al regadío, considerando la eficiencia, la aplicación técnicamente óptima de riego y adopción de cultivos, bajo el concepto de sostenibilidad, eficiencia social y económica. Permite además incorporar otros usos del recurso hídrico como por ejemplo el uso doméstico....

  14. Un criterio para seleccionar operadores genéticos para resolver CSP

    OpenAIRE

    Riff Rojas, María Cristina

    1998-01-01

    Nuestro interés es definir algoritmos evolucionistas para la resolución de problemas de satisfacción de restricciones (CSP), los cuales tomen en cuenta tanto las ventajas de los métodos tradicionales de resolución de CSP, así como las características propias de este tipo de problemas. En este contexto, se propone en el presente artículo un criterio para poder evaluar la performance de los operadores gen'eticos dentro de algoritmos evolucionistas que resuelven CSP.

  15. Hacer para pensar: ideas, espacios y herramientas

    Directory of Open Access Journals (Sweden)

    Miranda Garnier, Ximena

    2012-02-01

    Full Text Available Resumen: Con el presente ensayo se busca compartir la experiencia de aprendizaje diseñada y desarrollada por un grupo interdisciplinario de profesores y profesoras de la Universidad de Costa Rica. La actividad contó con la participación de docentes de distintas disciplinas académicas. La propuesta se concretó en un taller que utilizó el lenguaje de programación Scratch y las tarjetas Pico,como oportunidad para modelar un ambiente de aprendizaje construccionista. Ideas poderosas, espacios y herramientas se pusieron a disposición de los y las participantes para la construcción de historias digitales, modelos y simulaciones. El objetivo final fue que los y las profesoras pudieran vivenciar, a través de una experiencia práctica, el ambiente de aprendizaje construccionista, las ideas y las herramientas, para que más adelante las pudieran extrapolar en sus propias disciplinas y cursos.Abstract: With this essay we intend to share a learning experience designed for and developed with an interdisciplinary group of faculty at the University of Costa Rica. Scratch programming language and Pico Boards supported this opportunity to experience a constructionist environment, where powerful ideas, spaces and tools were available for participants to design and construct their own digital stories, models and simulations. The final goal was that participants would experience, through a practical experience, the constructionist learning environment and the tools available, so that they could, in the future, extrapolate the knowledge they constructed in their own disciplines and classes.

  16. La Escucha Efectiva. Recomendaciones para lograrla.

    Directory of Open Access Journals (Sweden)

    Mariano Álvarez Farfán

    2009-10-01

    Full Text Available La comunicación es y seguirá siendo una condición de la existencia humana. Aún avanzando por las sendas del siglo XXI es imposible vivir sin dedicarle atención priorizada a este proceso. Dentro de él un lugar primordial lo ocupa la habilidad de escuchar. Saber escuchar es una de las habilidades más importantes que debe tener un profesional e incluso cualquier persona común de la sociedad. En los últimos años los especialistas han venido dedicando una atención especial a esta habilidad, dándole un tratamiento relativamente independiente dentro de los estudios sobre el proceso de comunicación. En investigaciones realizadas sobre las habilidades que debe tener todo buen comunicador se ha determinado que la más necesaria y difícil de lograr es la de saber escuchar. Realmente pasamos más tiempo escuchando que hablando, pero no son muchos los que se pueden calificar como buenos oyentes. Los estudiosos del tema a nivel mundial coinciden también que desarrollar esta habilidad requiere, de una gran voluntad y disposición hacia el cambio de enfoques, conductas y formas de ver las cosas, porque solo hay una manera de lograrlo y es luchando desde “dentro” del individuo. En el trabajo se ofrecen diferentes opiniones y enfoques que pueden contribuir a desarrollar esta habilidad tan importante, para el trabajo profesional y para las relaciones interpersonales. Se enfatiza en los beneficios que reporta una buena escucha, qué entender por una buena escucha o escucha efectiva y las recomendaciones para lograr esa escucha efectiva.

  17. Software educativo para enfermería

    Directory of Open Access Journals (Sweden)

    Mac Gaul de Jorge, Marcia Ivonne

    2009-01-01

    Full Text Available El presente trabajo relata la experiencia de investigación del proyecto investigación del proyecto Nº 1531 del CIUNSa, "Software Educativo para Enfermería del Adulto". El equipo integra a enfermeras, quienes en el año 2003 elaboraron un material que responde a la realidad epidemiológica de nuestro país, marcadamente diferente a textos clásicos provenientes de otras regiones del mundo. Convencidos que las universidades deben dar respuestas a los problemas regionales, se están desarrollando materiales educativos que, aprovechan las ventajas que la Informática brinda (altamente interactivos y que pueden actualizarse permanentemente. Esta investigación está finalizando su etapa diagnóstica, la cual posee dos objetivos específicos para el desarrollo del producto software: uno tendiente a indagar las competencias de los alumnos de Ciencias de la Salud con relación al uso de materiales educativos informatizados; el otro, modelar el sistema informático del cual serán usuarios los alumnos y docentes, para lo cual se están realizando actividades de Ingeniería de Requerimientos que permitan establecer el contexto en el que se utilizará el software desarrollado. Creemos que el estudio diagnóstico culminado sitúa a nuestros alumnos en la misma sintonía de los desarrolladores. Sus expectativas por un recurso efectivamente didáctico coinciden con nuestras directrices de diseño.

  18. Taller para educadores: el uso del diccionario.

    OpenAIRE

    Ríos González, Gabriela

    2012-01-01

    Este artículo pretende darle una guía a los docentes de primaria y secundaria en el uso del diccionario. Primero realizamos una pequeña reflexión sobre el uso del diccionario, luego veremos los tipos de diccionario, las partes de un diccionario, la selección del diccionario adecuado y algunas actividades que el docente puede llevar a cabo en el aula para el uso del diccionario. This article pretends to guide the teachers of primary and high school in the use of the dictionary. First we cre...

  19. Envases para frutas y hortalizas frescas

    OpenAIRE

    Raimondo, Emilia; Espejo, Cecilia

    2002-01-01

    La calidad con que llegan las frutas al consumidor depende, en gran medida, del material del envase. Dado las exigencias cada vez mayores, tanto del mercado de exportación como del interno, es importante la adecuada selección del material para envase y embalaje. El envase apropiado es el que soluciona problemas fisiológicos propios de la fruta, la protege prolongando su conservación y, al mismo tiempo, resalta su presentación sin incrementar c...

  20. Notas para los Colaboradores del Index Botanicorum

    Directory of Open Access Journals (Sweden)

    Verdoorn Frans

    1946-12-01

    Full Text Available EL INDEX BOTANICORUM: -Al discutir la necesidad de un diccionario biográfico de los botánicos del mundo y de todos los tiempos. JAMES BRITTEN (J. Bot. 39: 394. 1901 afirma: “Este formaría un compendio manual y útil no solamente de biografías botánicas sino de investigación botánica y sería de valor incalculable para el historiador y el estudiante” En el siguiente artículo se habla de las pautas que deben seguir los colaboradores del Index Botanicarum al escribir en dicho diccionario.

  1. Aerobiologia: uma ciência para quem ?

    OpenAIRE

    Fabião, António; Fabião, André

    2006-01-01

    A aerobiologia pode ser definida como a ciência que estuda o material biológico e os organismos que se encontram na atmosfera, incluindo a sua libertação para a mesma, bem como a sua dispersão e transporte, deposição ou outra forma de remoção da atmos fera, e os seus impactes na vida vegetal, animal e humana. Trata-se de uma ciência interdisciplinar, com ligações a variadas áreas do conhecimento, incluindo a botânica, a ecologia, a meteorologia, a agricultura, a silvicultura e a alergologia c...

  2. Apontamentos para as aulas de Hidrologia

    OpenAIRE

    Rodrigues, Carlos Miranda; Guimarães, Rita Cabral; Moreira, Madalena

    2011-01-01

    Esta publicação constitui um manual de apoio aos alunos para a disciplina de Hidrologia, Hidrologia Agrícola e Interpretação da Paisagem. Nela são abordados os temas gerais da Hidrologia: Ciclo hidrológico; Bacia Hidrográfica; Precipitação; Intercepção; Evaporação e Evapotranspiração; Água no Solo, Escoamento Superficial; Balanço Hidrológico; Estudo das Cheias.

  3. Formar formadores para a escrita profissional

    Directory of Open Access Journals (Sweden)

    Tommaso Raso

    2007-01-01

    Full Text Available Este trabalho apresenta alguns dos resultados de dez anos de pesquisa e atividade didática para formar formadores de escrita profissional, tanto no sistema educacional quanto no mundo do trabalho. Em particular, apresenta-se um currículo base de competências comuns a todos os formadores, sem distinção de destinação didática. Essas competências são resumíveis em cinco pontos: a consciência da variação entre as estratégias textuais da fala e da escrita; a habilidade em identificar as informações dentro de um contexto e usá-las para os próprios fins textuais; a consciência dos traços que caracterizam um gênero textual e a capacidade de gerenciá-los na reformulação para objetivos diferentes; a capacidade de gerenciar os diferentes aspectos de uma situação comunicativa; a argumentação, com e sem documentação. O trabalho privilegia as competências textuais sobre aquelas lingüísticas de superfície e, portanto, mesmo pensado para um ambiente italófono, é aplicável a qualquer língua-cultura ocidental.This paper presents some results of a ten year research and teaching project for educating educators for professional writing, either in the educational system or in the working environment. Specifically, it presents a curriculum of basic competences that all educators should have, independently of the didactic destination. These competences can be summarized in five points: the conscience of the variation between speaking and writing textual strategies; the ability to identify information within a context, and in using it for textual purposes; the conscience of the parameters that characterize a textual genre, and the capacity of managing them reformulating a text for different purposes; the skills for managing the different aspects of a communicative situation; and, finally, argumentation, with and without documentation. The study privileges textual rather than surface linguistic competences; so, even if elaborated

  4. FINANCIAMIENTO ESTATAL PARA LOS PROCESOS ELECTORALES MUNICIPALES

    OpenAIRE

    2012-01-01

    A partir de un breve repaso de las últimas reformas jurídicas al régimen electoral, tanto del Código Municipal como del Código Electoral, el artículo describe el nuevo sistema de financiamiento estatal que se ha dispuesto para apoyar económicamente a los partidos políticos que participan en los procesos electorales municipales y que, antes de la entrada en vigencia del nuevo Código Electoral, no existía. Haciendo énfasis en las características legales de ese nuevo sistema de finan...

  5. Macros y atajos para el traductor

    OpenAIRE

    José Luis Heredero

    2007-01-01

    Sin necesidad de recurrir a los productos comerciales de ayuda a la traducción que se han ido generalizando en muchas grandes empresas y organizaciones, el traductor independiente puede ver considerablemente facilitado su trabajo si sabe explotar las muchas posibilidades que brindan Visual Basic y otros lenguajes poco conocidos de dominio público. Se presentan aquí varias macros de Word y pequeñas aplicaciones desarrolladas en los últimos años para acelerar tanto las búsquedas de términos —ba...

  6. Desarrollo de motores stirling para aplicaciones solares

    OpenAIRE

    García Menéndez, David

    2013-01-01

    Los sistemas de conversión termosolar basados en motores Stirling figuran entre las líneas de investigación actuales que pretenden contribuir al uso racional de la energía y al desarrollo sostenible. La presente Tesis Doctoral tiene como objetivo proporcionar criterios de análisis, diseño, fabricación y ensayo útiles para el desarrollo de motores Stirling alimentados con energía solar, a diferentes niveles de salto térmico. La metodología empleada está basada principalmente en técnicas...

  7. Los ritmos como terapia para la impulsividad

    Directory of Open Access Journals (Sweden)

    Mónica Triviño

    2012-10-01

    Full Text Available Investigaciones recientes muestran que el uso de patrones rítmicos facilita la respuesta óptima en el tiempo, por lo que el entrenamiento mediante ritmos podría proponerse como terapia novedosa ante problemas como la impulsividad. Esto podría beneficiar a pacientes con daño prefrontal o personas con trastorno por déficit de atención e hiperactividad (TDAH, que suelen mostrar conductas impulsivas, así como dificultad para estimar el paso del tiempo.

  8. Para no olvidar el comentario de texto.

    Directory of Open Access Journals (Sweden)

    Rúben López.

    2004-03-01

    Full Text Available ¿Qué es comentar?El Diccionario de la Real Academia Española enuncia que la noción de “comentario” tiene tres sentidos: 1 Escrito que sirve de explicación de una obra, para que se entienda más fácilmente. 2 Juicio, parecer, mención o consideración que se hace, oralmente o por escrito, acerca de una persona o cosa. 3 Título que se da a algunas historias escritas en estilo conciso.

  9. Para Bombay phenotype--a case report.

    Science.gov (United States)

    Mathai, J; Sulochana, P V; Sathyabhama, S

    1997-10-01

    Bombay phenotype is peculiar in that red cells are not agglutinated by antisera A, B or H; while serum contains anti A, B and H. Existence of modifying genes at independent loci with variable expression of ABO genes is postulated. We report here a case of partial suppression where antigens could be detected by elution tests and unlike classical Bombay type, normal amount of appropriate blood group substances were present in saliva. This case of para Bombay phenotype was detected as a result of discrepancy in cell and serum group ng. This highlights the importance of both forward and reverse grouping in ABO testing.

  10. Arquitectura empresarial para corresponsales no bancarios

    OpenAIRE

    Palacino Díaz, Alejandro; Rodríguez de Silvestre, Carlos Eduardo

    2011-01-01

    La arquitectura empresarial permite alinear el desarrollo tecnológico de una organización con su visión y estrategia. El presente trabajo de grado propone una solución tecnológica al procesamiento transaccional de CNB para entidades financieras en Colombia, mitigando riesgos de operación y reduciendo los limites impuestos por el manejo del efectivo en poblaciones remotas, enmarcada dentro de TOGAF como marco de referencia de arquitectura empresarial. El desarrollo de la arquitectura parte de ...

  11. Merci: um sistema interativo para cinema digital

    OpenAIRE

    Nóbrega, Mainara Rodrigues

    2013-01-01

    O cinema tem evoluído continuamente desde a sua criação. Passou a ter som, cores, efeitos visuais, especiais, tridimensionais, multissensoriais, e agora interatividade. Tais mudanças têm proporcionado ao público experiências cada vez mais realistas durante a exibição de um filme. Estas podem ser obtidas através de tecnologias implantadas no audiovisual e, algumas vezes, na própria sala de projeção para captação de movimento da plateia ou da voz de espectadores, com a finalidade de proporciona...

  12. Música para bebés

    OpenAIRE

    Cala Guerrero, María Dolores

    2014-01-01

    Este trabajo fin de grado refleja una revisión bibliográfica sobre la importancia que tiene el tratamiento de la música en madres embarazadas y bebés, para ello se investiga y se toman como ejemplo las aportaciones de los autores más relevantes en este tema. Se realiza un estudio sobre los beneficios de una correcta educación musical en edades tempranas y cómo ésta afecta al desarrollo psicomotor, cognitivo, emocional y lingüístico. Se habla sobre la importancia de conectar musicalmente a ...

  13. Misi Baby Spa - Un Mundo para Bebes

    OpenAIRE

    2012-01-01

    Misi Baby Spa es un lugar privilegiado concebido y diseñado especialmente para mamás, papás y bebés. Busca fortalecer el vínculo afectivo entre el núcleo familiar con herramientas como la lúdica, la música y el agua. Aliado con grandes marcas representativas del sector y encadenado a la marca Misi brindará un gran respaldo y garantía de servicio a sus clientes. Hombres y mujeres de clase media alta y alta interesados en el cuidado de y desarrollo de sus hijos, obtendrán en ...

  14. Entornos adaptados para personas con discapacidad mental

    OpenAIRE

    Guasch Murillo, Daniel; Bonasa Jiménez, Mª del Pilar; López Novella, Judit; Mayor Sánchez, Carolina; Guasch Murillo, Yolanda

    2001-01-01

    Las universidades tienen ante sí un reto importante en conseguir entornos accesibles para el alumnado con discapacidad mental donde puedan desarrollar con éxito sus estudios universitarios y, de esta forma, mejorar sus perspectivas laborales. Sólo el 5,4% de las personas con discapacidad de 25 o más años tienen estudios universitarios o equivalentes, siendo este porcentaje del 18,7% en el caso de las personas sin discapacidad (Observatorio Estatal de la Discapacidad, 2010). Si se observa el p...

  15. CXML: intérprete para XML

    OpenAIRE

    Concha Medina, Edgard José; Corro, Gonzalo Gabriel; Leiva, Mario

    2014-01-01

    El lenguaje XML, de creación relativamente reciente, está siendo muy utilizado en aplicaciones web y en las comunicaciones entre servidores web, y adquiriere importancia en el área de las bases de datos, no sólo como soporte para la transferencia de datos sino como formato de almacenamiento. Ya que el lenguaje XML es un estándar internacional y dado su importancia, en el año académico 2013 se solicitó a los alumnos de la asignatura Lenguajes de Programación y Compiladores de la Licenciatur...

  16. Um desenho institucional para o novo associativismo

    OpenAIRE

    Avritzer,Leonardo

    1997-01-01

    Apontam-se elementos de alteração no padrão do associativismo latino-americano e na auto-percepção dos participantes das associações civis. A partir dessa análise, sugere-se um modelo institucional que permitiria potencializar a contribuição desse novo associativismo para a democratização de práticas políticas que se geraram à sombra da debilidade histórica do associativismo civil.

  17. Infraestructura privada: Diez mandamientos para su sostenibilidad

    OpenAIRE

    Antonio Vives

    1997-01-01

    La pérdida de calidad de los servicios de infraestructura asociada con la participación del sector público llevaron en la década de los 70 al comienzo de una ola de desregulación y privatización. Ahora estamos en plena ola. La pregunta, que no tiene respuesta evidente, es si trata de una moda o si es un proceso irreversible. Si se desea hacer duradero, deben observarse una serie de condiciones que en este trabajo proponemos como los diez mandamientos para la sostenibilidad de la infraestructu...

  18. 11 Verduras para Diversificar la Dieta Peruana

    OpenAIRE

    2013-01-01

    Los peruanos debemos comer más verduras. Estos alimentos son fuentes esenciales de vitaminas, minerales, antioxidantes y fibra alimentaria y la ciencia muestra día a día su contribución a la prevención de enfermedades. Para tener un estilo de vida saludable es necesario comer diariamente cinco porciones de frutas y verduras y hacer ejercicio físico regularmente. Aquí presentamos una lista corta de once hortalizas de hoja, algunas son yuyos de uso tradicional en el campo peruano, otras son ver...

  19. Controlador de gastos para dispositivos Android

    OpenAIRE

    2012-01-01

    Este proyecto fin de carrera consiste en desarrollar una aplicación Android gestora de las finanzas personales que permita llevar un control exhaustivo de nuestros gastos y nuestros ingresos. Para poder diversificar cada una de las transacciones se han establecido diversos conceptos como cuentas, categorías o localizaciones. Las cuentas, así como las transacciones, son parte fundamental de la aplicación pues con ellas se establece una separación de nuestras finanzas. Las localizaciones, po...

  20. Un sistema de saneamiento para Madrid

    OpenAIRE

    Sánchez, Félix Cristóbal

    1986-01-01

    The Full Sanitation Plan for Madrid is the final action of a series undertaken for several years with the purpose to reach the completion of the sanitation system of the town. With the whole of these actions it could be said that the basic substructure has acquired enough level to deserve de real needs of the town.El Plan de Saneamiento Integral de Madrid representaba la culminación de una serie de acciones emprendidas, durante varios años, para conseguir que la ciudad completase su sistema d...

  1. Condutas para o trabalho de parto prematuro

    OpenAIRE

    Bittar,Roberto Eduardo; Carvalho,Mário Henrique Burlacchini de; Zugaib, Marcelo

    2005-01-01

    O parto prematuro é a principal causa de morbidade e mortalidade neonatal. Cerca de 75% dos nascimentos prematuros são decorrentes do trabalho de parto espontâneo. A patogenia do parto prematuro espontâneo é complexa e o sucesso do seu manejo depende da pesquisa cuidadosa dos riscos maternos e fetais para dar continuidade ou não à gestação. O objetivo deste artigo é fazer uma revisão do diagnóstico do trabalho de parto prematuro, tocólise, corticoterapia, tratamento antibiótico e assistência ...

  2. Modelos de datos para datos espaciales

    OpenAIRE

    Vitturini, Mercedes; Fillottrani, Pablo Rubén; Castro, Silvia Mabel

    2003-01-01

    El desarrollo de tecnologías de recolección y digitalización de datos geográficos junto con la nueva demanda de visualización, manipulación interactiva y análisis de los resultados, ha generado la necesidad de un nuevo tipo de software dedicado, denominados GIS. Las Bases de Datos Espaciales en sus diferentes modalidades son una parte integral de los GIS: proveen capacidades para representar, almacenar y acceder a los datos, además de resolver los problemas de control de concurrencia, manejo ...

  3. Redes sociales para educomunicadores : recursos y experiencias

    OpenAIRE

    Universitat Autònoma de Barcelona. Máster en Comunicación y Educación (online)

    2013-01-01

    Las redes sociales han sido universalmente acogidas entre los usuarios de internet como una manera comprometerse en eventos, grupos sociales y temas de interés. Estos usuarios han encontrado en las redes un espacio para compartir información, socializar y, en muchos casos, construir verdaderas redes de cooperación y colaboración, un uso que puede ampliarse aún más en la medida en que madure la alfabetización mediática de sus participantes. Este informe muestra las principales redes sociales, ...

  4. Tengo palabras para nombrarte y amarte

    OpenAIRE

    Zuluaga Sánchez, Sandra Inés; Giraldo Giraldo, Yicel Nayrobis

    2011-01-01

    Artículo (Maestría en Educación y Desarrollo Humano). Universidad de Manizales. Facultad de Ciencias Sociales y Humanas. CINDE, 2011 Este artículo busca presentar por qué un programa de promoción de lectura en la primera infancia es una acción potente para enriquecer el vínculo entre el bebé y su cuidador y proveer a la relación de multiples formas de expresión que potencian el desarrollo emocional y cognitivo de los niños, fortalece las capacidades comunicativas de los adultos; permite la...

  5. CONCILIACION PARA JUNTAS DE ACCION COMUNAL

    OpenAIRE

    Belalcazar Vega, Jose Alfredo

    2005-01-01

    La expedición de las normas reguladoras de los organismos de acción comunal mencionadas en la identificación del problema creo un vacío ya que le asigna la función de administrar justicia en la condición de conciliadores a personas que no estaban preparadas para asumir este tipo de funciones debido a la ausencia de capacitación sobre este tipo de normas legales. se pretende apoyar las funciones de la secretaria de desarrollo, ya que se generaría caos al interior de las comunidades que hacen p...

  6. Diretrizes brasileiras para o tratamento da narcolepsia

    OpenAIRE

    Alóe, Flávio; ALVES, Rosana Cardoso; Araújo, John F.; Azevedo, Alexandre; Bacelar, Andrea; Bezerra,Márcio; Bittencourt, Lia Rita Azeredo; BUSTAMANTE, Guilherme; CARDOSO, Tania Aparecida Marchiori de Oliveira; ECKELI, Alan L.; Fernandes, Regina Maria França; Goulart, Leonardo; Pradella-Hallinan,Márcia; Hasan,Rosa; Sander, Heidi Haueisen

    2010-01-01

    Este artigo relata as conclusões da reunião de consenso da Associação Brasileira de Sono com médicos especialistas brasileiros sobre o tratamento da narcolepsia, baseado na revisão dos artigos sobre narcolepsia publicados entre 1980 e 2010. Os objetivos do consenso são valorizar o uso de agentes avaliados em estudos randomizados placebo-controlados, emitir recomendações de consenso para o uso de outras medicações e informar pontos importantes a respeito da segurança e efeitos adversos das med...

  7. Para um perfil do idoso-andarilho

    Directory of Open Access Journals (Sweden)

    Claudia Lysia de Oliveira Araújo

    2012-01-01

    Full Text Available O termo envelhecimento é frequentemente empregado para descrever as mudanças morfofuncionais que ocorrem ao longo da vida humana, após a maturação sexual e que, progressivamente, comprometem a capacidade de resposta dos indivíduos ao estresse ambiental e à manutenção da homeostasia. Na condição de pessoas em envelhecimento avançado e de vida fragilizada, são encontrados muitos idosos-andarilhos por estradas e ruas das cidades brasileiras. Definimos aqui andarilho como a pessoa que vive fora do lar, em um cotidiano muito simples, miserável até, afastado de relações familiares e sociais mais próximas, distanciados do sentido de uma vida dita normal. A falta deste sentido de vida, a que se alia o preconceito da sociedade, têm sido fatores que levam à estigmatização desses idosos abandonados, fazendo-os a acreditar que a rua é o único lugar que lhes resta para viver. O objetivo deste estudo foi conhecer os motivos que conduzem um idoso a se tornar andarilho, tendo sido realizado nos albergues das cidades do Vale do Paraíba, no Estado de São Paulo. O universo desta experiência foram alguns idosos sem moradia, independentemente de gênero. Identificamos, neste estudo, os idosos encontrados não por seus nomes reais, mas por meio da denominação dada a pedras preciosas. Eles relataram ter profissão, embora vivam sós, perambulando pelas ruas das citadas regiões urbanas. Quanto aos problemas de saúde, os idosos aqui entrevistados referiram alguma patologia, ainda que nenhum deles fizesse tratamento ou visitasse médico regularmente, por não disporem de documentos. Os relatos desses idosos-andarilhos apontam para uma condição de sobrevivência fragilizada, comprometida por se tornarem muito vulneráveis, susceptíveis a agressões externas, o que agudiza cada vez mais sua exclusão familiar e social. Por fim, verifica-se que eles ainda sonham em voltar ao lar e recomeçar a vida ao lado da própria família.

  8. Receptores de radio monochip para FM

    OpenAIRE

    Miguel López, José María

    2005-01-01

    Este libro aborda de forma estructurada tanto los aspectos de diseño como los de realización de receptores de radio para la banda de FM. Tras unos primeros capítulos dedicados al estudio de las propiedades de la modulación de frecuencia y de los circuitos básicos que configuran un receptor de radio, se desarrolla un minucioso análisis de los circuitos integrados TDA7000/10/21. Paso a paso se muestra cómo diseñar con estos circuitos receptores de FM que, al requerir muy pocos ajustes, puede...

  9. PARA EVITAR LA CONTAMINACIÓN AMBIENTAL

    Directory of Open Access Journals (Sweden)

    F Pachón

    2005-01-01

    Full Text Available El presente artículo se enmarca dentro de la caracterización del sistema de producción bovina del municipio de Utica (Cundinamarca y dentro de los problemas más importantes que lo afectan. Como resultado, el estudio identificó la escasez de alimento de buena calidad en épocas secas como la principal limitante del productor bovino del municipio. Aprovechando una ventaja presente en la zona, como es la elaboración de panela (proceso a través del cual resultan algunos subproductos, como bagazo y melote, que pueden ser utilizados como alternativa alimenticia para los bovinos en cualquier época del año, se planteó un experimento en el que se elaboraron bloques multinutricionales con base en dichos subproductos. El experimento se adelantó en una finca de un productor y se utilizaron 57 novillos cebús con edades entre los 11 y los 24 meses y pesos entre los 124 y los 463 kilogramos. Los animales se dividieron dos grupos que se mantuvieron en pasturas no manejadas. Al grupo experimental se le ofrecieron adicionalmente bloques multinutricionales. Los animales fueron examinados para comprobar su estado fisiológico, con el fin de determinar posibles inconvenientes sanitarios que pudieran afectar el ensayo. Se realizaron pesajes para medir las ganancias de peso en los dos grupos. Los resultados mostraron promedios de ganancias diarias de peso similares a Pr < 5%, donde fueron ligeramente superiores las del grupo alimentado con los bloques multinutricionales (0,848 vs. 0,769 kg animal/día. Los aportes más importantes del experimento fueron, primero, brindar una opción para que el productor pueda alimentar a sus animales en épocas de escasez y evitar que tenga que venderlos a bajos precios. El segundo aporte fue abrir la posibilidad de usar los productos de la elaboración de la panela, que en muchas ocasiones se convierten en desechos que no son usados y que contaminan las fuentes de agua, de una forma económicamente viable.

  10. Plan de ventas para FDF en Colombia

    OpenAIRE

    Pinedo Molina, Jainer Mauricio

    2014-01-01

    Para muchas compañías el éxito en sus resultados comerciales está dado en gran medida por la elaboración y ejecución de un Plan de Ventas -- Es igualmente importante estar monitoreando la aplicación de las acciones planteadas, el avance en el logro de los objetivos y los ajustes que se deben realizar ante los cambios sucedidos en el entorno y la situación de la empresa; además de atender las nuevas necesidades del mercado -- Entender las variables del entorno, controlables y no controlables, ...

  11. Razonamiento algebraico elemental: propuestas para el aula

    Directory of Open Access Journals (Sweden)

    Walter F. Castro G

    2014-09-01

    Full Text Available En este artículo se aborda el problema de la enseñanza de álgebra en la escuela primaria. Se discute lo que se entiende como “early álgebra” y se presentan varios enfoques sobre la introducción del álgebra en la escuela elemental. En correspondencia con los enfoques, se discuten tanto algunas tareas de razonamiento algebraico elemental que pueden ser implantadas en el aula, como algunas de las características algebraicas atribuidas. Finalmente, se presenta una propuesta para asignar niveles o grados de algebrización a algunas tareas.

  12. Manual de protocolo para empresas hoteleras

    OpenAIRE

    Román-del-Monte, Annabelle Valentina

    2011-01-01

    Este proyecto propone la implementación de un manual de protocolo para empresas hoteleras, especialmente aquellas que reciben clientes pertenecientes al turismo de negocios. Frente a la mayor competencia existente,y en el actual contexto de crisis, las empresas buscan hoy día diferenciarse de las demás a través de la calidad. Una herramienta útil es el “protocolo aplicado a la empresa”. El protocolo anteriormente se entendía como una regla estricta, estrechamente unida al ámbito diplomá...

  13. FATORES DE RISCO PARA QUEDAS EM IDOSOS

    Directory of Open Access Journals (Sweden)

    Alice Gabrielle de Sousa Costa

    2013-01-01

    Full Text Available La ocurrencia de caídas representa obstáculo en la salud de ancianos y aumenta su dependencia. El objetivo fue investigar los factores de riesgos intrínsecos y extrínsecos, además de posibles asociaciones estadísticas para caídas en ancianos en los últimos seis meses. Estudio caso-control con enfoque cuantitativo, desarrollado en tres Asociaciones de Rehabilitación y un Centro de Asistencia Social, con dos grupos con treinta ancianos cada, un grupo con caídas (caso y otro sin caídas (control. Datos recogidos de enero hasta abril de 2010, por formulario. Los datos fueron organizados en plantillas y analizados por programa estadístico. El grupo caso presentó peores condiciones intrínsecas y más factores extrínsecos. Entre los factores de riesgo intrínsecos estadísticamente significativos, se señalan: alteraciones en los pies, equilibrio perjudicado y alteraciones propioceptivas. Por el refuerzo de la hipótesis de multicausalidad para ocurrencia de caídas, la posibilidad de actuación del enfermero.

  14. Sistema integral para viviendas unifamiliares -SIVIM-

    Directory of Open Access Journals (Sweden)

    Drágula, Josef

    1984-07-01

    Full Text Available The Integral System for Multi-family Housing —SIVIM— is a proposition combining a structural solution and a functional one. In the first, techniques developed in civil construction for reinforced concrete technology are incorporated in the production of buildings. The second one proposes a spatial solution appropriate to the users’ requirements. Thus, with this proposition, the aims of constructing mass, low-cost housing are maintained in countries with tropical climatesEl Sistema Integral para Viviendas Multifamiliares —SIVIM— es una proposición que combina una solución estructural y una solución funcional. En la primera, se incorporan técnicas desarrolladas en la construcción civil, para la tecnología del hormigón armado, a la producción de edificaciones. La segunda, propone una solución espacial apropiada a los requerimientos de los usuarios. Se mantiene así con esta proposición, las metas de la construcción masiva y del bajo costo de la vivienda en países de clima tropical

  15. La casa del paraíso

    Directory of Open Access Journals (Sweden)

    de Prada Poole, José Miguel

    1992-02-01

    Full Text Available The article is the report that was submitted for the Contest. This is a house in which "the man" is a friend of the nature, he controls it and incorporates it in his most immediate surroundings. People, animals and plants live together forming an interdependent system. The house gives lodging to the man as a group (any kind of group with certain recognized rules of cohabitation. The individual intimacy is protected through "compact building elements" in which the user can retreat and get completely isolated. The glass of the partition le electro-optical and its properties vary as desired. All the necessary installations, controls and networks are situated under the pavement.

    La memoria que se utilizó para el Concurso, al que se presentó esta propuesta, es la que sirve para su exposición. Es ésta, una casa en la que el Hombre es amigo de la naturaleza, la controla, y la incorpora a su entorno más inmediato. Hombres, animales y plantas conviven formando un sistema interdependiente. La vivienda, da cobijo al hombre como grupo (cualquier clase de grupo con ciertas reglas de convivencia reconocidas. Se protege la intimidad individual mediante "elementos compactos de edificación", en los que el usuario puede aislarse por completo. El vidrio del cerramiento es electroóptico y sus propiedades varían a voluntad. Todas las instalaciones, controles y redes necesarios se encuentran bajo el pavimento.

  16. Biossurfactantes: Uma alternativa para o mercado industrial

    Directory of Open Access Journals (Sweden)

    Ana Paula Pereira dos Santos

    2016-06-01

    Full Text Available Os biossurfactantes são moléculas com características tensoativas, isto é, tem o potencial de baixar a tensão superficial de líquidos, sendo indicados em diversas áreas de aplicação industrial e recuperação de derramamento de óleos em áreas afetadas. Através de atividades metabólicas, as bactérias e fungos sintetizam estes compostos anfipáticos na fase exponencial de crescimento microbiano, liberando moléculas com propriedades especificas de acordo com o tipo de substrato. Assim, busca-se alternativas e processos biotecnológicos que alcancem bons rendimentos e baixo custo na obtenção dos biossurfactantes. Com essa finalidade são utilizados óleos vegetais, óleos residuais de frituras e resíduos agroindustriais que apresentam características peculiares importantes para produção destas moléculas. Atualmente mais de 80% dos produtos de limpeza são fabricados com surfactantes sintéticos derivados do petróleo. O objetivo deste artigo foi destacar os aspectos relacionados na produção dos surfactantes de origem biológica e a importância destes para serem empregados no mercado industrial.

  17. Alternativas fundamentales para cuantificar el riesgo operacional

    Directory of Open Access Journals (Sweden)

    Ermilson Velasquez Ceballos

    2010-04-01

    Full Text Available El presente artículo es uno de los resultados de un proyecto de investigación financiado por la Universidad EAFIT en el año 2009. En el contexto del riesgo operacional, se hace un desarrollo formal de los métodos de Simulación Montecarlo, el algoritmo de recursión de Panjer y la Aproximación Analítica de Böcker y Klüppelberg, que son tres de las técnicas más utilizados para cuantificar ese riesgo en entidades financieras en el ámbito mundial. Luego se desarrolla una aplicación para un caso práctico, aplicando los tres métodos, y se obtienen conclusiones sobre su desempeño relativo. ABSTRACTThis article is one of the outcomes of a research project financed by Universidad EAFIT in the year 2009. In the operational risk context, a formal development of Montecarlo simulation methods, Panjer recursion algorithm, as well as Böcker and Klüppelberg analytical approximation is done, which are three of the most used techniques in order to quantify this risk in financial institutions worldwide. Subsequently an application for a practical case is developed by applying the three methods, and conclusions about its relative performance are obtained.

  18. EDUCACIÓN PARA EL CONSUMO

    Directory of Open Access Journals (Sweden)

    J. L. Castillejo

    2011-01-01

    Full Text Available El consumo es un fenómeno de gran peso en la vida actual de los países desarrollados y también de los que están en vías de desarrollo, sinónimo de felicidad y de estatus personal. Por todo ello el consumo merece ser objeto de la educación. En la educación para el consumo resulta clave la implicación familia- escuela, puesto que los padres marcan las primeras pautas en este terreno, junto al contexto social y los medios de comunicación. La educación para el consumo implica información, capacidad de análisis crítica de las situaciones y sensibilidad respecto a las consecuencias del consumo desmedido, que pone en peligro la supervivencia misma del planeta. El consumo se enfrenta así con la escala de valores que la educación debe defender.

  19. El humor como herramienta para lograr aprendizajes

    Directory of Open Access Journals (Sweden)

    Hilda Torres de Sánchez

    2003-09-01

    Full Text Available Una tendencia mundial se ha originado: el uso del humor como herramienta para lograr aprendizajes y mejorar el ambiente donde la persona se encuentre. En el área educativa hay pruebas que demuestran su utilidad y que efectivamente origina cambios positivos, medidos en las evaluaciones, tanto en los estudiantes como en participantes de sesiones de facilitación. El objetivo del experimento realizado fue: Determinar el comportamiento a través de la calificaciones en la primera prueba, del efecto del uso del humor en el dictado de clases utilizando diferentes herramientas como: chistes, anécdotas, analogías en los contenidos. A través de un estudio experimental con un grupo de control realizado en dos aulas de clases con 35 alumnos cada uno, al grupo experimental se le aplicó diferentes recursos humorísticos como herramientas de aprendizaje. Se analizaron las calificaciones en la primera prueba a través de porcentajes de aprobados y aplazados, observándose que el grupo experimental arrojó los mayores porcentajes de aprobados. Tales resultados confirman que el humor como herramienta, si induce a un desempeño excelente en alumnos, lo que lleva a implementar acciones de adiestramiento para los facilitadores, así como el surgimiento de investigaciones más profundas sobre el uso del humor en la educación.

  20. Un modelo SETAR para el PIB colombiano

    Directory of Open Access Journals (Sweden)

    Vivas Lorena

    2010-08-01

    Full Text Available En este artículo se estudia el comportamiento de la tasa de crecimiento del PIB colombiano entre 1982-2008 a partir de un modelo SETAR (Self-Exciting Threshold Autoregressive, empleando la metodología propuesta por Tsay (1989 y Tong (1990 para la detección de no linealidades relacionadas con la existencia de regímenes cambiantes. Adicionalmente, se comparan los pronósticos generados con los obtenidos en un modelo autorregresivo lineal para diferentes horizontes de predicción, empleando funciones de pérdida simétricas. Los resultados muestran evidencia empírica de que existe no linealidad de umbral en la serie asociada a las altas o bajas tasas de crecimiento registradas por su rezago anual (permaneciendo más tiempo en el régimen de tasas de crecimiento más elevadas y que el desempeño de los pronósticos del modelo SETAR parece no mejorar con respecto al modelo base.

  1. Cinco paradigmas para abordar lo real

    Directory of Open Access Journals (Sweden)

    Eva Pasek de Pinto

    2006-01-01

    Full Text Available Considerando la crisis de la investigación social, el propósito del estudio fue configurar un fundamento paradigmático para la investigación en ciencias sociales. Partiendo de dos cuerpos teóricos: Mardones, (1991; y Padrón, (1994, 1998, por medio de la deducción y del análisis se obtuvieron cuatro paradigmas de investigación que, integrados, permitieron obtener un quinto paradigma. Así, como resultado del estudio se presentan cinco paradigmas posibles para abordar la realidad: el empírico- inductivo; el racionalista deductivo; el fenomenológico vivencial, el reflexivo crítico y el holístico o de la complejidad. A lo largo del estudio, cada uno de ellos se analiza en cuatro aspectos paradigmáticos: el Ontológico, el Epistemológico, el Axiológico y el Metodológico.

  2. para cemento pórtland I

    Directory of Open Access Journals (Sweden)

    OLGA ISABEL RESTREPO BAENA

    2007-01-01

    Full Text Available En esta investigación se usaron minerales de origen colombiano tal y como son producidos en sus respectivas minas. Se experimentó con la fluorita (Santander, el feldespato (Antioquia y el manganeso (Antioquia en cantidades del 0,0%, 0,2%, 0,5%, 1,0%, 1,5% y 2,0%. Se aplicaron varias técnicas como difracción de rayos X, fluorescencia de rayos x, microscopía electrónica de barrido y microscopía óptica para caracterizar los materiales utilizados y análisis térmico diferencial para determinar la temperatura de clinkerización y se evaluó mineralógicamente el clínker obtenido. Se encontró que el mejor resultado se logró con la adición de 0,5% de la fluorita al permitir la mayor formación de alita y la disminución en el contenido de cal libre. El feldespato y el manganeso (braunita utilizados no tuvieron un comportamiento apropiado.

  3. modelo inteligente para la sociedad red

    Directory of Open Access Journals (Sweden)

    Mauricio Andión Gamboa

    2002-01-01

    Full Text Available En la nueva era de la información es muy probable que las universidades, una vez que se recuperen del shock que ha representado este vertiginoso cambio derivado de la aplicación de las nuevas tecnolgías de la información, se transformen en nodos de una red global de organizaciones sociales dedicadas a orquestar los procesos de producción y distribución de conocimiento en el mundo. En este ensayo se ofrecen un conjunto de argumentos que apoyan esta hipótesis. En primer lugar, se proporcionan algunos antecedentes respecto al concepto de Universidad entendida como organización social y los distintos modelos que ha adoptado para adaptarse a su entorno histórico-social, haciendo énfasis en el caso estadounidense, por considerarlo uno de los sistemas de educación superior más ilustrativos de este proceso de adaptación. Posteriormente, se analiza con más detalle el impacto de la revolución tecnológica en las universidades, haciendo un acercamiento al caso de las universidades en México. Finalmente se propone un modelo de Universidad nodo como alternativa para aquellas universidades dispuestas a abrirse a estos nuevos tiempos.

  4. O preparo para o trabalho de risco

    Directory of Open Access Journals (Sweden)

    Yone Caldas Silva

    Full Text Available A autora focaliza a importância da preparação psicológica e profissional dos trabalhadores, para enfrentarem os riscos do trabalho, no cenário atual de mudanças nas organizações. Considerando a literatura científica internacional, apresenta dados de sua experiência pessoal. A partir do diagnóstico organizacional, sob a coordenação da Assessoria em Segurança, Saúde e Meio Ambiente, da Refinaria Duque de Caxias, (RJ , da qual era consultora, foi aplicada uma metodologia baseada na autonomia de ação de grupos de empregados, incluindo decisões na aplicação de recursos. Como resultados, são evidenciados a dinamização da estrutura organizacional, mudanças nas condições de trabalho, diminuição significativa nos índices e na gravidade dos acidentes, maior capacitação psicológica e profissional para o trabalho de equipe e o desenvolvimento de aptidão gerencial. Conclui, focalizando o importante papel das instituições vinculadas à segurança, saúde e meio-ambiente, indicando a necessidade de serem implementadas pesquisas de novas metodologias concernentes aos aspectos psicológicos do trabalho.

  5. Reflexiones para proyectar viviendas del siglo XXI

    Directory of Open Access Journals (Sweden)

    Josep María Montaner

    2010-07-01

    Full Text Available El artículo plantea formular una revisión de los criterios de diseño de la vivienda colectiva para el siglo XXI reflejado, fundamentalmente, en que hoy en día existe la conciencia de un cambio social. El texto valora una serie de cuestiones clave: ¿responde la vivienda a la diversidad de la sociedad? ¿Contribuye a mejorar la calidad de la ciudad y el territorio? ¿Se hace un uso razonable de las tecnologías disponibles? ¿Responde a unos objetivos de sostenibilidad? Los parámetros para el diseño de la vivienda en la propuesta planteada parten de la definición de unos criterios básicos que se complementan con una serie de diagramas sobre las relaciones idóneas entre ámbitos de la vivienda y espacios del edificio. Se genera un sistema de valoración integral, formado por 14 + 1 variables imprescindibles, que permite proyectar y evaluar proyectos. En conclusión, la calidad de la vivienda se resuelve tanto en la correcta resolución de su interior, como en su contacto con el espacio público del barrio, mediante una diversidad de gradientes que pasen de lo urbano a lo privado.

  6. Adolfo Celi, um olhar para dois mundos

    Directory of Open Access Journals (Sweden)

    Alessandra Vanucci

    2002-11-01

    Full Text Available O ensaio resgata a vivência brasileira de Adolfo Celi, ator e diretor italiano ativo em cinema e teatro (1922-1986, inserido no laboratório paulista da renovação, na década de 1950. Sua atuação impôs, no palco, o legado texto-cêntrico de Sílvio d'Amico e a utopia do ator plástico de Copeau e, na tela, a estética neo-realista associada a uma atuação fortemente marcada pelo ideário teatral moderno. As intuições, a herança, as oportunidades e as invenções perdidas desta experiência transcultural sugerem um quadro de realização somente parcial do projeto modernizador. Ao entrar na década de 60, é a sensação de ter esgotado um ciclo existencial que fornece a Celi um válido álibi para o retorno. Álibi (1969, seu terceiro e último filme como diretor, realizado na Itália com Gassmann e Lucignani, é um testemunho de vida e memórias, de raiva e de saudade do Brasil; e um precioso guia para entender sua extraordinária ‘aventura americana’.

  7. FUNDAMENTOS COGNITIVOS PARA O ENSINO DA LEITURA

    Directory of Open Access Journals (Sweden)

    Lucilene Bender de Sousa

    2010-01-01

    Full Text Available Neste artigo, revisamos alguns fundamentos teóricos para o ensino da leitura baseados em recentes estudos das neurociências e ciências cognitivas. A leitura, enquanto processo cognitivo, deve ser compreendida em todos os seus níveis de processamento para que o ensino possa identificar e atender às necessidades do aluno. Primeiramente, abordamos o processamento da leitura do nível mais básico, a decodificação, ao nível mais avançado, a compreensão. Em seguida, exploramos funções cognitivas que não são exclusivas da leitura, a memória, a emoção e a aprendizagem. Por fim, propomos uma visão integrada desses processos, considerando a intrínseca relação entre língua, cognição e cultura, a qual permeia todas as nossas atividades, destacando o papel da cultura e da educação no desenvolvimento cognitivo.

  8. Yúmari / Tutuburi: danzar para no morir

    Directory of Open Access Journals (Sweden)

    Ángel Acuña Delgado

    2010-01-01

    Full Text Available Los rarámuri, habitantes de la sierra Tarahumara, al norte de México, tienen en su diversidad dancística una de sus más genuinas formas de expresión y comunicación, danza orientada tanto hacia el culto divino como hacia las relaciones humanas. Apoyado en los datos obtenidos durante los once meses de trabajo de campo entre 2001 y 2005 en varias comunidades rarámuris de la Alta y Baja Tarahumara, centraremos aquí la atención en el yúmari / tutuburi, ritual festivo a la vez que modalidad de danza desarrollada en su transcurso. Tras las referencias históricas iniciales, se describe a continuación el proceso festivo en general y la danza en particular identificada como yúmari / tutuburi; para situarnos finalmente en torno al sentido, tanto en un plano funcional como estructural. Con todo ello destacaremos la importancia que esta manifestación cultural posee para seguir siendo rarámuri dentro del contexto actual.

  9. Una matriz de contabilidad social para Asturias

    Directory of Open Access Journals (Sweden)

    Margarita Argüelles

    2003-01-01

    Full Text Available Una Matriz de Contabilidad Social es un sistema integrado de cuentas que presenta en un cuadro de doble entrada todas las transacciones que tienen lugar en una economía entre sectores productivos, factores de producción, sectores institucionales y resto del mundo. En comparación con una Tabla Input-Output, ofrece una mayor cantidad de información y presenta de forma plena el proceso circular de la renta, captando con mayor precisión los efectos de cambios exógenos. Una de las principales utilidades de una Matriz de Contabilidad Social es servir como base de datos para el desarrollo y aplicación de un modelo de equilibrio general computable. Este es, precisamente, el objetivo último que se persigue con la elaboración de la Matriz de Contabilidad Social de la economía asturiana que aquí se presenta. Esta Matriz ha sido construida con datos procedentes de las Cuentas Regionales de Asturias correspondientes al año 1995 y su estructura se ha adaptado a su futura utilización como base de datos para el modelo que se pretende aplicar en esta economía regional.

  10. Centro para reuniones, en Karpfenberg, Estiria (Austria

    Directory of Open Access Journals (Sweden)

    Windbrechtinger, W.

    1965-03-01

    Full Text Available The building bas two wings. One of them has two storeys, and a semibasement, and is used as offices. The other wing has a single floor level, and constitutes the Meeting Hall. On entering there is a kind of forecourt, and behind the meeting hall there is a further court, which on special occasions could also be utilized for large meetings. Amusement rooms for television and card and other games are provided in the semibasement: also a photographic laboratory, games stores, washing and boiler room. The ground floor contains the municipal library, a number of offices (an insurance company, the workers' chamber, and the association of nature's friends and rooms for the meetings of political organisations. On the second floor the syndicates have their offices, which include board room, a teaching room, three rooms for guests, the doorman's living quarters, and the necessary services. Finally, the meeting hall section involves a vestibule, the hall itself with accommodation for 300 people, a stage, cafeteria, kitchen, and other auxiliary facilities. The design of this building is rational and straightforward, and is pleasantly in keeping with the surrounding buildings and landscape.El edificio consta de dos alas: una, con dos plantas—destinadas a oficinas—y semisótano; y otra, de una sola planta, en la que está situada la sala de reuniones. Visto el conjunto desde la entrada, aparece una especie de patio delantero, dejando, detrás de la sala, un segundo patio, susceptible de ser utilizado en casos especiales, tales como grandes reuniones, etc. El semisótano agrupa las salas de esparcimiento—juego, televisión, trabajos para entretenimiento—, laboratorio fotográfico y cámara oscura, locales para guardar los utensilios de deporte, aseos, almacén y cuarto de la calefacción. La planta baja contiene la biblioteca municipal, varias oficinas— de una sociedad de seguros, de la cámara de trabajadores, de la asociación de amigos de la

  11. Estrategia para elevar la motivación laboral; factor imprescindible para mejorar nuestra productividad.

    Directory of Open Access Journals (Sweden)

    Reina de los Ángeles Carballé Piñón

    2015-12-01

    Full Text Available Este trabajo "Estrategia para elevar la motivación laboral; factor imprescindible para mejorar nuestra productividad" resulta de la investigación realizada para tesis de maestría; se realizó el estudio de 2 entidades, nos permitió conocer las principales posiciones que sobre motivación existen, factores que la influencian, cómo incide en el desempeño laboral y que acciones diseñar para elevarla. Las 2 entidades seleccionadas, claves en el desempeño empresarial son un centro de interfase y un centro generador de conocimientos, nuestro objetivo principal es sugerir propuestas que eleven la motivación de los trabajadores del CIGET(centro de interfase y la Universidad de Sancti Spíritus(centro generador de conocimientos por desempeñar una mejor labor y lograr así aumento de la eficacia, eficiencia y productividad; este se concreta específicamente en determinar qué factores ocasionan desmotivación en los trabajadores del CIGET y la Universidad, identificar aquellos factores que realmente motivan a estas personas, de manera individual como colectivamente y trazar una estrategia con el objetivo de elevar la motivación de los trabajadores hacia la actividad que realizan y dotar a estos de herramientas para la identificación de actitudes positivas o negativas en el ámbito laboral y cómo potenciarlas o minimizarlas según sea el caso.

  12. Puente mixto para ferrocarril y carretera

    Directory of Open Access Journals (Sweden)

    Harris, P. C.

    1963-10-01

    Full Text Available This new bridge, known as the West Branch, spans the course of a river, and has a double function and two superimposed decks. One of these carries the road, and the other lower one, the railway line. It has been constructed by the Dept. of Public Works of California. The structure consists of four main spans resting on reinforced concrete piles, of great height. Four rectangular holes run down their centres. The decks consist of a continuous metal framework, made up of heavy elements, some of them weighing up to 56 tons each, was assembled in the workshop in separate sections. These were then transported to the site, to be integrated within the whole structure. In the final assembly high tensile steel bolts were employed. As the piles are very high, they are of varying cross section, according to the height. The concreting was done by means of sliding formwork, and this was sufficiently wide to ensure that the concrete was at least four hours old when the formwork passed beyond its level. To carry out these operations an auxiliary tower was built up. which supported the framework carrying the concreting tub and its pouring mechanism. From this main tub the concrete was poured into others, which placed it into the various parts of the formwork. The operation of the concrete elevator, whose motive power was provided by of the plant at ground level, was controlled by telephone between the operator of the power plant and the person responsible for distributing the concrete on the top platform. To provide the finish of the surfaces left by the sliding formwork, another platform was installed, working at a level below the lower edge of the formwork, and a similar arrangement was adopted with respect to the inner formwork for the four hollows running inside the piles.El nuevo puente, llamado West Branch, que salva el profundo cauce de un río, tiene una doble finalidad y dos tableros superpuestos: uno para carretera en la parte superior y otro para una

  13. Método para mejorar la tolerancia a la salinidad

    OpenAIRE

    Navarro-Aviñó, Juan; López Moya, José Rafael

    2007-01-01

    Método para mejorar la tolerancia a la salinidad. La presente invención se refiere a un método específico para mejorar la tolerancia a la salinidad de organismos vivos y eliminar el sodio (Na+) de aguas, suelos, lodos y cualquier otro medio que contenga este elemento, basado en el empleo de la secuencia aislada de un ácido nucleico que codifica para la fitoquelatina sintasa de Nicotiana glauca.

  14. Nave para Volkswagen en Ravenna, Italia

    Directory of Open Access Journals (Sweden)

    Epaminonda, Ceccarelli

    1965-09-01

    Full Text Available This factory hall is meant to house an exhibition, workshops, stores and offices of the Italian subsidiary of the Volkswagen firm. It is sited in an urbanized, but not yet built up, area. Its ground area is 54 by 38 m. Part of the frontage, about 36 m, is set back 8 m with respect to the remaining 18 m; the latter correspond to the part of the building occupied by the exhibition hall. As the ground is weak, it has been necessary to use piles to support the foundations. The structure is metallic, and the enclosing walls and roof consist of prefabricated panels and metals sheets. The roof contains a special chamber, where the air conditioning ducts and other services are housed. Great care has been taken over the colour patterns, both inside and outside. The type of structure and use of prefabricated panels has greatly lowered the overall cost of the building. All the foundation elements have been suitable waterproofed.Esta nave industrial está destinada a albergar los servicios de exposición, talleres, depósito y oficinas para la empresa concesionaria, en Italia, de la marca de automóviles Volkswagen. Se halla situada en una zona urbanizada, pero sin edificar, y tiene 54x38 m en planta. Parte de la fachada principal—unos 36 m—está retranqueada 8 m respecto de la alineación; los 18 m restantes corresponden al salón de exposiciones. Como el terreno es de escasa capacidad de sustentación, ha sido necesario el empleo de pilotes en los puntos de apoyo. La estructura resistente es metálica y se ha cerrado y cubierto con paneles prefabricados y placas metálicas. Los forjados de cubierta tienen una cámara que permite la colocación de conductos para el acondicionamiento. Se han cuidado mucho los colores para la estructura vista y paramentos interiores. La disposición de la estructura y el empleo de paneles prefabricados han permitido obtener costos muy favorables. Todas las partes de la infraestructura han sido debidamente

  15. En busca de los recursos para su proyecto

    OpenAIRE

    Coto, Elizabeth

    2011-01-01

    Para buscar recursos para desarrollar un proyecto es preciso estar capacitado en tres fases: inicio, diseño del proyecto y preparación de la propuesta. Cualquier trabajo en cada una de las fases enunciadas debe ser de muy buena calidad ya que el proceso de búsqueda de recursos es altamente competitvo. Se presenta en este artículo, para cada una de las fases, una lista de recomendaciones muy concretas tendientes a que los investigadores progresen en su habilidad para conseguir los recursos ext...

  16. Taller de aprendizaje Cooperativo para ingeniería

    OpenAIRE

    Sancho Saiz, Javier

    2012-01-01

    Se presentan herramientas y material de apoyo para aplicar la metodología de aprendizaje cooperativo en la docencia universitaria, con una orientación especial a ingeniería. Apuntes de un curso de aprendizaje cooperativo para ingeniería realizado en la EUI de Vitoria-Gasteiz, en el que se señalan las técnicas grupales más adecuadas para desarrollar en los alumnos la capacidad de trabajo en equipo para resolver sistemáticamente problemas o situaciones complejas.

  17. Ortesis para amortiguación de temblor

    OpenAIRE

    Pons Rovira, José Luis; Rocon, Eduardo; Loureiro, Rui; Belda-Lois, J. M.; Lawrence, Normie

    2007-01-01

    Ortesis para amortiguación de temblor. El objeto de esta invención es un dispositivo ortésico portátil que es compacto y no invasivo. El dispositivo ortésico es de utilidad para el amortiguamiento del temblor y comprende: Un sustrato o sistema de soporte para fijar el dispositivo al miembro superior que comprende una parte distal y una parte proximal. Al menos un sensor unido al sustrato para medir el movimiento del miembro y generar una señal sensorial. Al menos un actuador ancl...

  18. Toma de muestras para el cultivo microbiológico

    OpenAIRE

    Padrós Sánchez, Carolina

    2010-01-01

    La toma de muestras para su análisis microbiológico es un paso esencial para un correcto diagnostico y tratamiento de las infecciones que pueden afectar a la piel, tejido celular subcutáneo o musculo. Sin embargo hay que tener en cuenta que el análisis microbiológico de la lesión se debe reservar para aquellos casos en los que se sospeche una infección localizada o sistémica. Se analizan en este apartado las diferentes metodologías empleadas para la toma de muestras, explicando la metodología...

  19. Garaje para la Universidad de California

    Directory of Open Access Journals (Sweden)

    Lin, T. Y.

    1964-06-01

    Full Text Available California University has constructed a two storey garage, with a prestressed concrete structure, at Berkeley. A particular feature of this building is that on the roof a soil layer, 0.45 cm in depth, has been laid, on which there is a grass lawn. The structure consists of a framework of beams, of 7.30 m span, in one direction, and 19 m in the other: this being the maximum separation of the columns in one elevation. Consequently the flooring is made of slabs spanning the shorter 7.30 m distance. The roof slab has been prestressed in two mutually perpendicular directions, hence it is practically impossible for it to develop cracks. This arrangement renders the slab watertight and implies a saving in the cost of applying waterproofing treatment. As the building is surrounded on three sides by three contention walls, advantage has been taken of this to transmit to these the horizontal thrusts due to windage and seismic forces. Most of the structural elements, excepting the flooring, have been prestressed and prefabricated at a workshop 80 Km. away from the site. Many of the constructional units have additional reinforcement, which can be post-tensioned after erection at the working site.La Universidad de California ha construido un garaje, de dos plantas, de hormigón pretensado, en Berkeley, que presenta la particularidad de utilizar la parte superior de su cubierta para colocar sobre ella una capa de tierra, de 0,45 metros de espesor, coronada por un manto de césped. La estructura resistente está constituida por un reticulado de vigas formando crujías de 7,30 m de luz y apoyos espaciados a 19 m. Por tanto, las losas que forman los forjados salvan una, luz de 7,30 m, mientras que las vigas forman pórticos de 19 m de luz máxima. La losa de cubierta se ha pretensado en dos direcciones normales entre sí y, como consecuencia de ello, al hallarse debidamente comprimida en el sentido de estas dos direcciones es prácticamente imposible la

  20. Método para eventos Gembra kaizen

    OpenAIRE

    Hornburg, Sigfrid

    2009-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção. A Manufatura Enxuta está baseada nas práticas do Sistema Toyota de Produção. O principal objetivo deste é reduzir e eliminar perdas a fim de deixar a organização mais ágil e flexível, conseqüentemente mais competitiva. É importante deixar claro que para a implantação das práticas de chão de fábrica da Manufatura Enxuta é necessário um sistema de gestão d...

  1. De las motivaciones para escribir historia local

    Directory of Open Access Journals (Sweden)

    Oscar Londoño Pineda

    2009-01-01

    Full Text Available El presente ensayo ofrece, a partir de la experiencia investigativa del autor y su contacto con la comunidad del municipio de Tuluá (Valle del Cauca, un balance sobre el potencial de motivaciones que se originan al escribir historias locales. El autor considera relevante las motivaciones de orden personal o familiar, las de carácter reivindicativo en torno a personajes o hechos históricos que forman parte de la memoria de una comunidad y las de orden emocional y social. Finalmente la historia local es vista por el autor como una práctica de gran utilidad para la enseñanza y aprendizaje a partir de las realidades locales.

  2. Recomendaciones para una lactancia materna exitosa

    OpenAIRE

    María Elena Ortega-Ramírez

    2015-01-01

    La lactancia materna es la única manera de proporcionar los nutrientes ideales para el adecuado crecimiento y desarrollo de los niños y las niñas. Es el único alimento que tiene una influencia biológica y emocional sobre la salud de la madre y su hijo. La lactancia materna protege a los lactantes de enfermedades gracias a sus propiedades antiinfecciosas, además de que es de más fácil digestión por la menor cantidad de caseína. No contiene betalactoglobulina, que es la proteína que más frecuen...

  3. Educar para a conexão

    OpenAIRE

    Silva, Vera Lúcia de Souza e, 1964-

    2003-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção. Educar para a conexão prevê que se trabalhe em sala de aula as dimensões de conexão do ser aprendente com ele mesmo, com o outro e com a natureza planetária e cósmica. Nesta concepção holística de educar, baseada no Paradigma Emergente de Ciência e Educação, o aprendente é conduzido a entrar em contato com os fundamentos de aprender a conhecer, a fazer, a ser ...

  4. NUEVAS CITAS DE ASCLEPIADACEAE PARA ARGENTINA

    Directory of Open Access Journals (Sweden)

    Sergio A Cáceres Moral

    2010-11-01

    Full Text Available Dos especies no mencionadas anteriormente de la Argentina son tratadas e ilustradas: Oxypetalum molle Hook. et Arn. y Oxypetalum ineanum Fourn. Oxypetalum appendieulatum Mart. et Zucc., Oxypetalum confusum Malme, Oxypetalum jörgensenii Meyer, Oxypetalum microphyllum Hook. et Arn., Oxypetalum pannosum Decaisne, Oxypetalum stipatum Malme, Funastrum flavum (Decaisne Malme y Blepharodon lineare (Decaisne Decaisne se registran por primera vez para la flora de Corrientes ..

  5. Escuela para señoritas, Inglaterra

    Directory of Open Access Journals (Sweden)

    Stillman y Eastwlck-Field, Arquitectos

    1963-02-01

    Full Text Available The object was to design part of a new building which had been seriously damaged during the war, so that the old and new parts would blend into a pleasant whole, with a capacity for 600 girls. The new designs avoid the glass box style of school buildings, and glass walls have been adopted only on the ground floor, thus giving an impression of light and airiness to what used to be a partial basement. Classrooms have been designed in a simple manner, and give the impression of conventional rooms. Simple lines and materials have been chosen throughout. Strong contrasts in the external finish have been avoided, and colours provide a relaxing background to the intensive activities of the students. A constructional feature is the use of prefabricated concrete joists and supports. Outer walls consist of brick panels filling in the space between the visible concrete framework. Ceilings are of insulating boards, and the floors are covered with linoleum. Special attention has been devoted to the hall. In this case the roof is of white gypsum, and the only features are the grills covering the fluorescent lighting. The walls of this hall are of glass, and are covered with heavy velvet curtains. A balcony with hardwood posts adds a simple and friendly feature to the building. The furniture and drapery have been carefully chosen. Camden school has a rigid tradition of individualism and fine education, and the new building has succeeded in maintaining the exclusive quality of the older parts, as well as offering an overall impression of up to date construction.El problema consistía en proyectar un nuevo núcleo para un edificio que había sido seriamente bombardeado durante la guerra, de tal modo que las partes antiguas y nuevas formasen un conjunto agradable y con capacidad para más de 600 chicas. En la nueva construcción se ha evitado el carácter de «cajas de cristal» de las nuevas escuelas ordinarias y se han empleado muros de cristal solamente en la

  6. Normas para colaboração

    OpenAIRE

    Helmut Renders

    2009-01-01

    A Caminhando é uma revista acadêmica publicada semestralmentepela Faculdade de Teologia da Universidade Metodista de São Paulo. Ela está aberta para pesquisadores/as e docentes/as da área da Teologia e das Ciências da Religião que possuam o grau de doutor ou mestre ou estejam prestes a obtê-lo.Apresentação de artigosO texto poderá ter no máximo 25.000 caracteres com espaços (digitadas em espaço duplo, fonte Times New Roman Times 12 ou equivalente, margem 2,5 cm) incluindo-se notas e bibliogra...

  7. Caso para diagnóstico

    Directory of Open Access Journals (Sweden)

    Souza Fernanda H. M. de

    2006-01-01

    Full Text Available Pseudoxantoma elástico perfurante periumbilical é distúrbio adquirido do tecido elástico, que acomete mulheres multíparas. Apresenta-se um caso dessa condição em mulher de 74 anos (G10, P10 mostrando placa amarelada de aspecto reticular com áreas constituídas por pápulas eritêmato-ceratósicas. A histologia demonstra derme reticular com fibras conjuntivas basofílicas e irregulares, além de área de hiperplasia epidérmica, com eliminação de fibras elásticas através de canal repleto de ceratina.

  8. Fomento de responsabilidad procreativa para adolescentes

    Directory of Open Access Journals (Sweden)

    Vanegas de Ahogado Blanca Cecilia

    1995-12-01

    Full Text Available

    Se está desarrollando una línea de investigación-Docencia-Extensión que pretende, con medidas de promoción y prevención primaria, fomentar en los adolescentes un manejo responsable de su sexualidad, para contribuir en la disminución del embarazo indeseado y del aborto provocado. El trabajo se inició con un programa de atención individual y de pareja en una importante universidad colombiana; continuó con un programa de educación a grupos, utilizando técnica participativa con juegos de salón, diseñados por las investigadoras, y ha tenido aplicabilidad con estudiantes de nivel secundario, universitario, de postgrado y profesionales en educación continua. Ha sido apoyado por cuatro investigaciones.

  9. Diretrizes curriculares para o curso de pedagogia

    OpenAIRE

    Vieira. Suzane da Rocha

    2007-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Educação. Programa de Pós-Graduação em Educação. Este trabalho discute as Diretrizes Curriculares Nacionais para o Curso de Pedagogia # Resolução CNE/CP n. 1/06 (BRASIL, 2006b) # expedidas em 15 de maio de 2006. O estudo se articula às pesquisas dedicadas à reforma da formação inicial de professores da Educação Básica, implementada durante os anos de 1990, em especial após a Lei n. 9394/96 (BRASIL, 1996...

  10. Yoga para crianças

    OpenAIRE

    Maria Ester Massola

    2012-01-01

    As crianças nascem em uma época de grandes mudanças, tudo parece instantâneo. No mundo externo tudo se transforma rapidamente, mas em nosso mundo interior, o ritmo é outro. Necessitamos desenvolver a observação e o olhar interno, para nos relacionarmos de forma mais equilibrada e saudável com nós mesmos e com os outros. Ensinar crianças e adolescentes a relaxar, a meditar, a gostar de permanecer um pouco em silêncio, a cuidar tanto de si como dos outros, a acalmar o corpo e a mente é sem dúvi...

  11. Consejos y propuestas para un envejecimiento satisfactorio

    Directory of Open Access Journals (Sweden)

    María Guillermina Yanes García

    2011-08-01

    Full Text Available Se presenta un manual que aborda el tema de la ancianidad haciendo énfasis en orientaciones relacionadas fundamentalmente con aspectos que contribuyan al desarrollo de aquellas aristas del sujeto que enriquecen su espiritualidad y vida emocional, tales como habilidades comunicativas y de convivencia, mejoramiento de la imagen de sí mismo, autoestima y motivaciones, entre otros aspectos que de hecho intervienen en el equilibrio del proceso salud enfermedad. Incluye temáticas identificadas por los propios adultos mayores como constitutivas de sus problemas de salud, pero teniendo también en cuenta las acciones y soluciones propuestas ante dichas problemáticas, con el objetivo de abrir horizontes de crecimiento y desarrollo que permitan mejorar la capacidad de los adultos mayores para enfrentar los problemas de aceptar y adaptarse a lo que les toca vivir.

  12. Cuatro preguntas para iniciarse en cambio organizacional

    Directory of Open Access Journals (Sweden)

    Carlos A. Acosta R.

    2002-01-01

    Full Text Available El presente artículo llega a un concepto sobre el cambio organizacional a partir de las respuestas que ofrece a cuatro preguntas: ¿Qué es lo que cambia en las organizaciones?, ¿Por qué cambian las organizaciones?, ¿Cómo cambian las organizaciones? y -entonces- ¿Qué es el cambio organizacional? Para lograr el propósito se toma como objeto a las organizaciones empresariales y se centra en las dimensiones donde se localizan los cambios, explora lo que algunos autores dicen sobre el cambio, revisa varias propuestas sobre las razones que llevan al cambio en las organizaciones, expone las modalidades en que cambian las organizaciones y, finalmente, como inferencia de lo expuesto, concluye en un concepto de cambio organizacional

  13. CUATRO PREGUNTAS PARA INICIARSE EN CAMBIO ORGANIZACIONAL

    Directory of Open Access Journals (Sweden)

    Carlos Acosta

    2002-07-01

    Full Text Available El presente artículo llega a un concepto sobre el cambio organizacional a partir de las respuestas que ofrece a cuatro preguntas: ¿Qué es lo que cambia en las organizaciones?, ¿Por qué cambian las organizaciones?, ¿Cómo cambian las organizaciones? y -entonces- ¿Qué es el cambio organizacional? Para lograr el propósito se toma como objeto a las organizaciones empresariales y se centra en las dimensiones donde se localizan los cambios, explora lo que algunos autores dicen sobre el cambio, revisa varias propuestas sobre las razones que llevan al cambio en las organizaciones, expone las modalidades en que cambian las organizaciones y, finalmente, como inferencia de lo expuesto, concluye en un concepto de cambio organizacional.

  14. Instrucciones para un coleccionista de mariposas

    OpenAIRE

    Perez, Mariana Eva

    2014-01-01

    Obra de Teatro escrita para el ciclo 2002 de Teatroxlaidentidad (Txi). Se estrenó en el Teatro del Pueblo (Buenos Aires), con dirección de Leonor Manso, asesoramiento dramatúrgico de Patricia Zangaro, actuación de María Figueras, asistencia de dirección de Lala Mendía, diseño de luces de Héctor Calmet y realización de objeto (mariposa) de Alberto Negrín. Sobre la puesta de Leonor Manso y con dirección de Lala Mendía, se realizaron funciones en distintas salas de Buenos Aires en 2005 y 2006, s...

  15. Una reforma constitucional para la periferia europea

    Directory of Open Access Journals (Sweden)

    Gerardo Pissarello

    2011-01-01

    Full Text Available La intempestiva reforma del artículo 135 de la Constitución española puede leerse como una expresión más de la erosión en Europa de los elementos garantistas del constitucionalismo de posguerra. Tanto por su contenido como por el procedimiento empleado para acometerla, su aprobación aparece reñida con principios constitucionales básicos, como el democrático, el del Estado social o el de la autonomía territorial. Asimismo, supone un golpe a la legitimidad global de la Constitución cuya reversibilidad no será sencilla.

  16. Accesibilidad digital para usuarios con limitaciones visuales

    Directory of Open Access Journals (Sweden)

    Toledo, Gabriela Alejandra

    2013-04-01

    Full Text Available El presente trabajo persigue como objetivos: recapitular y analizar los principios básicos de diseño para el desarrollo de tecnologías inclusivas; evaluar ventajas y desventajas en el uso del programa lector de pantalla (JAWS al acceder a entornos comunicacionales, desde las variables de navegabilidad, interoperabilidad, usabilidad y colaboración en la cognición; derivar sugerencias acerca del diseño de entornos de aprendizaje colaborativo, de modo de lograr una mayor efectividad de esta herramienta digital, aplicada a personas con limitaciones en la visión en diverso grado; redactar un manual complementario de orientaciones que facilite el uso de este instrumento inclusivo, aplicado a entornos de enseñanza/ aprendizaje colaborativo.

  17. Dispositivos de descarga de cisternas para inodoros

    Directory of Open Access Journals (Sweden)

    Laorden, José

    1960-06-01

    Full Text Available Not availableSe describe el fundamento de los dispositivos de descarga de las cisternas para inodoros y se dan las características y comportamiento de once tipos de los que usualmente se emplean en España; así como un Pliego de Condiciones mínimas de estos aparatos, deducido de los ensayos realizados en el I.T.C.C. En este Pliego de Condiciones mínimas se marcan tres categorías según la calidad del aparato. No se incluyen los fluxómetros en el presente artículo, aunque se hace una rápida mención de ellos.

  18. Un sistema de saneamiento para Madrid

    Directory of Open Access Journals (Sweden)

    Sánchez, Félix Cristóbal

    1986-03-01

    Full Text Available The Full Sanitation Plan for Madrid is the final action of a series undertaken for several years with the purpose to reach the completion of the sanitation system of the town. With the whole of these actions it could be said that the basic substructure has acquired enough level to deserve de real needs of the town.El Plan de Saneamiento Integral de Madrid representaba la culminación de una serie de acciones emprendidas, durante varios años, para conseguir que la ciudad completase su sistema de saneamiento. Con este conjunto de acciones comprendidas en el Plan puede decirse que esta infraestructura básica ha adquirido un nivel suficiente, capaz de prestar un servicio acorde con las auténticas necesidades de la Villa.

  19. Normas para colaboração

    Directory of Open Access Journals (Sweden)

    Helmut Renders

    2009-10-01

    Full Text Available A Caminhando é uma revista acadêmica publicada semestralmentepela Faculdade de Teologia da Universidade Metodista de São Paulo. Ela está aberta para pesquisadores/as e docentes/as da área da Teologia e das Ciências da Religião que possuam o grau de doutor ou mestre ou estejam prestes a obtê-lo.Apresentação de artigosO texto poderá ter no máximo 25.000 caracteres com espaços (digitadas em espaço duplo, fonte Times New Roman Times 12 ou equivalente, margem 2,5 cm incluindo-se notas e bibliografia. Os artigos submetidos à revista Caminhando deverão ser nacionalmente inéditos e não estar, no momento, sendo objeto de apreciação por quaisquer outros meios de publicação impressa. A página de rosto deverá conter o título do artigo,nome do autor, um resumo em português e, se for possível, também em inglês e espanhol (no máximo 250 caracteres com espaços. Como informações sobre o/a autor/a solicitamos a titulação, a ocupação e o e-mail do/ a autor/a. Os artigos serão encaminhados para um/a parecerista, com basenos quais o editor tomará a sua decisão. A remessa do artigo poderá ser feita via Internet para o e-mail helmut.renders@metodista.br, ou em CD enviado pelo correio para o endereço: Universidade Metodista – Faculdade de Teologia Helmut Renders, Editor da Revista Caminhando – Prédio Alfa – Sala 222 – Rua do Sacramento, 230 – 09640-000, São Bernardo do Campo/SP, Brasil.Normas para rodapé e referências bibliográficasAs citações devem ser inseridas no corpo do texto, seguindo as formas(Autor, ano ou (Autor, ano, página como no exemplo (WEBER, 1991, p. 95.Se houver, do mesmo autor, mais do que um título citado, deve-se acrescentar uma letra após a data, tal como no exemplo: (WEBER, 1991b, p. 32. As notas de rodapé estão reservadas para informações complementares.A bibliografia ou referências bibliográficas, quando houverem, devemser colocadas no final do texto e obedecer à norma NBR 6023

  20. El Cultivo de Lino para Fibra

    Directory of Open Access Journals (Sweden)

    Gazzani Cisneros L. Fernando

    1941-08-01

    Full Text Available Los cultivos de Lino practicados con el fin de obtener plantas de donde extraer la fibra correspondiente, fueron iniciados técnicamente por el suscrito a principios del año 1934. Antes de esa fecha se habían realizado ensayos esporádicos y aislados, algunos de relativa importancia, en cuanto a superficie sembrada, en diversas zonas del país, especialmente en la región de la sierra. Esos primeros ensayos de extracción y manipulación de los tallos, no obtuvieron el éxito deseado, debido a variados factores. Fueron ensayos sometidos a la iniciativa particular y que tropezaron con muchas dificultades; unas de orden técnico y otras de orden económico. Pero en cambio ellos no dejaron ver una serie de posibilidades y la certeza de una futura y nueva industria básica en la economía nacional. No me refiero a cultivos de Lino para grano, pues estos datan de antiguo entre nosotros y se practican con regulares resultados en diversas regiones, especialmente de nuestra sierra. Son cultivos practicados sin ningún tecnicismo, no encontrando grandes dificultades en el orden cultural y de desgrane, producció!1 de semilla; (linaza. Como todo primer ensayo, era necesario que el Estado fuera el encargado de afrontar y realizar los estudios y encontrar al mismo tiempo la forma de llevarlos más tarde al campo de la práctica, basados en principios técnicos que los hicieran factibles con éxito y redundaran en provecho de los sembradores. Fue como repito, a principios del mes de junio del año 1934, en la "Estación Experimental Agrícola de la Molina", cuando inició diferentes cultivos experimentales con semillas procedentes de nuestros valles de la sierra. Se practicaron diversas épocas de siembras, "densidades de población" (cantidad de semilla por unidad de superficie, "sistema de siembras" (en líneas o surcos-y voleo en melgas, así como también de "abonamiento": acción de las sales de potasa sobre las cualidades de la fibra

  1. ANÁLISIS DE LAS COMPETENCIAS NECESARIAS PARA UN BACHILLERATO GENERAL EN RECREACIÓN PARA COSTA RICA

    OpenAIRE

    Salazar Salas, Carmen Grace

    2002-01-01

    Los objetivos de este artículo son: 1. presentar los resultados de un estudio realizado para determinar el perfil profesional necesario para un bachillerato general en recreación de la Universidad de Costa Rica y 2. justificar la importancia de dicho bachillerato por medio de la revisión de literatura. El propósito del estudio fue determinar cuáles eran las competencias necesarias para el perfil profesional de un plan de estudios de un bachillerato general en recreación para que sea ofrecido ...

  2. ANÁLISIS DE LAS COMPETENCIAS NECESARIAS PARA UN BACHILLERATO GENERAL EN RECREACIÓN PARA COSTA RICA

    OpenAIRE

    Carmen Grace Salazar Salas

    2002-01-01

    Los objetivos de este artículo son: 1. presentar los resultados de un estudio realizado para determinar el perfil profesional necesario para un bachillerato general en recreación de la Universidad de Costa Rica y 2. justificar la importancia de dicho bachillerato por medio de la revisión de literatura. El propósito del estudio fue determinar cuáles eran las competencias necesarias para el perfil profesional de un plan de estudios de un bachillerato general en recreación para que sea ofrecido ...

  3. Marco normativo para la vivienda de interés prioritario: alternativas para la política de vivienda

    OpenAIRE

    Orjuela Martínez, Guillermo

    2014-01-01

    Garantizar el acceso efectivo a una vivienda digna o adecuada para los hogares que perciben menores ingresos, y especialmente para aquellos que reciben menos de dos smlmv, representa una de las obligaciones del Estado, para lograr así mejorar de forma continua las condiciones de vida de la población. Con este trabajo se abordan, desde una perspectiva jurídica, los instrumentos empleados para garantizar el acceso a una vivienda social y su incidencia en la configuración de los aspectos que det...

  4. Morelos A-2010, nueva variedad de arroz para siembra directa para el centro de México

    OpenAIRE

    Jorge Salcedo Aceves; Edwin Javier Barrios Gómez

    2012-01-01

    En la zona central de México se siembra el arroz (Oryza sativa L.) en trasplante y directa bajo riego; la mayoría de las variedades se han liberado para trasplante; sin embargo, al usarlas para siembra directa tienen el problema del acame. En 1998 se inicio el mejoramiento del arroz por inducción de mutaciones con el objetivo de obtener una variedad para siembra directa. Para esto, se irradiaron 200 gramos de semilla de la variedad Morelos A-92, en la fuente Gammacell 220 del Instituto Nacion...

  5. Composites de bagazo de baja densidad para partes y piezas moldeadas para la industria automotriz

    Directory of Open Access Journals (Sweden)

    Manuel Serantes

    2006-01-01

    Full Text Available Se desarrolló un composite a partir del bagazo de la caña de azúcar, con características similares a una muestra entregada por la firma FAIST GmbH& Co. K.G. de Alemania, para ser empleado en la elaboración de partes y piezas moldeadas para la industria automotriz. Se estudian diferentes grados de molida. A los composites obtenidos se le determinaron las propiedades físico-mecánicas. Se realizó un análisis visual de su aspecto físico. Se presentan los resultados obtenidos, así como conclusiones y recomendaciones.

  6. La reforma esperada: una educación para todos y para cada uno de ellos

    OpenAIRE

    Barrientos Mollo, Roberto

    2008-01-01

    El presente trabajo sustenta la posibilidad de las reformas a gran escala. Reformas sostenibles y con resultados drásticos en una legislatura. Para lo cual son necesarias dos condiciones. En primer lugar que todos los ciudadanos se unan en torno a un sueño común o propósito moral, y en segundo lugar una sólida y dinámica teoría de la acción para el cambio del sistema, dicha teoría viene a ser un conjunto de elementos guía de las acciones a nivel de sistema. Presenta dos casos de reformas ex...

  7. Modelo para la implementación de controles internos para empresas constructoras.

    OpenAIRE

    Choez Chiquito, Wilton Antonio

    2015-01-01

    La presente investigación se refiere al tema Metodología para la implementación de nuevos métodos de Control para las empresas de construcción en el Ecuador. Donde las características principales de este sector ha sido su rápido crecimiento en las últimas dos décadas, con un alto número de trabajadores de obras con bajo o ningún nivel de educación, falta de compromiso por parte de los empleados de obra por el alto nivel de rotación que puede existir debido a que las construcciones son por per...

  8. Algunas consideraciones para la reconstrucción del concepto de contabilidad para el presente siglo

    Directory of Open Access Journals (Sweden)

    Claudia Lucía Niño Galeano

    2003-06-01

    Full Text Available En este artículo se hace una reflexión sobre la posición de la contabilidad en el contexto actual, rescatando de manera general su evolución como disciplina y su transformación permanente. A partir de diversas definiciones sobre contabilidad se intenta resaltar los elementos que la determinan como disciplina y sus contenidos, los cuales deben responder o vincularse aún más con la realidad económica actual, caracterizada por la globalización y el impacto de los mercados financieros internacionales. En este contexto, la contabilidad debe ser flexible, tener la capacidad para responder en forma rápida a los cambios del entorno económico y tener las cualidades necesarias para informar objetivamente a los interesados.

  9. CRITERIOS PARA LA ELABORACIÓN DE MAPAS DE PROCESOS. PARTICULARIDADES PARA LOS SERVICIOS HOSPITALARIOS

    Directory of Open Access Journals (Sweden)

    Dianelys Nogueira Rivera

    2009-05-01

    Full Text Available

    Para responder a las necesidades de un entorno cambiante, se hace necesario  modificar el funcionamiento de las organizaciones, o sea, sus procesos. Ya no se piensa en diseños con una estructura inmutable con el paso de los años, sino permanentemente sometidos a revisiones, en virtud de que cada proceso de por sí es mejorable. Actualmente, las instituciones de salud luchan por incorporar herramientas y modelos de gestión como: Benchmarking, Gestión por Procesos o Reingeniería e intentan generalizar la revisión de los procesos como una práctica sistemática, que a la vez forme parte de la cultura médica. Como base para la mejora, es extendido el uso de los mapas de procesos que, a partir de varios enfoques, permiten la visualización y apreciación de las interrelaciones entre los procesos, y actividades para perfeccionar los resultados que los clientes desean. Este trabajo propone un procedimiento para la elaboración de mapas de procesos de servicios hospitalarios, a partir del análisis bibliográfico y la evaluación en la práctica social.

  10. “Sexo pelo sexo” para homens e “sexo por amor” para mulheres

    Directory of Open Access Journals (Sweden)

    Luciana Zucco

    2012-04-01

    Full Text Available

     O presente trabalho analisa os discursos sobre sexo veiculados por revistas femininas e masculinas. Estudos anteriores constataram que aos avanços da condição feminina na sociedade ocidental somam-se modelos reificadores de uma ideologia normatizante das relações sexuais.  A hipótese é de que as revistas também reproduzem discursos diferenciados para homens e mulheres, reafirmando o sexismo cultural (MORAES, 2002. Foram analisadas as reportagens sobre sexo anunciadas nas capas de Nova e Men’s Health, em 2007, com base na análise de discurso (ORLANDI, 2001. Men’s Health  se dirige ao público masculino através de um discurso direto e objetivo, uma vez que sexo é culturalmente considerado “coisa de homem”.  Nova apresenta enunciados de promoção da autonomia sexual, revisitando velhos discursos. Apesar de os magazines apresentarem a lógica do sex machine  (CATONNÉ, 2001, as diferenças situam-se entre: ter prazer para conquistar e dar prazer
    para multiplicá-lo.

  11. Treinamento introdutório para enfermeiras dirigentes: possibilidades para gestão do SUS

    Directory of Open Access Journals (Sweden)

    Marisa Leal Correia Melo

    2003-12-01

    Full Text Available Este artigo enfoca o Treinamento Introdutório como marco inicial do processo de capacitação para os integrantes do Sistema Único de Saúde. Toma como premissa que a prática gerencial requer a apreensão de um corpo de conhecimento presente nos micro e macro espaços de trabalho dos dirigentes. Ao articular o Treinamento Introdutório com a área de gerência, o considera estratégico para enfermeiras que assumem cargos de direção, ao constituir-se num espaço que pode oportunizar o desenvolvimento de competência técnica, administrativa, ética e política para o exercício do cargo. No plano organizativo, o Treinamento Introdutório deve ser planejado e implementado de forma participativa e democrática, a fim de permitir ao dirigente uma compreensão ampliada do contexto em que está se inserindo.

  12. VALIDACIÓN DE UN MODELO MATEMÁTICO PARA LA CALIBRACIÓN DE FRENÓMETROS PARA MOTOCICLETAS Y PARA VEHÍCULOS LIVIANOS

    OpenAIRE

    Solano Sánchez, Paula Raquel

    2011-01-01

    Los frenómetros para motocicletas y vehículos livianos son equipos de medición utilizados para evaluar la eficacia de frenado de las motocicletas y de los vehículos livianos. Este artículo presenta un modelo matemático propuesto para la calibración específica de estos equipos de medición, las fuentes de incertidumbre consideradas para el modelo en cuestión y su cuantificación, así como los principales resultados de la validación de este modelo matemático. Al finalizar el proceso de investigac...

  13. Justicia para las sobrevivientes de Perú

    OpenAIRE

    Valdez-Arroyo, Flor de María

    2007-01-01

    Perú ha adoptado medidas para ayudar a las sobrevivientes de la violencia sexual durante conflictos armados en su búsqueda de justicia y reparación, pero la falta de una perspectiva cultural y de género para establecer mecanismos adecuados pone este proceso en peligro.

  14. The para-petroleum industry; L'industrie parapetroliere

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    The para-petroleum industry includes societies that realize studies and installations for the deposits exploitation. This document presents the situation of the para-petroleum industry in 2001, the world investment growth of the activity, the french societies financial results and an inventory of the main operations in the amalgamation domain. (A.L.B.)

  15. Jõhvis tuleb parasürrealistide näitus

    Index Scriptorium Estoniae

    2008-01-01

    Jõhvi kontserdimajas avatakse parasürrealistide rühmituse PARA näitus "Panoraam". Osalevad Ilmar Malin (maalid), Jüri Palm (maalid), Elo Järv (nahkskulptuurid), Vello Vinn (graafika), Leonhard Lapin (akvarellid), Enn Tegova (maalid), Ahti Seppet (puuskulptuurid), Raivo Kelomees (maalid), Kristiina Viin (joonistused ja maalid)

  16. Modelo de determinantes sociales para la salud poblacional de Asturias

    OpenAIRE

    Shmarev Shmarev, Andrey

    2013-01-01

    Hemos buscado establecer una ecuación de salud para mirar el peso que tienen variaciones en variables sociales, medidas de forma agregada para la población sobre la salud autopercibida de la población por municipios.

  17. Eficacia y Eficiencia, premisas indispensables para la Competitividad

    Directory of Open Access Journals (Sweden)

    Armando Rodríguez-Aguilera

    2012-01-01

    investigadores y empresarios cubanos consiste en atacar los obstáculos que requieren solución para alcanzar la competitividad, utilizando para ello métodos y técnicas que permiten trazar nuevas estrategias basadas esencialmente en la Calidad total y el mejoramiento continuo.

  18. A nontraumatic para-aortic lymphocele complicating nephrolithiasis.

    Science.gov (United States)

    Hyson, E A; Belleza, N A; Lowman, R M

    1977-09-01

    Many cases of traumatic para-aortic lymphocele have been reported. Recently, a case of nontraumatic para-aortic lymphocele was investigated. The etiologic consideration for this lymphocele formation is either a localized inflammatory process, or fibrosis induced by prior passage of calculi.

  19. Programa "DRL" para controle experimental de pesquisa em julgamento temporal

    OpenAIRE

    Costa,Valéria Catelli Infantozzi da; Paula,Eldereis de; Xavier, Gilberto Fernando; Bueno,José Lino Oliveira

    2007-01-01

    Um programa de computador, o "DRL", foi desenvolvido para controle e coleta de dados em experimentos envolvendo processos temporais associados à atenção e memória. Apresenta-se um breve relato do programa, como configurá-lo para diferentes tipos de experimentos e como acessar os resultados gravados em arquivos.

  20. PARA'04, State-of-the-art in scientific computing

    DEFF Research Database (Denmark)

    Madsen, Kaj; Wasniewski, Jerzy

    This meeting in the series, the PARA'04 Workshop with the title ``State of the Art in Scientific Computing'', was held in Lyngby, Denmark, June 20-23, 2004. The PARA'04 Workshop was organized by Jack Dongarra from the University of Tennessee and Oak Ridge National Laboratory, and Kaj Madsen and J...

  1. Pensamiento crítico: formar para atreverse

    OpenAIRE

    Bolaños Torres, Bertha Isabel

    2012-01-01

    Tesis de grado para optar al título de Magister en Ciencias de la Educación, esta tiene como objetivo identificar en los postulados del pensamiento crítico una propuesta de transformación para el docente en formación desde la práctica pedagógica.

  2. UNA PROPUESTA EVALUATIVA PARA ACTIVIDADES DE EDUCACIÓN AMBIENTAL PARA LA SOSTENIBILIDAD

    Directory of Open Access Journals (Sweden)

    Rosa M. Medir Huerta

    2016-01-01

    Full Text Available El propósito de este artículo es presentar una propuesta evaluativa para ac - tividades de educación ambiental para la sostenibilidad en el ámbito escolar ofrecidas desde entidades externas a la escuela. Para ello, se realiza una eva - luación real de un programa educativo de una administración pública que se orienta al refuerzo del currículo de educación infantil, primaria y secundaria. El objetivo de la evaluación es diagnosticar la presencia, en las actividades estudiadas, de principios clave de la educación ambiental para la sosteni - bilidad identificados por el equipo de investigación a partir de referencias internacionales. La metodología es la investigación evaluativa de programas dentro del paradigma crítico de la investigación educativa y con herramientas de tipo cuantitativo. Se utiliza, básicamente, un cuestionario expresamente diseñado que valora la presencia y la ausencia de los principios establecidos de la educación ambiental para la sostenibilidad. Los resultados nos aportan nuevas informaciones acerca de las fortalezas y las debilidades del desarrollo de actividades de educación ambiental. Se llega a una valoración cuantificada de los principios definidos en tres grupos, según su necesidad de mejora, y se determina que los principios mejor tratados en las actividades son los que se relacionan con los contenidos disciplinares más clásicos, tratados con buenos y distintos métodos didácticos. En cambio, las debilidades detectadas se refieren a aspectos cruciales de la educación ambiental tales como experimentar nuevas sensaciones, aprender a buscar información, pensamiento crítico, sentimiento de pertenencia a un lugar, trabajo en colaboración, adquirir una visión global de la realidad, y reflexionar sobre la vida cotidiana y sobre el futuro deseado.

  3. Carriles para alta velocidad. Comportamiento en fatiga

    Directory of Open Access Journals (Sweden)

    Duart, J. M.

    2005-02-01

    Full Text Available In recent years, passanger train speed and freight train load have increased to enhance efficiency of rail road transportation. These trends have increased the severity of rail service conditions, calling for rails with greager wear resistance, strength and fatigue behavior. In the United States and Europe, track site weld rails are made entirely by alumino thermic process. This work describe the results of experimental study conducted on bending fatigue strength of plain rails and alumino thermic welded rails with preheating procedures (oxipropane and air-induced propane approved by railways authorities. Compliance with the required fatigue strength shall be ascertained by 4 point pulsating bending test in accordance with European standard by alumino thermic weld in rails. The Locati method, based in the empirical Miner's law about the cumulative damage on a fatigue tested material, allows, once known the Wohler curve of the welding process in use to settle the fatigue tensile limit at 50% with only one test. The values obtained at 2.10 cycles for plain rails (Sf = 353 MPa, oxipropane preheated aluminothermic weld rails (Sf = 225 MPa, and propane-air induced aluminothermic weld rails (Sf = 210 MPa are very similar to those resulting from test method stated in the European Standard. From our point of view and due to its ease, speediness and savings, this is the most suitable test to check the quality and compare the aluminothermic processes in use.

    En los últimos años la eficiencia de los FECC, tanto para el transporte de viajeros como de mercancías, ha experimentado un desarrollo espectacular. Ello, ha sido posible gracias, entre otros factores, a la fabricación de carriles con resistencia al desgaste, carga de rotura y resistencia a fatiga mejoradas. La soldadura de los carriles, en Europa y U.S.A. se realiza "in situ" por aluminotermia con precalentamiento de los carriles con oxipropano o propano

  4. Promover os talentos para reduzir a probreza

    Directory of Open Access Journals (Sweden)

    Enrico Novara

    2003-08-01

    Full Text Available A dimensão da pobreza, a sua distribuição regional, as diferenças do fenômeno na área rural e na cidade, são elementos de conhecimento público. A cidade brasileira mostra cotidianamente as feridas causadas pela desigual distribuição de renda e pela exclusão social: a configuração espacial do território intraurbano é o mais nítido retrato do fenômeno, que hoje representa o principal obstáculo ao desenvolvimento sustentável do país. Apesar desta evidência, os programas de redução da pobreza, desenvolvidos nos últimos anos, apresentam poucos pontos de integração com a realidade territorial. Por outro lado, a desigual distribuição de renda e a exclusão social de ampla parte da população, mesmo descrevendo detalhadamente o problema, não ajudam a identificar os pontos de partida e os elementos positivos que devem ser fortalecidos para implementar programas integrados de redução da pobreza. A história e as experiências de programas de urbanização dos últimos 25 anos podem contribuir para definir um percurso metodológico a partir das potencialidades, mesmo que adormecidas, das pessoas que vivem a situação de pobreza. Chamamos "patrimônio" o conjunto de recursos palpáveis e impalpáveis que as pessoas possuem e podem colocar em jogo para enfrentar as situações críticas que estão vivendo. Identificar e desenvolver ações que possam aumentar este patrimônio, reduzindo a vulnerabilidade das famílias, pode ser o caminho a ser percorrido. O desenvolvimento de "corpos intermediários" e de atores intermediários capazes de compartilhar necessidades e potencialidades representa uma etapa fundamental deste percurso.The dimension of poverty, its regional distribution, the differences of the phenomenon in the rural area and in the city, are widely known elements. The Brazilian city shows, on a daily basis, the wounds caused by the unequal distribution of income and social exclusion: the spatial configuration of

  5. Normas para publicação

    Directory of Open Access Journals (Sweden)

    Editores INTERthesis

    2014-06-01

    Full Text Available A Revista Internacional Interdisciplinar INTERthesis, publicada pelo Programa de Pós-Graduação Interdisciplinar em Ciências Humanas da UFSC, aceita para avaliação artigos inéditos, concisos e consistentes, preferencialmente com abordagem interdisciplinar, estabelecendo pontes entre disciplinas principalmente em áreas temáticas tais como:Condição Humana na Modernidade,Estudos de Gênero eSociedade e Meio AmbienteSerão aceitas contribuições nas seguintes modalidades:aArtigo: deve ser original, contribuição de caráter acadêmico e/ou técnico-científico destinada a divulgar resultados de pesquisa científica, de natureza empírica, experimental ou conceitual (mínimo de 12 e máximo de 18 páginas, incluindo títulos, resumos, tabelas, figuras, mapas e referências.b Revisão: avaliação crítica sistematizada da literatura sobre determinado assunto; deve-se citar o objetivo da revisão, especificar (em métodos os critérios de busca na literatura e o universo pesquisado, discutir os resultados obtidos e sugerir estudos no sentido de preencher lacunas do conhecimento atual (mínimo de 12 e máximo de 18 páginas, incluindo títulos, resumos, tabelas, figuras, mapas e referências.cEnsaio: reflexão circunstanciada, com redação adequada ao escopo de uma publicação científica, com maior liberdade por parte do autor para defender determinada posição, que vise aprofundar a discussão ou que apresente nova contribuição/abordagem a respeito de tema relevante (mínimo de 12 e máximo de 18 páginas, incluindo títulos, resumos, tabelas, figuras, mapas e referências.d Resenha: análise crítica sobre livro publicado nos últimos dois anos (até 6 páginas, com as mesmas configurações que se solicita ao texto, incluindo referência bibliográfica completa no cabeçalho.Leia mais nas Instruções aos autores: https://periodicos.ufsc.br/index.php/interthesis/article/view/31715/25904

  6. Sludge como fator de risco para prematuridade

    Directory of Open Access Journals (Sweden)

    Elizabeth Kazuko Watanabe

    2016-10-01

    Full Text Available Introdução: O trabalho de parto prematuro (TPP é um grave problema de saúde pública devido à elevada morbidade e mortalidade neonatal.Como fatores de risco,destacam-se o baixo nível socioeconômico,nutrição inadequada,extremos de idade,estresse físico e psicológico,tabagismo e drogas ilícitas.Intecorrências como incompetência cervival,placenta de inserção baixa,descolamento prematuro de placenta,polidramnio,gemelaridade, rotura prematura de membranas,história prévia de parto prematuro são causas obstétricas e ginecológicas. Dentre as infecções,a corioamnionite é uma das mais importantes.A prevenção e a predição da prematuridade têm sido alvo de pesquisas através de métodos clínicos, bioquímicos e ultrassonográficos. À ultrassonografia(US,a medida do comprimento de colo uterino com transdutor vaginal(TV e a pesquisa do eco glandular endocervical auxiliam na predição do parto prematuro. Outro sinal ultrassonográfico que parece estar associado à infecção e à prematuridade é o sludge,um agregado espesso de partículas no líquido amniótico próximo ao orifício interno do colo uterino.A associação sludge e colo curto(menor que 25mmaumenta o risco de TPP. Objetivo/Metodologia: apresentamos um caso de sludge em gestante com 16 semanas e antecedente de TPP. Relato de caso:TPDA,24anos,secundigesta primípara(natimorto com 29 semanas,realizou USTV devido a colo entreaberto ao toque vaginal e ao passado obstétrico. Ao exame,visualizou-se sludge e colo medindo 3,8cm de comprimento. Foi internada para tratamento com Clindamicina e Cefalexina via oral por 10 dias.Exames de urina I, hemograma e proteína C reativa normais na internação. Alta após 5 dias,com acompanhamento semanal e prescrição de progesterona 200mg via vaginal. Conclusão: o sludge é um sinal preditor de prematuridade.

  7. Aprendizaje y conocimiento para innovar y emprender

    Directory of Open Access Journals (Sweden)

    López de Silanes, José Luis

    2011-12-01

    Full Text Available Learning and the creation of knowledge are closely related to improved competitiveness and the creation of wealth in a country, because they help to boost innovation and the development of more productive activities with higher added value by taking advantages of the opportunities offered by the new technologies. Spain, which has made a significant effort during the last 30 years and has managed not only to position itself in ninth place among the countries with the highest scientific production, but also among the major world economies, has lost momentum in recent years, which is why it needs to improve its competitive capacity. In order to achieve this, an appropriate environment must be generated through promoting the innovative capacity of all the institutions involved and improving the quality of education, as well as the conditions required for facilitating the free movement of knowledge. In this context, the Spanish university still has an important task before it in terms of improving optimization of the use made of its educational resources and scientific production, as well as the continuous updating of knowledge and promotion of the entrepreneurial ability of young university students, with the assistance of society as a whole.

    El aprendizaje y la creación de conocimiento están estrechamente relacionados con la mejora de la competitividad y la creación de riqueza de un país, porque contribuyen a potenciar la innovación y el desarrollo de actividades más productivas y de mayor valor añadido aprovechando las oportunidades que brindan las nuevas tecnologías. España, que ha realizado un importante esfuerzo durante los últimos 30 años, y ha logrado situarse entre las principales economías del mundo, ha perdido posiciones en los últimos años, por lo que necesita mejorar su capacidad competitiva. Para lograrlo, es necesario generar un entorno adecuado mediante el fomento de la capacidad innovadora de todas las

  8. Fontes: dois contextos expositivos para a incomensurabilidade

    Directory of Open Access Journals (Sweden)

    Elisa de Sousa Martinez

    2008-11-01

    Full Text Available O significado da obra de arte é construí­do na relação que esta estabelece com o contexto em que é exposta e com as obras com as quais constitui um percurso perceptivo, sensí­vel e cognitivo. Utilizam-se os princí­pios teóricos da semiótica discursiva para construir uma análise na qual, ao mesmo tempo em que é considerada a localização imanente do ponto de partida de um percurso de geração de sentido, na estrutura da obra Fontes, de Cildo Meireles, exposta em dois eventos artí­sticos diferentes, identificam-se figuras e temas que participam de uma rede que a interliga a outros textos e seus respectivos potenciais significativos. As escolhas dos curadores inserem a obra em contextos situacionais no quais o seu sentido é apreendido e, também, contribui para a produção de sentido de um texto que o engloba. Palavras-chave arte contemporânea, instalação, semiótica visual Abstract The meaning of a work of art is produced by the relationship established within the context of the exhibition, as well as with the other works with which it builds the one sensitive and cognitive course. Based on the Semiotics of A.J. Greimas we present an analysis of Cildo Meirele's Fontes, a work exhibited in two different events, revealing its common figures and themes. We consider not only the immanent structure of the meaning in an artistic text, but also its connection to other texts and the potential meanings that emerge from them. The choices made by a curator have the potential to insert the artwork in a situational context in which its meaning is captured and this contributes to the global perception of the text/exhibition in which it is presented. Key words contemporary art, installation art, visual semiotics

  9. Para além da linhagem

    Directory of Open Access Journals (Sweden)

    Maria Joana GOMES

    2011-03-01

    Full Text Available A subida de Urraca I (1109-1126 ao trono do reino de Leão e Castela como sucessora de Afonso VI (1072-1109 representou, como atestam vários testemunhos escritos, um acontecimento problemático para os seus contemporâneos. Consoante a posição que assumem perante este facto, os textos historiográficos peninsulares não deixaram de fornecer argumentos e justificações que favoreciam ou que, pelo contrário, atacavam o papel da filha de Afonso VI. Partindo da análise do catálogo das mulheres de Afonso VI em dois desses textos -O Chronicon Regum Legionensium e o Liber Regum Villarensis-, este artigo procura problematizar não apenas o lugar de Urraca no quadro genealógico das mulheres e da descendência de Afonso VI, mas também avaliar de que modo estas relações genealógicas são apresentadas por cada um destes textos, para legitimar ou denegrir a rainha de Leão e Castela e, através dela, a dinastia a que esta pertence.Comme on le constate à travers plusieurs témoignages écrits, l’accession au trône de León et Castille d’Urraque (1109-1126, succédantà Alphonse VI (1072-1109, fut perçue par ses contemporains comme un fait de nature problématique. Selon la position qu’ils adoptent, les textes historiographiques hispaniques fournissent autant d’arguments et de justifications favorables ou hostiles au rôle politique de la fille d’Alphonse VI. À partir de l'analyse de la liste des femmes d’Alphonse VI dans le Chronicon regum Legionensium de Pélage d’Oviedo et du Liber regum Villarensis, cet article s’intéresse non seulement à la place d’Urraque dans la généalogie des femmes et de la descendance d’Alphonse VI mais tente aussi de montrer comment ces relations généalogiques sont présentées dans chacun de ces textes afin de légitimer ou discréditer la reine de Léon et Castille et, à travers elle, sa propre dynastie.

  10. Feasibility of co-generation of water and electricity by means of the IRIS;Factibilidad de cogeneracion de agua y electricidad mediante el IRIS

    Energy Technology Data Exchange (ETDEWEB)

    Vargas E, S.; Alonso V, G.; Gonzalez, J. A.; Xolocostli, V.; Ramirez S, J. R., E-mail: samuel.vargas@inin.gob.m [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2009-10-15

    The importance to count with resources that allow the development of a country is an important factor. The electricity and the water are factors that in the future will be crucial for the development of any region of the planet. In this work the economic reliability of use of IRIS reactor like a energy source for the electricity production, as well as for the potable water production through the desalination of sea water. Within this study the requirements of these two outlines for different regions from the country are analyzed, nevertheless, chooses the northwest region of the Mexican republic, because, according to estimations realized for the Energy Secretary and the National Commission of the Water, this would present important water requirements and electricity, due to the population increase that is considered for all the country, mainly the built-up zones. Combined to this one is due to consider that the present water demand in some regions of the country present a worrisome over-exploitation of this liquid appraising. The economic evaluation of co-generation that appears in this work though the IRIS reactor, includes different desalination capacities at the moment, using the three more used techniques, obtaining the even costs of water and electricity, as well as net saleable energy and the construction costs as much for the desalination plant and the IRIS reactor. (Author)

  11. Desalination of seawater with nuclear power reactors in cogeneration; Desalacion de agua de mar con reactores nucleares de potencia en cogeneracion

    Energy Technology Data Exchange (ETDEWEB)

    Flores E, R.M

    2004-07-01

    The growing demand for energy and hydraulic resources for satisfy the domestic, industrial, agricultural activities, etc. has wakened up the interest to carry out concerning investigations to study the diverse technologies guided to increase the available hydraulic resources, as well as to the search of alternatives of electric power generation, economic and socially profitable. In this sense the possible use of the nuclear energy is examined in cogeneration to obtain electricity and drinkable water for desalination of seawater. The technologies are analysed involved in the nuclear cogeneration (desalination technology, nuclear and desalination-nuclear joining) available in the world. At the same time it is exemplified the coupling of a nuclear reactor and a process of hybrid desalination that today in day the adult offers and economic advantages. Finally, the nuclear desalination is presented as a technical and economically viable solution in regions where necessities of drinkable water are had for the urban, agricultural consumption and industrial in great scale and that for local situations it is possible to satisfy it desalinating seawater. (Author)

  12. Cogeneration and production of 2nd generation bio fuels using biomass gasification; Cogeneracion y produccion de biocombustibles de 2 generacion mediante gasificacion de biomasa

    Energy Technology Data Exchange (ETDEWEB)

    Uruena Leal, A.; Diez Rodriguez, D.; Antolin Giraldo, G.

    2011-07-01

    Thermochemical decomposition process of gasification, in which a carbonaceous fuel, under certain conditions of temperature and oxygen deficiency, results in a series of reactions that will produce a series of gaseous products is now widely used for high performance energetic and versatility of these gaseous products for energy and 2nd generation bio fuels and reduce the emission of greenhouse gases. (Author)

  13. CDM incidence in the economical feasibility of cogeneration in Argentine; Incidencia del MDL en la factibilidad economica de sistemas de cogeneracion industrial en Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Sosa, Maria Isabel; Fushimi, Alberto [Universidad Nacional de La Plata (UNLP), La Plata, BA (Argentina). Fac. de Ingenieria. Area Departamental Mecanica], e-mail: misosa@volta.ing.unlp.edu.ar, e-mail: afushimi@volta.ing.unlp.edu.ar

    2006-07-01

    In this paper, the contribution to the financial and economic feasibility of cogeneration systems with gas turbine and exhaust gas heat recovery boiler is discussed in function of the financial credit for reduction of greenhouse gases emissions (GH Gs) by using the Clean Development Mechanism (CDM). It has to be kept in mind the restrictions of these systems to be capital intensive projects subject to the effects of the economy of scale. Other factors to take into account are the constancy of the heat demand, the rates of sale of electricity and steam surpluses, the regulatory laws, the ignorance of the cogeneration technologies on the part of the investor, among others. The profitability of the investment for implementation of a cogeneration system can be elevated in large facilities with gas turbines and heat recovery boiler (T G + HRSG). Results discussed in previous papers are pointed out and new conclusions are enunciated. (author)

  14. Recomendaciones para una lactancia materna exitosa

    Directory of Open Access Journals (Sweden)

    María Elena Ortega-Ramírez

    2015-03-01

    Full Text Available La lactancia materna es la única manera de proporcionar los nutrientes ideales para el adecuado crecimiento y desarrollo de los niños y las niñas. Es el único alimento que tiene una influencia biológica y emocional sobre la salud de la madre y su hijo. La lactancia materna protege a los lactantes de enfermedades gracias a sus propiedades antiinfecciosas, además de que es de más fácil digestión por la menor cantidad de caseína. No contiene betalactoglobulina, que es la proteína que más frecuentemente se asocia con alergia a proteína de leche de vaca. Por estas razones los médicos y trabajadores de la salud deben favorecer la práctica de la lactancia materna.

  15. Testes de racionalidade para loterias no Brasil

    Directory of Open Access Journals (Sweden)

    Marcos A. M. Lima

    2006-06-01

    Full Text Available O artigo investiga a prevalência de expectativas racionais no caso de duas loterias brasileiras (Quina e Mega-Sena. A estratégia de teste se relaciona com uma condição de ortogonalidade entre o erro condicional de previsão e o conjunto de informação. Especificamente, o resíduo de uma equação para o preço líquido de um bilhete de loteria deveria ser não correlacionado com as vendas. Os resultados favoreceram a hipótese de expectativas racionais somente no caso da Mega-Sena que é sujeita a ampla cobertura da mídia. Claramente a Quina está associada a um perfil distinto de apostadores.The paper investigates the prevalence of rational expectations in the case of two Brazilian lotteries (Quina and Mega-Sena. The testing strategy relates to an orthogonality condition between the conditional forecast error and the information set. Specifically, the residual of a equation for net price of a lottery ticket should be uncorrelated with sales The results favoured the rational expectations hypothesis only in the case of the Mega-Sena that is subject to broad media coverage. Clearly the Quina lottery is associated with a diferent profile of betters.

  16. Biblioteca y residencia para estudiantes - Viena (Austria

    Directory of Open Access Journals (Sweden)

    Lippert, G.

    1972-02-01

    Full Text Available The recently completed Municipal Library of Vienna, includes the lending of books, reading rooms, information services, children's library, municipal library and lecture rooms. The hostel Adolf Schärf «Vindobona» is a tall building, of 33 m height, which in addition to many rooms for the communal life of students, has 54 double bedrooms, and 147 single rooms, equipped with standards of comfort comparable to those of an hotel, since the hostel is used by students in winter, and as an hotel in the summer.El conjunto terminado Casa del Libro-Biblioteca Municipal de Viena alberga los servicios de autoalquiler, salas de lectura, información, biblioteca infantil, biblioteca municipal, salas de conferencias, etc. La Residencia Hogar Adolf Schärf «Vindobona» es una torre de 33 m de altura que, además de los numerosos locales para el desarrollo de la vida en común de los estudiantes, alberga 54 habitaciones con dos camas, y 147 sencillas, equipadas todas ellas a escala hotelera, dado que el hogar es explotado por los mismos estudiantes como tal hotel durante las vacaciones.

  17. para celdas de combustible de etanol

    Directory of Open Access Journals (Sweden)

    CARLOS MONSALVE GIL

    2008-01-01

    Full Text Available En este trabajo se elaboraron dos membranas nanocompuestas de Nafion®- TiO2 con 2 y 4% del cerámico por el método del “recasting”. El análisis de composición del microscopio de barrido electrónico (SEMEDS mostró una estructura de dos capas, una enriquecida en cerámico y otra con menos cantidad, pero con dispersión uniforme. Se midió la velocidad de permeación de etanol y la absorción de solventes en estas membranas a diferentes temperaturas y concentraciones y los resultados fueron comparados con los obtenidos para la membrana de Nafion® sin modificar. Los resultados experimentales mostraron un incremento de la permeación y de la absorción de solvente con la concentración de etanol y la temperatura. La absorción de agua también mostró un incremento en las membranas compuestas lo cual puede permitir operar a mayores temperaturas y menores humedades relativas y aumentar el desempeño de la celda de combustible.

  18. Bolonia, una oportunidad para el derecho deportivo

    Directory of Open Access Journals (Sweden)

    Francisco de la Torre Olid

    2011-01-01

    Full Text Available El nuevo panorama universitario, adaptado al Plan de Bolonia, ha exigido una revisión de estudios de larga tradición como son los de Derecho y este momento ha permitido implantar unos nuevos planes en los que el Derecho del deporte tiene un espacio. Este estudio razona sobre la importancia de esta materia por la consideración de su contenido interdisciplinar, que ejercita en la visión unitaria del Ordenamiento, y por la realidad tan universal que acota, que hace necesario su conocimiento por el jurista, que es un profesional llamado a intervenir en la sociedad e implicarse en lo que ésta se proyecte. Se muestra una experiencia para dibujar, desde la UCAM, un itinerario procedimental y una realidad universitaria que puede inspirar otras iniciativas académicas, con el compromiso con el Derecho deportivo que familiariza con el deporte y contribuye a su fomento; además de exigir estar a resultas de la actualización de un Derecho que, al ser novedoso en su relevancia jurídica, se ha de seguir completando y consolidando.

  19. Fuentes documentales para la historia del CSIC

    Directory of Open Access Journals (Sweden)

    Rodríguez de Quiroga, Alfredo

    1999-08-01

    Full Text Available Not available.En la línea que desde hace tiempo vienen apuntando diversos autores, se plantea en este trabajo la necesidad de abordar del modo más exhaustivo posible la reconstrucción histórica del Consejo Superior de Investigaciones Científicas. Resulta para ello indispensable recurrir al uso de fuentes documentales reveladoras de información detallada de primera mano que permita un estudio serio y riguroso del tema. En este sentido, nuestro objetivo es contribuir a facilitar tan difícil labor, aportando con estas notas los resultados obtenidos en la primera fase del proyecto que estamos llevando a cabo sobre la localización y recuperación de los fondos que, directa o indirectamente, se encuentran relacionados con el papel desempeñado por el Consejo en el proceso de construcción y desarrollo institucional de la política científica y tecnológica en el franquismo.

  20. Guía para autores

    Directory of Open Access Journals (Sweden)

    John Harold Estrada Montoya

    2015-08-01

    Full Text Available La Revista Acta Odontológica Colombiana, es una publicación electrónica seriada, semestral y arbitrada, editada desde la Facultad de Odontología de la Universidad Nacional de Colombia, dirigida a académicos, investigadores y profesionales interesados los temas actuales y los resultados de la actividad científica e investigativa en odontología. Filosofía y política editorial La Revista Acta Odontológica Colombiana tiene como objetivo publicar resultados o avances de investigación promotores del desarrollo de conocimientos académicos, técnicos, científicos y éticos para la odontología y la salud bucal, relacionados con aspectos de la práctica clínica, salud pública, bioética, educación, ciencias básicas, biotecnología, materiales dentales y de laboratorio. Asimismo tiene como propósito consolidar el intercambio de saberes, experiencias e investigadores en el área de la salud, en general, y de la odontología, en particular, a nivel nacional e internacional. 

  1. Aditivos para hormigones, morteros y pastas

    Directory of Open Access Journals (Sweden)

    Gaspar Tebar, Demetrio

    1984-09-01

    Full Text Available This article comments on the increasing importance of the use of admixtures for concrete, mortars and grouts as well as the specific effects they produce, thus requiring a suitable Spanish Normative, whose performance was taken in charge by a Working Group of the Technical Commission n.° 83 from the IRANOR, created for this purpose. This article is first of a series which intends to give an account of the works, on the Normative of those additives, the Working Group is carrying out.

    En el presente artículo se comenta la importancia que ha adquirido el empleo de los aditivos para hormigones, morteros y pastas, así como las modificaciones y efectos específicos que producen, lo que ha motivado la necesidad de contar con una normativa española apropiada, cuya realización se encomendó a un Grupo de Trabajo, creado al efecto, de la Comisión Técnica n.º 83 del IRANOR. Este artículo es el primero de una serie en la que se pretende dar cuenta de los trabajos que sobre normativa de los mencionados aditivos se viene realizando por dicho Grupo de Trabajo.

  2. Escala de Motivação para a Leitura para Adolescentes e Jovens: Propriedades Psicométricas

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Mezzalira Gomes

    Full Text Available RESUMO A motivação para ler, assim como a motivação para aprender, é uma variável chave para a aprendizagem. Este estudo tem como objetivo descrever os passos relativos à construção de uma Escala de Motivação em Leitura (EML para adolescentes e jovens, apresentar dados preliminares de suas propriedades psicométricas e validade de constructo. Participaram 329 estudantes do 6° ano do Ensino Fundamental ao 3º ano do Ensino Médio. Da análise fatorial exploratória dos 83 itens da escala, emergiram seis fatores coerentes com o continuum motivacional descrito pela Teoria da Autodeterminação, com consistência interna entre 0,97 e 0,76. Esses resultados iniciais revelam propriedades psicométricas promissoras da escala para uso no contexto educativo.

  3. AUTONOMÍA PARA APRENDER Y AUTONOMÍA PARA VIVIR

    Directory of Open Access Journals (Sweden)

    Miryam Narváez Rivero

    2005-04-01

    Full Text Available RESUMEN: El sistema educativo tiene el reto actual de formar individuos autónomos. Esta autonomía no implica solo el que las personas tengan los recursos necesarios para aprender a aprender, sino que puedan convivir armónicamente en comunidad, escuchándose a sí mismos para tomar sus propias decisiones, sin estar determinados por deseos instintivos ni modelos coercitivos impuestos por la sociedad. Así, para desarrollar autonomía, le corresponde a la educación trabajar tres elementos: la voluntad, la libertad y la autoestima. De esta forma, una educación promotora de una verdadera autonomía deberá tener un carácter dialógico, haciendo hincapié en la integración solidaria de la persona con su comunidad. Nos referimos a una persona que no ha renunciado a sus metas ni aspiraciones, sino que sabe cómo guiarlas hacia un proyecto común de bienestar general. ABSTRACT: The educative system’s latest challenge is to educate independent individuals. This autonomy does not just imply that people have the necessary resources to learn to learn, but the ones they need to live together in harmony with others, listening to themselves to make their own decisions without being determined by instinctive desires nor coercive models imposed by the society. It is so, that to develop autonomy, the educational system must work with these three elements: will, freedom and self-esteem. Also, an educational system which promotes a true autonomy must have a dialogic character, insisting on the individual solidarity integration with the community; with this, we mean a person who has not resigned to his goals or aspirations, but that knows how to guide them towards a common project for the community well-being.

  4. Una arquitectura basada en software libre para archivos web

    Directory of Open Access Journals (Sweden)

    Mercy H. Ospina Torres

    2013-04-01

    Full Text Available Los archivos web son sistemas de información que se han venido desarrollando desde finales de los años 90 para llevar a cabo la preservación histórica del patrimonio web como parte del patrimonio digital de la humanidad. Tales archivos han tenido que afrontar ciertos desafíos propios de los recursos web, como son el tamaño de la web y su naturaleza cambiante, las tecnologías asociadas a la web, la web superficial y la web profunda, la organización de la web en dominios, entre otros. Debido a ello, se ha hecho necesario proponer arquitecturas, técnicas, herramientas y estándares para las diferentes funcionalidades de un archivo web que permitan afrontar de manera eficaz dichos desafíos. Este trabajo tiene como objetivo establecer una arquitectura basada en software libre para un prototipo de archivo web. Para ello se hace una revisión detallada del dominio de archivo web, de sus funciones y de los enfoques usados hasta el momento para llevarlas a cabo. Se presenta un estudio comparativo entre diferentes iniciativas de preservación web a nivel mundial y se establecen los componentes para un sistema para la preservación web basada en software libre.

  5. Matthew Lipman y Paulo Freire: Conceptos para la libertad

    Directory of Open Access Journals (Sweden)

    Stella Accorinti

    2002-01-01

    Full Text Available M. Lipman y P. Freire son dos pensadores comprometidos con las prácticas de la libertad. Para ellos libertad es libertad para aprender a pensar y a ser en comunidades de diálogo, de indagación, de investigación. Es el proyecto que lleva a los seres humanos al conocimiento de sí mismos y al re-conocimiento de los otros. Sin libertad no hay posibilidades existenciales para nuestra humanización. En este trabajo se estudian las propuestas que ambos filósofos proponen para una educación y una pedagogía del aprender a ser libres. Para esto se requiere, según Lipman, desarrollar un pensamiento mutidimensional (creativo, flexible, amplio, abierto, lleno de recursos, complejo, estimulante, que se opone al pensamiento simplificador. Pensar también es filosofar, eso justifica por qué para Lipman se debe hacer filosofía para niñ@s. Por su parte, Freire entiende que el derecho a una educación en libertad es lo que permite resistir y superar cualquier tipo de opresión.

  6. Sistema de apoyo para la toma de decisiones para la gestión de inventarios

    OpenAIRE

    Uribe Cadavid, Diana Cecilia

    2012-01-01

    Los planeadores de los recursos de la empresa (ERP) son sistemas computacionales que ayudan a las compañías a integrar la información del negocio. Para realizar la gestión de inventarios, estos paquetes tienen algunos modelos de control y gestión de inventarios, que requieren la definición de parámetros, los cuales son establecidos de manera arbitraria por el administrador del inventario, ignorando el impacto que tienen éstos sobre los niveles de inventario y de servicio, así como en los cost...

  7. Bancos para ler e conversar : parâmetros de projeto para sistema de design generativo

    OpenAIRE

    Ana Cláudia Vettoretti

    2010-01-01

    Esta dissertação trata do apoio ergonomico durante atividades de conversa e leitura em bancos públicos quando o corpo assume variadas posturas. São estruturados parâmetros de projeto associados a dimensionamentos antropométricos relacionados a posturas observadas. Os parâmetros são incorporados à estratégia procedural para geração de formas utilizando modelo geométrico com regras de combinação. O procedimento é testado no software Rhinoceros (Grasshopper) gerando designs alternativos de banco...

  8. Para salir de la pobreza: El enfoque del Banco Interamericano de Desarrollo para reducir la pobreza

    OpenAIRE

    1998-01-01

    Este informe se propone colocar el tema de la pobreza en términos de lo que sabemos acerca de ella, y de lo que podemos hacer para eliminarla. Enmarcar estos temas no es una tarea fácil. Nuestra falta de conocimientos sobre la situación social de los pobres es abismal, y por lo general las prácticas y políticas que se recomiendan no se han probado en el terreno. En su búsqueda de políticas que permitan confrontar la pobreza, la experiencia del Banco demuestra que con frecuencia el proceso de ...

  9. Renovar as arestas da cidade para uma arquitectura sem barreiras: Shindler Award 2010, acesso para todos

    OpenAIRE

    2010-01-01

    Este trabalho focaliza-se essencialmente na questão da acessibilidade, e sobretudo, no modo como a arquitectura deverá responder aos direitos e necessidades físicas do Homem, no que respeita a acessibilidade nas cidades, concretamente neste caso, numa área de Berlim. No fundo a crença a ideia de uma arquitectura que permita a mobilidade para todos. Através da pesquisa de bibliografia relativa ao urbanismo, numa arquitectura de maior escala, até à arquitectura “menor”, e na procura de...

  10. Accesorios para lactancia materna. Sistema de nutrición suplementaria para lactar (SNS)

    OpenAIRE

    Rozas García, M. Rosa

    1998-01-01

    La lactancia materna es un proceso fisiológico que pueden llevar a cabo casi la totalidad de las mujeres. En algunas circunstancias especiales como la adopción de un bebé, los problemas de succión del niño o la interrupción temporal de la lactancia pueden aparecer dificultades y ser necesario el empleo de los llamados suplementadores de lactancia. Describimos el sistema de nutrición suplementaria SNS® para que los profesionales de la salud conozcan sus carac­terísticas, manejo e indicaciones ...

  11. Narrativa literária: suporte para a infância, texto para a juventude

    Directory of Open Access Journals (Sweden)

    Celia Abicalil Belmiro

    2012-11-01

    Full Text Available http://dx.doi.org/10.5007/2175-795X.2012v30n3p843 O livro de literatura infantil contemporâneo tem se constituído sobre o tripé: texto,imagem, formato do suporte para embasar a construção da narrativa. Todavia, esses elementos também podem falsear ou transformar o perfil das obras consideradas canônicas para crianças, explicitando a arbitrariedade desse modelo de livro. Por outro lado, narrativas que exploram o texto verbal e o texto visual pressupondo um leitor-modelo juvenil, e que mantêm um formato de livro infantil, indicam que essa faixa adolescente vem se constituindo como um leitor que utiliza linguagens múltiplas e simultâneas. Este trabalho analisa elementos-chave da narrativa no livro "Nenhum peixe aonde ir", da autora franco-canadense Marie-Francine Hébert, com ilustrações deJanice Nadeau. O tema da guerra, sob os olhos da criança e sob uma forte presença daenunciação, permite diferentes camadas de leitura e compreensão. Ao mesmo tempo,usos de imagens, fontes de texto e diagramação, que outrora indicavam um leitorinfantil, contemplam atualmente uma variedade de leitores de diferentes públicos eidades. A obra "As margens da alegria", de Guimarães Rosa, com ilustrações de NelsonCruz, tem o objetivo de contrapor algumas especificidades de composição visual e detexto. Categorias das artes plásticas (superfície, imagem e da teoria da leitura (leitormodelo,pressuposição ajudam a compreender esse fenômeno que se tornou modelode letramento: o livro de literatura infantil. Dessa forma, a concepção de juventude ede leitura para o jovem vem sendo reavaliada para que sejam incluídas outras formasde texto e, nelas, a literatura.

  12. Ciuda tu corazón, es para toda la vida -Para Disfrutar la Música Clasica

    OpenAIRE

    2012-01-01

    Cuida tu corazón, es para toda la vida. Importantelibro de información sobre prevenciónde de las enfermedades cardiovasculares,dirigido a la comunidad en general.Hace parte de la colección de libros sobre prevención primaria: “Cuidatu corazón, vive mejor” que desde hace varios años viene publicandoel profesor, doctor Fernando Manzur Jattin, desde su grupo de investigación:“Centro de Investigaciones Biomédicas”, perteneciente a laFacultad de Medicina de la Universidad de Cartagena y Categoriza...

  13. DESARROLLO DE TECNOLOGIAS PARA EL CULTIVO DE CELULAS DE PIEL PARA TRANPLANTE AUTOLOGO

    OpenAIRE

    YOUNG A., MANUEL

    2003-01-01

    En Chile se estima que, cada año se ven afectadas 268.865 personas por quemaduras que requieren atención médica. De estos, 60.494 corresponden a quemaduras del tipo AB y B que requieren de tratamiento quirúrgico y posterior rehabilitación debido a su gravedad, dándose además frecuentemente la situación crítica de decesos. Otras lesiones severas de la piel la constituyen las ulceraciones, siendo la principal causa de amputación no traumática del pie. Para casos como quemaduras, el tratamien...

  14. Inteligencia para la alimentación, alimentación para la inteligencia

    OpenAIRE

    Oscar Prospéro-García; Mónica Méndez Díaz; Ilia Alvarado Capuleño; Marcel Pérez Morales; Jehú López Juárez; Alejandra E. Ruiz Contreras

    2013-01-01

    Comer es una conducta dirigida a conseguir la energía para llevar a cabo las funciones que mantienen al organismo y le permiten contender contra las demandas del medio. Debido a que nuestro organismo evolucionó dentro de un ambiente con escasez de alimentos, los genes que nos adaptaron al medio fueron los que promueven el almacenamiento y optimización de los nutrientes, así como aquellos que promueven la habilidad de generar estrategias de cacería y otras conductas orientadas a ese objetivo. ...

  15. Epistemologías para el Humanismo desde la Filosofía para la paz

    OpenAIRE

    Irene Comins Mingol; Sonia París Albert

    2012-01-01

    El concepto de ciencia ha adoptado desde la modernidad, e influenciado por lo que académicamente viene siendo conocido como el paradigma galileano frente al paradigma aristotélico, unas características que nos llevan a pensar en la objetividad, la neutralidad, la tecnificación y la razón instrumental, entre otras, cuando hablamos de ciencia. Sin embargo, desde la reflexión filosófica han sido varias las propuestas que se han ido construyendo a favor de nuevas epistemologías para las humanidad...

  16. Sanatorio para la infancia, en Munich

    Directory of Open Access Journals (Sweden)

    Haind, Friedrich F.

    1964-10-01

    Full Text Available The main objects to be met in the design this Children's Building were to provide suitable control and protection of the children, adequate working conditions for the nurses, and develop a pleasant family environment. This clinic is an extension of that run by the Sisters of Saint Benedict in Lechnerstrasse, Munich. It consists of two blocks, of 4 and 5 floor levels. It has a semibasement, housing the services, and some spare rooms and other facilities, described in the enclosed plans. The ground floor provides room for 25 beds, for the older boys. On the second floor there are 30 beds for those recently born, whilst the third floor has space for 30 beds for prematurely born babies. The nurses live in the attic, where there are 15 bedrooms, each with two beds, a kitchen and suitable auxiliary facilities. Much thought has been given to the design of details, the general distribution and circulation system has been planned with much care, and the overall functional efficiency of the building as a children's clinic has been kept a paramount factor. All this makes this building an outstanding one among those of this type.Los objetivos principales perseguidos aquí son: conseguir una eficaz vigilancia y protección de los niños; organizar los puestos de trabajo de las enfermeras para que resulten prácticos y agradables, y crear un ambiente familiar La clínica construida —como ampliación de las instalaciones que las Hermanas de San Benito poseen en la calle Lachner, en Munich— comprende dos cuerpos de edificio unidos, de 4 y 5 plantas de altura, respectivamente, y está distribuida del siguiente modo: el semisótano aloja, además de la zona de servicios, una serie de dependencias, que vienen descritas en la respectiva documentación gráfica. La planta baja alberga 25 camas; está destinada a los niños mayores y colegiales; la planta primera, con 30 camas, a los recién nacidos, y la planta segunda, con 30 camas, a la sección de prematuros

  17. Finanzas Modernas para los Mercados Latinoamericanos

    Directory of Open Access Journals (Sweden)

    Manrique Hernández Ramírez

    2013-02-01

    Full Text Available En este artículo se detalla la evolución de la teoría financieramoderna y se mencionan las universidades, mediosde publicación, autores y países que lideran este tipode investigación. También se lleva a cabo un examen de losprogramas de finanzas de las mejores escuelas de negociosa nivel mundial, para lograr establecer un panorama clarode los tópicos más relevantes. Por medio de la investigaciónbibliográfica se busca exponer el progreso que ha presentadoel campo de las finanzas a la luz de la creciente investigacióny su influencia sobre los contenidos de los mejores programasde estudio a nivel mundial. El objetivo final es que las escuelasde negocios latinoamericanas actualicen, con más facilidad,los programas de las maestrías en administración deempresas con énfasis en finanzas.   ABSTRACT The evolution of modern financial theory is detailed. Theuniversities, published media, authors and countries leadingthis type of research are identified. The finance curricula of theworld’s best business schools are examined to obtain a clearview of the topics considered as the most relevant in that focus.The objective of the bibliographical research is to revealthe advances that the finance specialization has had from theperspective of the growing research in this area, and the impactit has also had on the content of the best finance programsof the world. The final goal is to facilitate the actualization ofthe Master in Business Administration with focus on Financeprograms of the Latin American Business Schools.

  18. PERFIL PARA REPRESENTAR UNA ARQUITECTURA DE COMPONENTES EN UML

    Directory of Open Access Journals (Sweden)

    Fernando Orejas Valdés

    2006-04-01

    Full Text Available

    El lenguaje unificado de modelado (Unified Modeling Language, UML es un lenguaje de modelado estándar para problemas generales, sin embargo, es necesario extenderlo para dominios específicos como puede ser el caso de determinadas arquitecturas. Aquí se presenta una extensión mediante un perfil para una arquitectura de componentes y conectores genéricos.

  19. Planificación nutricional para un nadador amateur

    OpenAIRE

    Álvarez Estévez, Antonio

    2014-01-01

    El objetivo de este trabajo es brindar una planificación sobre la correcta nutrición que debe de realizar un deportista amateur durante la temporada. Para llevar a cabo este trabajo, escogimos a un alumno de 3º de Grado de Ciencias de la Actividad Física y el Deporte de la Universidad de Huelva que compite en natación a nivel amateur como sujeto para la realización de la planificación. Para la correcta elaboración de este proyecto es preciso hacer primero un planteamiento sobre las cara...

  20. Cadenas de valor: un enfoque para las agrocadenas

    OpenAIRE

    Yadira Peña; Paula Andrea Nieto Alemán; Fabián Díaz Rodríguez

    2008-01-01

    Este artículo tiene como propósito mostrar elementos de análisis para abordar el tema de las cadenas de valor. Tras una revisión exhaustiva de bibliografía relacionada y aplicada a la agricultura, se dan a conocer herramientas conceptuales que coadyuvan a construir un escenario claro y conducente para que las cadenas logren mejores niveles de competitividad, crecimiento y desarrollo para su entorno. En la primera y segunda parte se desarrolla el concepto de cadena de valor y se muestran los a...

  1. Nuevos índices para evaluar la agrobiodiversidad

    OpenAIRE

    2012-01-01

    Hasta hoy, la agrobiodiversidad ha sido evaluada utilizándose índices que han sido diseñados para estudios del funcionamiento general de los ecosistemas no intervenidos (diversidad Alfa, Beta y Gamma); sin embargo, estos índices no son totalmente funcionales para caracterizar la diversidad de agroecosistemas en función de sus valores utilitarios y aportes medibles para la alimentación humana, de los animales y del recurso suelo, así como de necesidades complementarias asociadas al forta...

  2. Aplicación en plataforma Android para aeropuertos

    OpenAIRE

    Jiménez Díaz, Daniel

    2011-01-01

    Este trabajo realiza el diseño de una aplicación para dispositivo móvil sobre la plataforma creada por Google, Android. La aplicación está pensada para su uso en el aeropuerto. Las funciones de la aplicación intentan trabajar el recorrido completo del cliente del aeropuerto. Implementa un localizador de vehículos, un servicio de mensajería y plantea una solución para la localización en interiores dentro del aeropuerto.

  3. Prototipo para Almacenar y Recuperar Métricas de Software

    Directory of Open Access Journals (Sweden)

    Enrique Luna Ramírez

    2012-01-01

    Full Text Available En este artículo se presenta un prototipo de repositorio para almacenar y recuperar métricas de software, extraídas de proyectos de desarrollo de software mediante herramientas de minería de datos. El repositorio fue diseñado para almacenar las métricas en forma de metadatos y poder recuperarlas mediante alias de identificadores. Para mostrar la operabilidad del repositorio, se presentan ejemplos relativos al proceso de desarrollo de software, en particular, a la construcción de modelos de estimación del tamaño de un proyecto de desarrollo de software.

  4. ¡Trujillo Ahora!: Una ciudad para todos

    OpenAIRE

    Marcela García

    2011-01-01

    Esta presentación muestra quien es y las actividades que llevó a cabo la organización civil Trujillo ¡Ahora! en el marco del proyecto Ciudades Sustentables (RG-K1253). Trujillo fue elegida por el Banco Interamericano de Desarrollo como ciudad piloto para el proyecto de Ciudades Sustentables, a través de la Municipalidad Provincial de Trujillo, como entidad del Estado. Para el efecto, Trujillo ¡Ahora! fue invitada a participar como sociedad civil en para colaborar con su experiencia y conocimi...

  5. ¡Pañales para la literatura infantil!

    Directory of Open Access Journals (Sweden)

    Patricia Londoño

    1985-06-01

    Full Text Available La literatura infantil es un invento reciente: Apareció el siglo pasado en Europa occidental, ligada a la idea de que en educación es más fructífero tratar con niños que con adultos. Se empezó a escribir por separado para los niños, se publicaron libros para transmitirles a los futuros adultos modelos de comportamiento y experiencias colectivas y, en algunos casos, simplemente para proveerlos de un pasatiempo.

  6. Ambiente hipermídia para o ensino da geometria

    OpenAIRE

    Macedo, Claudia Mara Scudelari de

    2004-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Programa de Pós-Graduação em Engenharia de Produção O ensino de geometria nos últimos anos tem se tornado uma tarefa cada vez mais difícil, tanto para os alunos como para os professores. Dentre os fatores que colaboraram para esta situação, destaca-se o despreparo dos professores neste conteúdo nos seus cursos de formação. Da mesma forma, as dificuldades encontradas pelos alunos no entendimento de temas mais avançados como o ...

  7. Sistema Inteligente para el álgebra lineal

    OpenAIRE

    Casas, Laura; Pérez, Olga; Docampo, Lisandra; Mota, Yailé; Coello, Lenniet; González, Isabel; Martín, Ángela

    2013-01-01

    El trabajo describe la concepción del Sistema Inteligente para el Algebra Lineal (SIAL), el cual fue creado por los autores de la investigación. Sus fundamentos teóricos están relacionados con las técnicas de Inteligencia Artificial para clasificar, utilizando el clasificador k-vecinos más cercanos K-NN (Caballero, 2010), así como los cinco problemas tipos del Álgebra Lineal (Yordi, 2004). El SIAL se creó con el objetivo de apoyar al estudiante durante su estudio independiente para brindarle ...

  8. Agenda Nacional para la Igualdad en Discapacidades 2013-2017

    OpenAIRE

    2013-01-01

    La Agenda Nacional para la Igualdad en Discapacidades (ANID), documento que fue trabajado por la Secretaría Nacional de Planificación y Desarrollo (SENPLADES) y el Consejo Nacional de Discapacidades (CONADIS), es un instrumento técnico para orientar la gestión de las instituciones públicas hacia el cumplimiento de los derechos de las personas con discapacidad. La ANID 2013-2017 tiene 12 ejes que están planteados de manera armónica con los objetivos del Plan Nacional para el Buen Vivir. Establ...

  9. Red privada virtual como alternativa para el acceso remoto

    OpenAIRE

    2010-01-01

    La comunicación es esencial para la eficiencia organizacional, pero al efectuarse a grandes distancias, se presentan altos costos y se expone información vital. Debido a esto, se propone diseñar una Red Privada Virtual como alternativa para el acceso remoto en ambientes corporativos donde empleados, clientes y socios comerciales puedan intercambiar información de forma económica y segura. Para ello, se realizó una investigación no experimental,...

  10. Controlador fuzzy de dos etapas para frenos ABS

    OpenAIRE

    2003-01-01

    [ESP] En este artículo se presenta un nuevo controlador fuzzy jerárquico de dos etapas para sistemas ABS. En una primera etapa el controlador estima el deslizamiento que ha de tener la rueda del vehículo para conseguir la mejor frenada posible en función del tipo de firme y en una segunda calcula cual debe ser el par de frenado más adecuado para cada instante. [ENG]In this article a new two-stages hierarchical fuzzy controller for Anti-lock Braking Systems is presented. In the ...

  11. Estrategia de desarrollo del sector privado (PSDS) para Chile

    OpenAIRE

    Roberto Zahler

    2006-01-01

    El objetivo de este informe es desarrollar el "outline" elaborado por el BID, para perfilar una propuesta de estrategia que podría ser adoptada por el Banco para apoyar el desarrollo del sector privado en Chile. El informe sostiene que el sector público chileno viene desarrollando, desde hace tiempo políticas de desarrollo que, acompañadas por una interacción con el sector privado (buscando un adecuado marco de actuación para las actividades de éste), han constituido un éxito en la Región. Es...

  12. Aspectos esenciales de condicionales para los contratos sensibles al contexto

    OpenAIRE

    Sartorio, Alejandro R.; Rodríguez, Guillermo L.; Vaquero, Marcelo

    2011-01-01

    Teniendo en cuenta los aspectos tecnológicos y de diseño de los mecanismos de inyección de contratos sensibles al contexto en el Dispositivo Hipermedial Dinámico (DHD), se desarrollan tres tipos de condicionales para las reglas de los contratos que representan información de contexto. A su vez se presenta un modelo conceptual de condicionales donde se capturan aspectos esenciales para el framework colaborativo Sakai utilizado para la implementación tecnológica del DHD en el agregado de nuevas...

  13. Antena horn para operación en banda ancha

    OpenAIRE

    Criollo Velásquez, Edgar Hernando

    2013-01-01

    En el trabajo presentado se diseña una antena de campana con doble joroba (DRHA) para implementaciones de banda ancha, diseñada para operar en la banda de frecuencias de 1.8 - 18 GHz. El objetivo es disminuir el deterioro en el VSWR y el patrón de radiación para el rango superior de la banda de frecuencias introduciendo novedosas codificaciones estructurales sobre una DRHA convencional. La nueva antena tiene un VSWR menor de 2.5, una ganancia máxima superior a 10 dBi y un patrón de radiación ...

  14. OBSERVADOR ADAPTABLE PARA TANQUES PRISMÁTICOS ABIERTOS

    OpenAIRE

    SA Rodríguez; J De-León; J Barajas-Fernández; F. RIVERA-TREJO

    2010-01-01

    En este trabajo se presenta el diseño de un observador adaptable, esto es un sensor computacional, el cual será utilizado para estimar el caudal de entrada y algunos parámetros difíciles de medir en un tanque abierto, entre estos el coeficiente de descarga. Por medio de un sistema no lineal, se propone un modelo matemático para un tanque abierto. Además, se presentan condiciones suficientes para garantizar la convergencia de dicho observador. Resultados de simulación muestran las posibles apl...

  15. Propuesta de arquitectura segura para b-learning utilizando patrones

    OpenAIRE

    David L. La Red Martínez; Acosta, Julio César

    2012-01-01

    En este trabajo se trata el problema de integrar la perspectiva tecnológica con la pedagógica, brindando una arquitectura para sistemas de blearning. Se adoptan principios educativos comprobados del enfoque centrado en la persona (person-centered approach) para impulsar procesos educativos, con utilización de la TICs de manera segura. Se propone un modelo en capas capaz de brindar soporte basado en Web para estos principios educativos. El trabajo se centra en la propuesta de una arquitectura ...

  16. MECANISMOS UTILIZADOS PARA MONITOREAR EL PODER DE MERCADO EN MERCADOS ELÉCTRICOS: REFLEXIONES PARA COLOMBIA

    Directory of Open Access Journals (Sweden)

    Jesús Alonso Botero

    2013-12-01

    Full Text Available El propósito de este trabajo es analizar la viabilidad de la utilización del índice de oferta residual (IOR en el mercado eléctrico mayorista en Colombia, con el fin de promover la competencia. Esto se hace a partir de la revisión de la literatura relacionada con las experiencias internacionales respecto a los mecanismos para monitorear el poder de mercado y del análisis del Documento 118 de la Comisión de Regulación de Energía y Gas (CREG, 2010. La principal conclusión es que el IOR no es un buen mecanismo de control en mercados hidráulicos, mientras que el desarrollo de los mercados de largo plazo ha sido utilizado con gran éxito para mitigar el riesgo de abuso de poder de mercado, seg°n lo muestra la experiencia internacional.

  17. Época apropriada para a poda apical do algodoeiro para o controle de pragas

    Directory of Open Access Journals (Sweden)

    Robério Carlos dos Santos Neves

    2010-12-01

    Full Text Available O objetivo deste trabalho foi determinar a época apropriada para a realização da poda apical em algodoeiro. O trabalho foi realizado durante as safras de 2008 e 2009 (maio a novembro em delineamento de blocos ao acaso, em dois ambientes, com as variedades: BRS 201, de fibra branca, e BRS Rubi, BRS Safira e BRS Verde, de fibra colorida, em Paudalho, PE; e BRS 201 e BRS Rubi, em Surubim, PE. A poda apical consistiu na retirada dos ápices das plantas com estruturas vegetativas e reprodutivas, em duas idades fenológicas: com 50% das maçãs maduras (poda I e no surgimento dos primeiros capulhos (poda II. A poda I resultou em maior retirada de botões florais do que a poda II. Em ambas as podas, houve a retirada de cinco nós dos ponteiros. A produção e a qualidade de fibra não diferiram entre plantas podadas ou não. Um número significativo de estruturas atacadas foi eliminado pela poda. A poda apical é recomendada para reduzir o número de estruturas não produtivas, ao final da safra, que são utilizadas como hospedeiras de pragas

  18. Los productos de chagra para la vida y para la salud

    Directory of Open Access Journals (Sweden)

    Adelaida Rodríguez

    2014-09-01

    Full Text Available Este trabajo fue escrito por la autora a partir del conocimiento de sus padres, de las etnias nonuya y muinane, en el medio río Caquetá (Amazonia colombiana, con el apoyo de una beca de investigación propia de la Tropenbos Internacional Colombia. El artículo destaca la importancia y significado de la chagra para los indígenas y explica cómo eran las chagras en tiempos anteriores, los trabajos involucrados en la preparación de una chagra nueva (socola, tumba, quema, siembra y mantenimiento, la manera de sembrar las diferentes especies, las especies y variedades sembradas en la chagra, los cambios que se han dado en las chagras que se hacen hoy en día, y el proceso para extraer el almidón de yuca y preparar la yuca amarilla de donde se obtiene la fariña. Incluye un glosario con la identificación biológica de nombres de plantas y animales, con explicación de términos en lengua muinane o español local.

  19. Para uma sociologia do carisma na atualidade: ensaio para leitura do carisma de Samora Machel.

    Directory of Open Access Journals (Sweden)

    Hélio Bento Maúngue

    2014-07-01

    Full Text Available http://dx.doi.org/10.5007/1806-5023.2014v11n1p91   O presente artigo é uma analisa sobre os usos e apropriações feitas da personalidade e qualidades carismáticas de Samora Machel. Pretendemos demonstrar que depois de morto o seu carisma prevalece e perdura no cotidiano, bem como que a relação emocional entre o líder e o povo continua. Apontamos que, nos dias atuais políticos, artistas, bem como cidadãos em geral fazem uso e apropriam-se, de modo racional e calculista, do carisma samoriano para obter benesses. Apontamos também que ainda hoje é Samora que as pessoas apelam e chamam para a resolução da grande maioria dos problemas da sociedade moçambicana. Assim, desencadeia-se um uso e apropriação político, socioeconômico e sociocultural do carisma samoriano. Tal uso e apropriação tornam o carisma um fenômeno objetivado e rotinizado.

  20. UTILIZANDO O MÉTODO TODIM PARA AVALIAR AS MELHORES EMPRESAS PARA TRABALHAR

    Directory of Open Access Journals (Sweden)

    Renato Teixeira da Silva

    2011-06-01

    Full Text Available Este artigo expõe uma nova proposta de ordenação das 5 melhores empresas para trabalhar em termos de qualidade do ambiente de trabalho e qualidade na gestão de pessoas utilizando-se do método TODIM como suporte científico para tal. A ordenação inicial, proposta pela revista Você/SA Exame, utiliza como método classificador o índice de felicidade no trabalho, uma soma ponderada de índices resultantes da percepção dos funcionários, das práticas da empresa e da constatação feita por jornalistas em visitas às empresas. Este trabalho, que utiliza o método TODIM, considera esses itens como critérios de avaliação e realiza uma análise comparativa das alternativas. Ao final, é executada uma comparação entre as ordenações e uma análise de sensibilidade, analisando as especificidades de cada método de ordenação e a consistência de seus resultados.

  1. Tecnologías apropiadas para abastecimiento de agua y saneamiento en la Zona Andina para poblaciones rurales y aisladas

    OpenAIRE

    2013-01-01

    En el texto que viene a continuación se describen las tecnologías más importantes utilizadas en las zonas rurales de la cordillera andina para el abastecimiento de agua y saneamiento. Se trata de tecnología apropiada, ya que otra no podría ser aplicable debido a las peculiaridades de la misma. Entre ellas se analizaran las distintas estructuras para el abastecimiento de agua, distintos tipos de letrinas y un sistema para el tratamiento de aguas grises. También brevemente haremos hincapié ...

  2. Arquitectura para la interconectividad de la tecnología Bluetooth con redes IP cableadas para transporte de voz

    OpenAIRE

    Reinoso R., Daryan F.; Guzmán F., Juan P.; Hurtado G., Javier A.; Caicedo, Oscar Mauricio; Martínez, Francisco Orlando

    2008-01-01

    En el presente documento se estudian los criterios y requerimientos tecnológicos necesarios para la construcción de una arquitectura que permita la interconectividad de Bluetooth con redes Ethernet como base para la prestación de servicios de VoIP; adicionalmente se detallan los resultados obtenidos a partir de un proceso de validación de la arquitectura con base en la simulación de una serie de scenarios y un análisis de desempeño de un prototipo funcional para la prestación de dichos servi...

  3. Filosofia africana para descolonizar olhares: perspectivas para o ensino das relações étnico-raciais

    OpenAIRE

    Machado, Adilbênia Freire; UNIVERSIDADE FEDERAL DA BAHIA

    2014-01-01

    Resumo: O texto traz uma teia que tem como centro a Filosofia Africana; para se chegar a esse centro, no intento de trazer contribuições e perspectivas outras para “descolonizar olhares” e implicando perspectivas para o ensino das relações étnico-raciais, três conceitos fundamentais serão trabalhados: ancestralidade, encantamento e alteridade. Sabe-se que a filosofia, por séculos, fora usada como meio de colonização, justificando as barbáries cometidas em nome de uma “civilização”, usurpando ...

  4. Linux embebido en FPGA para sistemas de monitoreo industrial

    Directory of Open Access Journals (Sweden)

    José F. Carmona Martínez

    2013-03-01

    Full Text Available Actualmente la obtención en FPGA (Field Programmable Gate Array de módulos independientes para aplicaciones específicas de monitoreo industrial, ha hecho que su reutilización e integración sea compleja y que los tiempos de desarrollo y puesta a punto de los mismos sean considerablemente elevados. En este trabajo se propone una solución a este problema basada en embeber Linux en un FPGA, específicamente utilizando el kit Spartan3AN. Las herramientas de codiseño hardware/software utilizadas para lograr este objetivo han permitido tener resultados a corto plazo, que indican el enfoque para futuras investigaciones. De manera que se logró ejecutar aplicaciones de uso general para el control de ip-cores empotrados en hardware reconfigurable. La plataforma obtenida es estable y flexible a futuras implementaciones tanto de software como de hardware.

  5. Processamento do milho para vacas leiteiras em pastejo

    Directory of Open Access Journals (Sweden)

    A.M. Moura

    2014-12-01

    Full Text Available Doze vacas lactantes Holandês-Gir (1/2, em sistema de pasto rotativo de Panicum maximum cv. Mombaça, foram suplementadas com concentrados contendo milho seco finamente moído (MM, milho expandido (ME, milho floculado a vapor (MF ou milho moído reidratado e ensilado (MU. O delineamento experimental adotado foi o de quadrado latino 4 x 4, com três repetições. O consumo de pasto foi maior quando as vacas foram suplementadas com MF, o que se refletiu em maior consumo de MS, PB, FDN para o mesmo tratamento. A digestibilidade aparente da MS foi maior para as dietas de MF e MM. A digestibilidade aparente da FDN foi menor para MU. A produção e composição do leite das vacas não diferiram entre os tratamentos, entretanto a eficiência alimentar foi menor para MF.

  6. Novo teste para diagnóstico das afasias

    Directory of Open Access Journals (Sweden)

    José G. Albernaz

    1953-06-01

    Full Text Available Um novo teste para diagnóstico e contrôle do tratamento das diferentes formas de afasia, especialmente adaptado para a língua portuguêsa, é apresentado e descrito em detalhe. O teste, que será de valor para clínicos e psicólogos interessados no tratamento e reabilitação de pacientes afásicos, se executa em cêrca de 30 minutos, interpreta-se fàcilmente e fornece os elementos necessários para o planejamento da reeducação da linguagem. Além disso, a repetição do teste de tempos em tempos indicará os progressos do paciente e sugerirá modificações do plano de tratamento no momento oportuno.

  7. Registros nuevos de especies de Leucospidae (Hymenoptera: Chalcidoidea para Colombia

    Directory of Open Access Journals (Sweden)

    Arias Penna Diana Carolina

    2008-12-01

    Full Text Available Dos especies de Leucospis se reportan por primera vez para Colombia Leucospis aliena y Leucospis enderleini. Teniendo en cuenta estos nuevos registros, el número de especies de Leucospis reportadas para el país se eleva a 11. Además se reporta una nueva localidad en Colombia para Leucospis colombiana en el departamento del Magdalena y un registro adicional para Polistomorpha conura en el departamento del Amazonas. Los especímenes se encuentran depositados en la colección entomológica del Museo José Hernández Camacho del Instituto de Investigación de Recursos Biológicos Alexander von Humboldt (IAvH-E, Villa de Leyva (Boyacá, Colombia.

  8. Confianza y capital social: evidencia para México

    Directory of Open Access Journals (Sweden)

    Rubén Martínez-Cárdenas

    2015-01-01

    Full Text Available Desde la perspectiva económica la confianza entre los miembros de una sociedad está asociada al funcionamiento eficiente de los mercados, al reforzamiento de contratos y, en general, a la capacidad para generar desarrollo y bienestar. En este artículo exploramos empíricamente los determinantes de la confianza en México, en particular, aislamos la relación entre dos medidas de capital social, una para el individuo y otra para su entorno. Nuestros resultados muestran que la confianza aumenta con estas medidas de capital social y con ausencia de se - gregación es mayor en comunidades pequeñas, a mayor edad y para habitantes del centro-occidente, entre otras.

  9. Diez consejos para prevenir infecciones durante el embarazo

    Centers for Disease Control (CDC) Podcasts

    2007-12-14

    Este podcast ofrece 10 consejos para prevenir infecciones durante el embarazo.  Created: 12/14/2007 by National Center for Birth Defects and Developmental Disabilities (NCBDDD).   Date Released: 2/27/2008.

  10. INTRODUCCION A LA ESTADISTICA PARA ECONOMISTAS AGRICOLAS USANDO EL SPSS

    OpenAIRE

    2003-01-01

    Este documento es un manual de estadística para economistas aplicados que usan el programa estadístico SPSS. Está diseñado para ser usado dentro de un taller de capacitación de una semana, y tiene como propósito familiarizar a profesionales de la investigación con procedimientos estadísticos básicos, necesarios para realizar análisis socioeconómicos a datos que provienen de encuestas. Este documento es una introducción para los usuarios en la creación y manipulación de las bases de datos, en ...

  11. Preparando um ambiente de desenvolvimento para a plataforma android

    Directory of Open Access Journals (Sweden)

    Felipe Pires de Oliveira

    2015-11-01

    Full Text Available Este artigo descreve as etapas para a criação de um ambiente de desenvolvimento para a plataforma Android. O artigo foi dividido em quatro partes: Primeiro uma introdução sobre o assunto. Na segunda seção são mostrados os passos necessários para a configuração do ambiente de desenvolvimento. Na terceira seção, é demonstrado como criar uma aplicação para dispositivo Android que calculo Índice de Massa Corporal (IMC. A quarta seção apresenta as considerações finais. A solução abordada tem como base a IDE Eclipse e o SDK do Android, bem como o Kit de Desenvolvimento Java da Oracle (JDK.

  12. Preparando um ambiente de desenvolvimento para a plataforma android

    Directory of Open Access Journals (Sweden)

    Felipe Pires de Oliveira

    2015-12-01

    Full Text Available Este artigo descreve as etapas para a criação de um ambiente de desenvolvimento para a plataforma Android. O artigo foi dividido em quatro partes: Primeiro uma introdução sobre o assunto. Na segunda seção são mostrados os passos necessários para a configuração do ambiente de desenvolvimento. Na terceira seção, é demonstrado como criar uma aplicação para dispositivo Android que calculo Índice de Massa Corporal (IMC. A quarta seção apresenta as considerações finais. A solução abordada tem como base a IDE Eclipse e o SDK do Android, bem como o Kit de Desenvolvimento Java da Oracle (JDK.

  13. Ciclo Hápticos: Para Quinteto de Sopros

    Directory of Open Access Journals (Sweden)

    Jorge Luiz de Lima Santos

    2016-06-01

    Full Text Available Memorial e partitura de Ciclo Hápticos, escrita em 2014 para quinteto de sopros. O memorial descreve brevemente as ferramentas metodológicas empregadas para o planejamento e criação da obra. De um lado, para produção do material melódico-harmônico foi empregado o Sistema-Gr de composição musical, desenvolvido por Carlos Almada (2014. Do outro lado, para organização formal, utilizamos o software Partitions - que faz parte do conjunto de programas do Parsemat, elaborado por Pauxy Gentil-Nunes (2009 – o qual informa o conjunto total de possibilidades de partições de um dado número.

  14. Estimación del efecto escuela para Colombia

    Directory of Open Access Journals (Sweden)

    Olga Rosalba Rodríguez-Jiménez

    2011-01-01

    Full Text Available El estudio presenta la estimación de la magnitud del efecto escolar para Colombia a partir de los datos del Segundo Estudio Regional Comparativo y Explicativo, SERCE. La muestra estuvo conformada por 7.236 estudiantes y 155 escuelas de 3º y 6º de básica. Para el análisis se ajustaron modelos multinivel de dos niveles con las variables índice socioeconómico, nivel cultural, género, preescolarización, lengua materna, puntaje en matemáticas y lenguaje. Los resultados señalan un efecto entre 6% y 23%, mayor para Lectura que para Matemáticas, al igual que diferencias entre las escuelas a partir de las diferencias socioculturales y socioeconómicas de los alumnos y la escuela.

  15. Significado de ser docente para el adulto mayor sanfernandino

    OpenAIRE

    Martina, Martha; Facultad de Medicina, UNMSM; Santos, Gladys; Facultad de Medicina, UNMSM; Lema, Julia; Facultad de Medicina, UNMSM

    2013-01-01

    Objetivos: Comprender el significado de ser docente para el adulto mayor de la Facultad de Medicina de San Marcos y describir las motivaciones que determinan, de alguna forma, su decisión de postergar su retiro, no obstante haber cumplido con los requisitos legales para la jubilación. Diseño: Estudio de caso cualitativo. Institución: Facultad de Medicina, UNMSM. Participantes: Docentes adulto mayores de la Facultad de Medicina. Intervenciones: Entrevista a profundidad. Principales medidas de ...

  16. Dikadoa (Una ópera para Philip Glass

    Directory of Open Access Journals (Sweden)

    Alfonso Zurro

    2012-04-01

    Full Text Available Texto cedido para esta publicación por el autor. Ha sido escrita pensada para ser puesta en escena utilizando nuevas tecnologías teatrales y de la comunicación. Como autor, de sus obras estrenadas, cabe destacar: Farsas Maravillosas, Bufonerías, Quién mal anda, A solas con Marilyn, El extraordinario vuelo de los ángeles.

  17. Las nuevas normas españolas para cemento

    Directory of Open Access Journals (Sweden)

    Calleja, José

    1976-12-01

    Full Text Available Not availableSeñores: Es para mí un alto honor, que no es la primera vez que recibo de la fraternal amistad de ustedes los hermanos argentinos, el haber sido invitado por el Instituto Nacional de Tecnología Industrial (INTI con la colaboración del Instituto del Cemento Portland Argentino (ICPA, para departir sobre temas que profesionalmente nos interesan y preocupan.

  18. Laboratorio para diseño de experiencia de usuario

    OpenAIRE

    David Silva Barrera; Yanicet Aveleira Rodríguez

    2012-01-01

    El artículo aborda la situación actual del diseño de experiencia de usuarios para los sistemas informáticos. Refleja la necesidad de encontrar una solución favorable para los usuarios.  Propone entonces el montaje de un laboratorio de diseño de experiencia de usuario que brinde servicios en la empresa. La propuesta incluye la descripción de los elementos que deben incorporarse en el laboratorio.

  19. Construccionismo: objetos para pensar, entidades públicas y micromundos

    OpenAIRE

    Eleonora Badilla Saxe; Alejandra Chacón Murillo

    2011-01-01

    Este artículo presenta una perspectiva pedagógica de la teoría educativa denominada Construccionismo, propuesta por Seymour Papert sobre la base del Constructivismo de Jean Piaget. Papert considera las computadoras como semillas culturales que pueden ejercer una poderosa influencia en el pensamiento de las personas. En particular, se abordan tres de los conceptos clave para el Construccionismo: objetos para pensar, entidades públicas y micromundos. This article presents a pedagogical perspe...

  20. Construccionismo: Objetos para pensar, entidades públicas y micromundos

    Directory of Open Access Journals (Sweden)

    Eleonora Badilla Saxe

    2004-01-01

    Full Text Available Este artículo presenta una perspectiva pedagógica de la teoría educativa denominada Construccionismo, propuesta por Seymour Papert sobre la base del Constructivismo de Jean Piaget. Papert considera las computadoras como semillas culturales que pueden ejercer una poderosa influencia en el pensamiento de las personas. En particular, se abordan tres de los conceptos clave para el Construccionismo: objetos para pensar, entidades públicas y micromundos