WorldWideScience

Sample records for cfd modelling approach

  1. A CFD Approach to Modeling Spacecraft Fuel Slosh

    Science.gov (United States)

    Marsell, Brandon; Gangadharan, Sathya; Chatman, Yadira; Sudermann, James; Schlee, Keith; Ristow, James E.

    2009-01-01

    Energy dissipation and resonant coupling from sloshing fuel in spacecraft fuel tanks is a problem that occurs in the design of many spacecraft. In the case of a spin stabilized spacecraft, this energy dissipation can cause a growth in the spacecrafts' nutation (wobble) that may lead to disastrous consequences for the mission. Even in non-spinning spacecraft, coupling between the spacecraft or upper stage flight control system and an unanticipated slosh resonance can result in catastrophe. By using a Computational Fluid Dynamics (CFD) solver such as Fluent, a model for this fuel slosh can be created. The accuracy of the model must be tested by comparing its results to an experimental test case. Such a model will allow for the variation of many different parameters such as fluid viscosity and gravitational field, yielding a deeper understanding of spacecraft slosh dynamics. In order to gain a better understanding of the dynamics behind sloshing fluids, the Launch Services Program (LSP) at the NASA Kennedy Space Center (KSC) is interested in finding ways to better model this behavior. Thanks to past research, a state-of-the-art fuel slosh research facility was designed and fabricated at Embry Riddle Aeronautical University (ERAU). This test facility has produced interesting results and a fairly reliable parameter estimation process to predict the necessary values that accurately characterize a mechanical pendulum analog model. The current study at ERAU uses a different approach to model the free surface sloshing of liquid in a spherical tank using Computational Fluid Dynamics (CFD) methods. Using a software package called Fluent, a model was created to simulate the sloshing motion of the propellant. This finite volume program uses a technique called the Volume of Fluid (VOF) method to model the interaction between two fluids [4]. For the case of free surface slosh, the two fluids are the propellant and air. As the fuel sloshes around in the tank, it naturally

  2. Development of CFD Approaches for Modeling Advanced Concepts of Nuclear Thermal Propulsion Test Facilities Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The project will be developing a CFD approach that can handle the additional complexities needed in a NTP testing facility when modeling the combustion processes in...

  3. CFD Modeling of Wall Steam Condensation: Two-Phase Flow Approach versus Homogeneous Flow Approach

    Directory of Open Access Journals (Sweden)

    S. Mimouni

    2011-01-01

    Full Text Available The present work is focused on the condensation heat transfer that plays a dominant role in many accident scenarios postulated to occur in the containment of nuclear reactors. The study compares a general multiphase approach implemented in NEPTUNE_CFD with a homogeneous model, of widespread use for engineering studies, implemented in Code_Saturne. The model implemented in NEPTUNE_CFD assumes that liquid droplets form along the wall within nucleation sites. Vapor condensation on droplets makes them grow. Once the droplet diameter reaches a critical value, gravitational forces compensate surface tension force and then droplets slide over the wall and form a liquid film. This approach allows taking into account simultaneously the mechanical drift between the droplet and the gas, the heat and mass transfer on droplets in the core of the flow and the condensation/evaporation phenomena on the walls. As concern the homogeneous approach, the motion of the liquid film due to the gravitational forces is neglected, as well as the volume occupied by the liquid. Both condensation models and compressible procedures are validated and compared to experimental data provided by the TOSQAN ISP47 experiment (IRSN Saclay. Computational results compare favorably with experimental data, particularly for the Helium and steam volume fractions.

  4. Comparing different CFD wind turbine modelling approaches with wind tunnel measurements

    Science.gov (United States)

    Kalvig, Siri; Manger, Eirik; Hjertager, Bjørn

    2014-12-01

    The performance of a model wind turbine is simulated with three different CFD methods: actuator disk, actuator line and a fully resolved rotor. The simulations are compared with each other and with measurements from a wind tunnel experiment. The actuator disk is the least accurate and most cost-efficient, and the fully resolved rotor is the most accurate and least cost-efficient. The actuator line method is believed to lie in between the two ends of the scale. The fully resolved rotor produces superior wake velocity results compared to the actuator models. On average it also produces better results for the force predictions, although the actuator line method had a slightly better match for the design tip speed. The open source CFD tool box, OpenFOAM, was used for the actuator disk and actuator line calculations, whereas the market leading commercial CFD code, ANSYS/FLUENT, was used for the fully resolved rotor approach.

  5. Comparing different CFD wind turbine modelling approaches with wind tunnel measurements

    International Nuclear Information System (INIS)

    The performance of a model wind turbine is simulated with three different CFD methods: actuator disk, actuator line and a fully resolved rotor. The simulations are compared with each other and with measurements from a wind tunnel experiment. The actuator disk is the least accurate and most cost-efficient, and the fully resolved rotor is the most accurate and least cost-efficient. The actuator line method is believed to lie in between the two ends of the scale. The fully resolved rotor produces superior wake velocity results compared to the actuator models. On average it also produces better results for the force predictions, although the actuator line method had a slightly better match for the design tip speed. The open source CFD tool box, OpenFOAM, was used for the actuator disk and actuator line calculations, whereas the market leading commercial CFD code, ANSYS/FLUENT, was used for the fully resolved rotor approach

  6. CFD Approaches for Modelling Bubble Entrainment by an Impinging Jet

    Directory of Open Access Journals (Sweden)

    Martin Schmidtke

    2009-01-01

    Full Text Available This contribution presents different approaches for the modeling of gas entrainment under water by a plunging jet. Since the generation of bubbles happens on a scale which is smaller than the bubbles, this process cannot be resolved in meso-scale simulations, which include the full length of the jet and its environment. This is why the gas entrainment has to be modeled in meso-scale simulations. In the frame of a Euler-Euler simulation, the local morphology of the phases has to be considered in the drag model. For example, the gas is a continuous phase above the water level but bubbly below the water level. Various drag models are tested and their influence on the gas void fraction below the water level is discussed. The algebraic interface area density (AIAD model applies a drag coefficient for bubbles and a different drag coefficient for the free surface. If the AIAD model is used for the simulation of impinging jets, the gas entrainment depends on the free parameters included in this model. The calculated gas entrainment can be adapted via these parameters. Therefore, an advanced AIAD approach could be used in future for the implementation of models (e.g., correlations for the gas entrainment.

  7. A Multi-Model Approach for Uncertainty Propagation and Model Calibration in CFD Applications

    CERN Document Server

    Wang, Jian-xun; Xiao, Heng

    2015-01-01

    Proper quantification and propagation of uncertainties in computational simulations are of critical importance. This issue is especially challenging for CFD applications. A particular obstacle for uncertainty quantifications in CFD problems is the large model discrepancies associated with the CFD models used for uncertainty propagation. Neglecting or improperly representing the model discrepancies leads to inaccurate and distorted uncertainty distribution for the Quantities of Interest. High-fidelity models, being accurate yet expensive, can accommodate only a small ensemble of simulations and thus lead to large interpolation errors and/or sampling errors; low-fidelity models can propagate a large ensemble, but can introduce large modeling errors. In this work, we propose a multi-model strategy to account for the influences of model discrepancies in uncertainty propagation and to reduce their impact on the predictions. Specifically, we take advantage of CFD models of multiple fidelities to estimate the model ...

  8. CFD modelling approach for dam break flow studies

    Directory of Open Access Journals (Sweden)

    C. Biscarini

    2010-04-01

    Full Text Available This paper presents numerical simulations of free surface flows induced by a dam break comparing the shallow water approach to fully three-dimensional simulations. The latter are based on the solution of the complete set of Reynolds-Averaged Navier-Stokes (RANS equations coupled to the Volume of Fluid (VOF method.

    The methods assessment and comparison are carried out on a dam break over a flat bed without friction, a dam break over a triangular bottom sill and a dam break flow over a 90° bend. Experimental and numerical literature data are compared to present results.

    The results demonstrate that the shallow water approach, even if able to sufficiently reproduce the main aspects of the fluid flows, loses some three-dimensional phenomena, due to the incorrect shallow water idealization that neglects the three-dimensional aspects related to the gravity force.

  9. CFD modelling approach for dam break flow studies

    Directory of Open Access Journals (Sweden)

    C. Biscarini

    2009-11-01

    Full Text Available This paper presents numerical simulations of free surface flows induced by a dam break comparing the shallow water approach to fully three-dimensional simulations. The latter are based on the solution of the complete set of Reynolds-Averaged Navier-Stokes (RANS equations coupled to the Volume of Fluid (VOF method.

    The methods assessment and comparison are carried out on a dam break over a flat bed without friction and a dam break over a triangular bottom sill. Experimental and numerical literature data are compared to present results.

    The results demonstrate that the shallow water approach loses some three-dimensional phenomena, which may have a great impact when evaluating the downstream wave propagation. In particular, water wave celerity and water depth profiles could be underestimated due to the incorrect shallow water idealization that neglects the three-dimensional aspects due to the gravity force, especially during the first time steps of the motion.

  10. CFD modeling using PDF approach for investigating the flame length in rotary kilns

    Science.gov (United States)

    Elattar, H. F.; Specht, E.; Fouda, A.; Bin-Mahfouz, Abdullah S.

    2016-02-01

    Numerical simulations using computational fluid dynamics (CFD) are performed to investigate the flame length characteristics in rotary kilns using probability density function (PDF) approach. A commercial CFD package (ANSYS-Fluent) is employed for this objective. A 2-D axisymmetric model is applied to study the effect of both operating and geometric parameters of rotary kiln on the characteristics of the flame length. Three types of gaseous fuel are used in the present work; methane (CH4), carbon monoxide (CO) and biogas (50 % CH4 + 50 % CO2). Preliminary comparison study of 2-D modeling outputs of free jet flames with available experimental data is carried out to choose and validate the proper turbulence model for the present numerical simulations. The results showed that the excess air number, diameter of kiln air entrance, radiation modeling consideration and fuel type have remarkable effects on the flame length characteristics. Numerical correlations for the rotary kiln flame length are presented in terms of the studied kiln operating and geometric parameters within acceptable error.

  11. Numerical modelling in building thermo-aeraulics: from CFD modelling to an hybrid finite volume / zonal approach; Modelisation numerique de la thermoaeraulique du batiment: des modeles CFD a une approche hybride volumes finis / zonale

    Energy Technology Data Exchange (ETDEWEB)

    Bellivier, A.

    2004-05-15

    For 3D modelling of thermo-aeraulics in building using field codes, it is necessary to reduce the computing time in order to model increasingly larger volumes. The solution suggested in this study is to couple two modelling: a zonal approach and a CFD approach. The first part of the work that was carried out is the setting of a simplified CFD modelling. We propose rules for use of coarse grids, a constant effective viscosity law and adapted coefficients for heat exchange in the framework of building thermo-aeraulics. The second part of this work concerns the creation of fluid Macro-Elements and their coupling with a calculation of CFD finite volume type. Depending on the boundary conditions of the problem, a local description of the driving flow is proposed via the installation and use of semi-empirical evolution laws. The Macro-Elements is then inserted in CFD computation: the values of velocity calculated by the evolution laws are imposed on the CFD cells corresponding to the Macro-Element. We use these two approaches on five cases representative of thermo-aeraulics in buildings. The results are compared with experimental data and with traditional RANS simulations. We highlight the significant gain of time that our approach allows while preserving a good quality of numerical results. (author)

  12. CFD based approach for modeling direct contact condensation heat transfer in two-phase turbulent stratified flows

    International Nuclear Information System (INIS)

    This paper describes a CFD based strategy for the modeling of stratified two-phase flows with heat and mass transfer across a moving steam-water interface due to direct contact condensation. Such flows have been of major importance for example in connection with the analysis of nuclear reactor safety systems, in particular during two-phase Pressurized Thermal Shock (PTS) scenarios. The approach is based on the two-fluid phase-average model. The interfacial friction was modeled by using an Algebraic Interfacial Area Density (AIAD) framework where the drag coefficient is a function of the local flow characteristics. To show the impact of the modeling of interfacial friction the simulation with the AIAD model was compared with a simulation where a constant drag coefficient of 0.44 was used in the whole domain. For the modeling of interfacial heat and mass transfer two correlations for the water heat transfer coefficient based on the penetration theory were utilized. The CFD simulations were validated against a steady-state TOPFLOW-PTS steam/water experiment. In the experiment, very detailed temperature measurements were conducted using special thermocouple lances and infrared thermography. Total condensation rate was determined indirectly by using three different methods. The simulations have shown that the results obtained with the AIAD model are considerably closer to the experimental observations than the results obtained with the constant drag coefficient. The condensation models used in the current study predict quite different total condensation rates. That caused significant differences in the temperature field. The simulations of the TOPFLOW-PTS steam/water experiment with condensation have shown that the proposed CFD modeling approach can be successfully applied for the prediction of temperature field and condensation rate during two-phase Pressurized Thermal Shock scenarios. However, the modeling of turbulent interfacial heat transfer should be improved

  13. MODELING OF MESO-SCALE STRUCTURES IN PARTICLE-FLUID SYSTEMS: THE EMMS/CFD APPROACH

    Institute of Scientific and Technical Information of China (English)

    Ning Yang; Wei Wang; Wei Ge; Jinghai Li

    2005-01-01

    Meso-scale structures existing in the form of particle-rich clusters, streamers or strands in circulating fluidized beds, and of ascending bubble plumes and descending liquid-rich vortices in bubble columns and slurry-bed reactors, as commonly observed, have played an important role in the macro-scale behavior of particle-fluid systems. These meso-scale structures span a wide range of length and time scales, and their origin, evolution and influence are still far from being well understood.Recent decades have witnessed the emergence of computer simulation of particle-fluid systems based on computational fluid dynamic (CFD) models. However, strictly speaking these models are far from mature and the complex nature of particle-fluid systems arising from the meso-scale structures has been posing great challenges to investigators. The reason may be that the current two-fluid models (TFM) are derived either from continuum mechanics by using different kinds of averaging techniques for the conservation equations of single-phase flow, or from the kinetic theory of gases in which the assumption of molecular chaos is employed, thereby losing sight of the meso-scale heterogeneity at the scale of computational cells and leading to inaccurate calculation of the interaction force between particles and fluids. For example, the overall drag force for particles in a cell is usually calculated from the empirical Wen & Yu/Ergun correlations,which should be suspected since these correlations were originally derived from homogeneous systems.Schemes to solve this problem for gas-particles systems may be classified into four categories. First, one could capture the detailed meso-scale structure information at the cell scale by employing the so-called direct numerical simulation (DNS) (Hu, 1996), the pseudo-particle modeling (PPM) (Ge & Li, 2003), or the Lattice-Boltzmann method (LBM) to track the interface between gas and particles. Second, refinement of the computational meshes may

  14. MODELING OF MESO-SCALE STRUCTURES IN PARTICLE-FLUID SYSTEMS: THE EMMS/CFD APPROACH

    Institute of Scientific and Technical Information of China (English)

    Ning; Yang; Wei; Wang; Wei; Ge; Jinghai; Li

    2005-01-01

    Meso-scale structures existing in the form of particle-rich clusters, streamers or strands in circulating fluidized beds, and of ascending bubble plumes and descending liquid-rich vortices in bubble columns and slurry-bed reactors, as commonly observed, have played an important role in the macro-scale behavior of particle-fluid systems. These meso-scale structures span a wide range of length and time scales, and their origin, evolution and influence are still far from being well understood.Recent decades have witnessed the emergence of computer simulation of particle-fluid systems based on computational fluid dynamic (CFD) models. However, strictly speaking these models are far from mature and the complex nature of particle-fluid systems arising from the meso-scale structures has been posing great challenges to investigators. The reason may be that the current two-fluid models (TFM) are derived either from continuum mechanics by using different kinds of averaging techniques for the conservation equations of single-phase flow, or from the kinetic theory of gases in which the assumption of molecular chaos is employed, thereby losing sight of the meso-scale heterogeneity at the scale of computational cells and leading to inaccurate calculation of the interaction force between particles and fluids. For example, the overall drag force for particles in a cell is usually calculated from the empirical Wen & Yu/Ergun correlations,which should be suspected since these correlations were originally derived from homogeneous systems.Schemes to solve this problem for gas-particles systems may be classified into four categories. First, one could capture the detailed meso-scale structure information at the cell scale by employing the so-called direct numerical simulation (DNS) (Hu, 1996), the pseudo-particle modeling (PPM) (Ge & Li, 2003), or the Lattice-Boltzmann method (LBM) to track the interface between gas and particles. Second, refinement of the computational meshes may

  15. Comprehensive Approach to Verification and Validation of CFD Simulations Applied to Backward Facing Step-Application of CFD Uncertainty Analysis

    Science.gov (United States)

    Groves, Curtis E.; LLie, Marcel; Shallhorn, Paul A.

    2012-01-01

    There are inherent uncertainties and errors associated with using Computational Fluid Dynamics (CFD) to predict the flow field and there is no standard method for evaluating uncertainty in the CFD community. This paper describes an approach to -validate the . uncertainty in using CFD. The method will use the state of the art uncertainty analysis applying different turbulence niodels and draw conclusions on which models provide the least uncertainty and which models most accurately predict the flow of a backward facing step.

  16. TANK48 CFD MODELING ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.

    2011-05-17

    The process of recovering the waste in storage tanks at the Savannah River Site (SRS) typically requires mixing the contents of the tank to ensure uniformity of the discharge stream. Mixing is accomplished with one to four dual-nozzle slurry pumps located within the tank liquid. For the work, a Tank 48 simulation model with a maximum of four slurry pumps in operation has been developed to estimate flow patterns for efficient solid mixing. The modeling calculations were performed by using two modeling approaches. One approach is a single-phase Computational Fluid Dynamics (CFD) model to evaluate the flow patterns and qualitative mixing behaviors for a range of different modeling conditions since the model was previously benchmarked against the test results. The other is a two-phase CFD model to estimate solid concentrations in a quantitative way by solving the Eulerian governing equations for the continuous fluid and discrete solid phases over the entire fluid domain of Tank 48. The two-phase results should be considered as the preliminary scoping calculations since the model was not validated against the test results yet. A series of sensitivity calculations for different numbers of pumps and operating conditions has been performed to provide operational guidance for solids suspension and mixing in the tank. In the analysis, the pump was assumed to be stationary. Major solid obstructions including the pump housing, the pump columns, and the 82 inch central support column were included. The steady state and three-dimensional analyses with a two-equation turbulence model were performed with FLUENT{trademark} for the single-phase approach and CFX for the two-phase approach. Recommended operational guidance was developed assuming that local fluid velocity can be used as a measure of sludge suspension and spatial mixing under single-phase tank model. For quantitative analysis, a two-phase fluid-solid model was developed for the same modeling conditions as the single

  17. SLURRY FLOW MODELLING BY CFD

    Directory of Open Access Journals (Sweden)

    K.C. Ghanta

    2010-12-01

    Full Text Available An attempt has been made in the present study to develop a generalized slurry flow model using CFD and utilize the model to predict concentration profile. The purpose of the CFD model is to gain better insight into the solid liquid slur¬ry flow in pipelines. Initially a three-dimensional model problem was developed to understand the influence of the particle drag coefficient on the solid concen¬tration profile. The preliminary simulations highlighted the need for correct mo¬delling of the inter phase drag force. The various drag correlations available in the literature were incorporated into a two-fluid model (Euler-Euler along with the standard k- turbulence model with mixture properties to simulate the tur¬bulent solid-liquid flow in a pipeline. The computational model was mapped on to a commercial CFD solver FLUENT6.2 (of Fluent Inc., USA. To push the en¬velope of applicability of the simulation, recent data from Kaushal (2005 (with solid concentration up to 50% was selected to validate the three dimensional simulations. The experimental data consisted of water-glass bead slurry at 125 and 440-micron particle with different flow velocity (from 1 to 5 m/s and overall concentration up to 10 to 50% by volume. The predicted pressure drop and concentration profile were validated by experimental data and showed excel-lent agreement. Interesting findings came out from the parametric study of ve-locity and concentration profiles. The computational model and results discus¬sed in this work would be useful for extending the applications of CFD models for simulating large slurry pipelines.

  18. Modelling of Air Flow trough a Slatted Floor by CFD

    DEFF Research Database (Denmark)

    Svidt, Kjeld; Bjerg, Bjarne; Morsing, Svend;

    In this paper two different CFD-approaches are investigated to model the airflow through a slatted floor. Experiments are carried out in a full-scale test room. The computer simulations are carried out with the CFD-code FLOVENT, which solves the time-averaged Navier-Stokes equations by use of the...

  19. Scavenging Process Analysis in a 2-Stroke Engine by CFD Approach for a Parametric 0D Model Development

    OpenAIRE

    Cagin, Stéphanie; Bourabaa, Nachida; Delacourt, Eric; Morin, Céline; Fischer, Xavier; Coutellier, Daniel; Carré, Bertrand; Loumé, Sylvain

    2015-01-01

    International audience This paper presents a method to improve cylinder design of 2-stroke auto-ignition engine based on a CFD (Computational Fluid Dynamics) study of internal flows in the chamber and an unsteady global 0D parametric approach. In 2-stroke engine, scavenging process plays an important role regarding engine efficiency and pollutant emissions. Several geometrical and environmental parameters (like piston velocity and inlet/outlet thermofluid conditions) impact the scavenging ...

  20. Application of Simple CFD Models in Smoke Ventilation Design

    DEFF Research Database (Denmark)

    Brohus, Henrik; Nielsen, Peter Vilhelm; la Cour-Harbo, Hans;

    2004-01-01

    The paper examines the possibilities of using simple CFD models in practical smoke ventilation design. The aim is to assess if it is possible with a reasonable accuracy to predict the behaviour of smoke transport in case of a fire. A CFD code mainly applicable for “ordinary” ventilation design...... uses a standard k-ε turbulence model. Simulations comprise both steady-state and dynamic approaches. Several boundary conditions are tested. Finally, the paper discusses the prospects of simple CFD models in smoke ventilation design including the inherent limitations....

  1. Modelling a DR shaft operated with pure hydrogen using a physical-chemical and CFD approach

    OpenAIRE

    Ranzani Da Costa, Andrea; Wagner, D.; Patisson, F.; Ablitzer, D.

    2009-01-01

    International audience The hydrogen-based route could be a valuable way to produce steel considering its low carbon dioxide emissions. In ULCOS, it is regarded as a long-term option, largely dependent on the emergence of a hydrogen economy. To anticipate its possible development, it was decided to check the feasibility of using 100% H2 in a Direct Reduction shaft furnace and to determine the best operating conditions, through appropriate experimental and modelling work. We developed from s...

  2. Effects of Temperature on the Wave Soldering of Printed Circuit Boards: CFD Modeling Approach

    Directory of Open Access Journals (Sweden)

    M.S. Abdul Aziz

    2016-01-01

    Full Text Available ABSTRACT This study investigated the effects of temperature on the wave soldering of printed circuit boards (PCBs using three-dimensional finite volume analysis. A computational solder pot model consisting of a six-blade rotational propeller was developed and meshed using tetrahedral elements. The leaded molten solder (Sn63Pb37 distribution and PCB wetting profile were determined using the volume of fluid technique in the fluid flow solver, FLUENT. In this study, the effects of five different molten solder temperatures (456 K, 473 K, 523 K, 583 K, and 643 K on the wave soldering of a 70 mm × 146 mm PCB were considered. The effects of temperature on wetting area, wetting profile, velocity vector, and full wetting time were likewise investigated. Molten solder temperature significantly affected the wetting time and distribution of PCBs. The molten solder temperature at 523 K demonstrated desirable wetting distribution and yielded a stable fountain profile and was therefore considered the best temperature in this study. The simulation results were substantiated by the experimental results.

  3. Simulating fuel assemblies with low resolution CFD approaches

    Energy Technology Data Exchange (ETDEWEB)

    Roelofs, F., E-mail: roelofs@nrg.eu [NRG, Petten (Netherlands); Gopala, V.R. [NRG, Petten (Netherlands); Chandra, L. [IIT Rajasthan (India); Viellieber, M.; Class, A. [KIT, Karlsruhe (Germany)

    2012-09-15

    Highlights: Black-Right-Pointing-Pointer Justification for development of low resolution mesh approaches. Black-Right-Pointing-Pointer Mathematical background of the approaches. Black-Right-Pointing-Pointer Meshing considerations for different approaches are presented. Black-Right-Pointing-Pointer Examples of applications are provided. - Abstract: In addition to the traditional fuel assembly simulations using system codes, subchannel codes or porous medium approaches, as well as detailed CFD simulations to analyze single sub channels, a Low Resolution Geometry Resolving (LRGR) CFD approach and a Coarse-Grid-CFD (CGCFD) approach are taken. Both methods are based on a low resolution mesh that allows the capture of large and medium scale flow features such as recirculation zones, which are difficult to be reproduced by the system codes, subchannel codes and porous media approaches. The LRGR approach allows for instance fine-tuning the porous parameters which are important input for a porous medium approach. However, it should be noted that the prediction of detailed flow features such as secondary flows (small flows in the direction perpendicular to the main flow) is not feasible. Using this approach, the consequences of flow blockages for detection possibilities and cladding temperatures can be discussed. The goal of the CGCFD approach with SGM is that it can be applied to simulate complete fuel assemblies or even complete cores capturing the unique features of the complex flow induced by the fuel assembly geometry and its spacers. In such a case, grids with a very low grid resolution are employed. Within the CGCFD a subgrid model (SGM) accounts for sub grid volumetric forces which are derived from validated CFD simulations. The volumetric forces take account of the non resolved physics due to the coarse mesh. The current paper discusses and presents both, the CGCFD and the LRGR approaches.

  4. Liquid rocket propulsion impeller CFD modeling

    Science.gov (United States)

    Ratcliff, Mark L.; Athavale, Mahesh M.; Thomas, Matthew E.; Williams, Robert W.

    1993-01-01

    Steady-state impeller geometric modeling and typical Navier-Stokes CFD algorithm analysis procedures are assessed using two benchmark quality impeller data sets. Two geometric modeling and grid generation software packages, ICEM-CFD and PATRAN, are considered. Results show that a significant advantage of PATRAN's open-ended architecture is the potential interaction between CFD and structural/thermal analysts inside the mechanical computer-aided engineering environment. However the time required to construct the inducer grid would be unacceptable in a design and engineering environment. The ICEM-CFD package is considered to be more appropriate for structural grid generation but lacks the mature link to structural/thermal analysis arena as compared to PATRAN.

  5. Prediction of gasoline yield in a fluid catalytic cracking (FCC riser using k-epsilon turbulence and 4-lump kinetic models: A computational fluid dynamics (CFD approach

    Directory of Open Access Journals (Sweden)

    Muhammad Ahsan

    2015-07-01

    Full Text Available Fluid catalytic cracking (FCC is an essential process for the conversion of gas oil to gasoline. This study is an effort to model the phenomenon numerically using commercial computational fluid dynamics (CFD software, heavy density catalyst and 4-lump kinetic model. Geometry, boundary conditions and dimensions of industrial riser for catalytic cracking unit are conferred for 2D simulation using commercial CFD code FLUENT 6.3. Continuity, momentum, energy and species transport equations, applicable to two phase solid and gas flow, are used to simulate the physical phenomenon as efficient as possible. This study implements and predicts the use of the granular Eulerian multiphase model with species transport. Time accurate transient problem is solved with the prediction of mass fraction profiles of gas oil, gasoline, light gas and coke. The output curves demonstrate the breaking of heavy hydrocarbon in the presence of catalyst. An approach proposed in this study shows good agreement with the experimental and numerical data available in the literature.

  6. Efficient Turbulence Modeling for CFD Wake Simulations

    DEFF Research Database (Denmark)

    van der Laan, Paul

    Wind turbine wakes can cause 10-20% annual energy losses in wind farms, and wake turbulence can decrease the lifetime of wind turbine blades. One way of estimating these effects is the use of computational fluid dynamics (CFD) to simulate wind turbines wakes in the atmospheric boundary layer. Since...... wind farm, the simulated results cannot be compared directly with wind farm measurements that have a high uncertainty in the measured reference wind direction. When this uncertainty is used to post-process the CFD results, a fairer comparison with measurements is achieved....... this flow is in the high Reynolds number regime, it is mainly dictated by turbulence. As a result, the turbulence modeling in CFD dominates the wake characteristics, especially in Reynolds-averaged Navier-Stokes (RANS). The present work is dedicated to study and develop RANS-based turbulence models...

  7. Modelling Complex Inlet Geometries in CFD

    DEFF Research Database (Denmark)

    Skovgaard, M.; Nielsen, Peter V.

    field. In order to apply CFD for this purpose it is essential to be able to model the inlet conditions precisely and effectively, in a way which is comprehensible to the manufacturer of inlet devices and in a way which can be coped with by the computer. In this paper a universal method is presented and...

  8. Gasificaton Transport: A Multiphase CFD Approach & Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Dimitri Gidaspow; Veeraya Jiradilok; Mayank Kashyap; Benjapon Chalermsinsuwan

    2009-02-14

    The objective of this project was to develop predictive theories for the dispersion and mass transfer coefficients and to measure them in the turbulent fluidization regime, using existing facilities. A second objective was to use our multiphase CFD tools to suggest optimized gasifier designs consistent with aims of Future Gen. We have shown that the kinetic theory based CFD codes correctly compute: (1) Dispersion coefficients; and (2) Mass transfer coefficients. Hence, the kinetic theory based CFD codes can be used for fluidized bed reactor design without any such inputs. We have also suggested a new energy efficient method of gasifying coal and producing electricity using a molten carbonate fuel cell. The principal product of this new scheme is carbon dioxide which can be converted into useful products such as marble, as is done very slowly in nature. We believe this scheme is a lot better than the canceled FutureGen, since the carbon dioxide is safely sequestered.

  9. CFD model of an aerating hydrofoil

    International Nuclear Information System (INIS)

    Improving water quality in the tailrace below hydroelectric dams has become a priority in many river systems. In warm climates, water drawn by the turbine from deep in a reservoir can be deficient in dissolved oxygen (DO), a critical element in maintaining a healthy aquatic ecosystem. Many different solutions have been proposed in order to increase the DO levels in turbine discharge, including: turbine aeration systems (adding air to the water through either the turbine hub, the periphery or through distributed aeration in the runner blades); bubble diffusers in the reservoir or in the tailrace; aerating weirs downstream of the dams; and surface water pumps in the reservoir near the dam. There is a significant potential to increase the effectiveness of these solutions by improving the way that oxygen is introduced into the water; better distributions of bubbles will result in better oxygen transfer. In the present study, a two-phase Computational Fluid Dynamics model has been formulated using a commercial code to study the distribution of air downstream of a simple aerating hydrofoil. The two-phase model uses the Eulerian-Eulerian approach. Appropriate relations are used to model the interphase forces, including the Grace drag force model, the Favre averaged drag force and the Sato enhanced eddy viscosity. The model is validated using experimental results obtained in the water tunnel at the University of Minnesota's Saint Anthony Falls Laboratory. Results are obtained for water velocities between 5 and 10 m/s, air flow rates between 0.5 and 1.5 sL/min and for angles of attack between 0° and -8°. The results of this study show that the CFD model provides a good qualitative comparison to the experimental results by well predicting the wake location at the different flow rates and angles of attack used

  10. CFD model of an aerating hydrofoil

    Science.gov (United States)

    Scott, D.; Sabourin, M.; Beaulieu, S.; Papillon, B.; Ellis, C.

    2014-03-01

    Improving water quality in the tailrace below hydroelectric dams has become a priority in many river systems. In warm climates, water drawn by the turbine from deep in a reservoir can be deficient in dissolved oxygen (DO), a critical element in maintaining a healthy aquatic ecosystem. Many different solutions have been proposed in order to increase the DO levels in turbine discharge, including: turbine aeration systems (adding air to the water through either the turbine hub, the periphery or through distributed aeration in the runner blades); bubble diffusers in the reservoir or in the tailrace; aerating weirs downstream of the dams; and surface water pumps in the reservoir near the dam. There is a significant potential to increase the effectiveness of these solutions by improving the way that oxygen is introduced into the water; better distributions of bubbles will result in better oxygen transfer. In the present study, a two-phase Computational Fluid Dynamics model has been formulated using a commercial code to study the distribution of air downstream of a simple aerating hydrofoil. The two-phase model uses the Eulerian-Eulerian approach. Appropriate relations are used to model the interphase forces, including the Grace drag force model, the Favre averaged drag force and the Sato enhanced eddy viscosity. The model is validated using experimental results obtained in the water tunnel at the University of Minnesota's Saint Anthony Falls Laboratory. Results are obtained for water velocities between 5 and 10 m/s, air flow rates between 0.5 and 1.5 sL/min and for angles of attack between 0° and -8°. The results of this study show that the CFD model provides a good qualitative comparison to the experimental results by well predicting the wake location at the different flow rates and angles of attack used.

  11. Linearised CFD Models for Wakes

    DEFF Research Database (Denmark)

    Ott, Søren; Berg, Jacob; Nielsen, Morten

    from generic look{up tables. Three dierent models, based on three dierent closures, are examined:  - the 'simple closure' using an unperturbed eddy viscosity uz  - the mixing length closure  - the E-ε closure Model results are evaluated against oshore wind farm production data from Horns Rev I...

  12. CFD Modeling of Sodium Fires

    International Nuclear Information System (INIS)

    A sodium cooled fast reactor is one of the attractive concepts for the 4th generation nuclear reactors. For the safety of a sodium cooled fast reactor, sodium-air and sodium-water reactions must be avoided. A sodium-air reaction typically occurs in two dominant modes, namely the spray fire and the pool fire. To avoid sodium-air accidents and to deal with their consequences, it is essential to understand the physical phenomena. Numerical modeling is one of the methods, which can be used to understand all the physics involved. This paper will present new numerical methods to model sodium pool combustion based on advanced state-of-the-art Computational Fluid Dynamics techniques. The models have been developed, implemented and validated against available experimental data of Newman and Payne. (author)

  13. Linearised CFD models for wakes

    Energy Technology Data Exchange (ETDEWEB)

    Ott, S.; Berg, J.; Nielsen, Morten

    2011-12-15

    This report describes the development of a fast and reasonably accurate model for the prediction of energy production in offshore wind farms taking wake effects into account. The model has been implemented as a windows application called Fuga which can run in batch mode or as a graphical user interface. Fuga is briefly described. The model is based on a linearization technique which is described in some detail, and linearized, governing equations are derived and written in a standard form based on a mixed-spectral formulation. A new solution method is used to solve the equations which involves intensive use of look-up tables for storage of intermediate results. Due to the linearity of the model, multiple wakes from many turbines can be constructed from the wake of a single, solitary turbine. These are in turn constructed from Fourier components by a fast Fourier integral transform of results derived from generic look-up tables. Three different models, based on three different closures, are examined: 1) the 'simple closure' using an unperturbed eddy viscosity kucentre dotz. 2) the mixing length closure. 3) the E-epsilon closure. Model results are evaluated against offshore wind farm production data from Horns Rev I and the Nysted wind farm, and a comparison with direct wake measurements in an onshore turbine (Nibe B) is also made. A very satisfactory agreement with data is found for the simple closure. The exception is the near wake, just behind the rotor, where all three linearized models fail. The mixing length closure underestimates wake effects in all cases. The E-epsilon closure overestimates wake losses in the offshore farms while it predicts a too shallow and too wide the wake in the onshore case. The simple closure performs distinctly better than the other two. Wind speed data from the the Horns rev met masts are used to further validate Fuga results with the 'simple' closure. Finally, Roedsand 1 and 2 are used as an example to illustrate

  14. Modeling Pulse Tube Cryocoolers with CFD

    Science.gov (United States)

    Flake, Barrett; Razani, Arsalan

    2004-06-01

    A commercial computational fluid dynamics (CFD) software package is used to model the oscillating flow inside a pulse tube cryocooler. Capabilities for modeling pulse tubes are demonstrated with preliminary case studies and the results presented. The 2D axi-symmetric simulations demonstrate the time varying temperature and velocity fields in the tube along with computation of the heat fluxes at the hot and cold heat exchangers. The only externally imposed boundary conditions are a cyclically moving piston wall at one end of the tube and constant temperature or heat flux boundaries at the external walls of the hot and cold heat exchangers.

  15. CFD modeling of the EPR primary circuit

    International Nuclear Information System (INIS)

    Highlights: • A RANS CFD computation of almost all of the EPR reactor primary circuit is demonstrated. • Comparison with experimental data of the obtained results is carried out. • Hydraulic decoupling between main vessel elements in normal operation is pointed out. • Promising results are found out with regards to nuclear plants’ safety demonstration. - Abstract: The present paper deals with the feasibility of a RANS CFD computation of almost all of the primary circuit of a EPR PWR reactor. The developed model includes the vessel, the core, the steam generators and the associated piping. The flow in the primary circuit is studied under normal operations with balanced flow rates between loops. The k–ε realizable model is retained for the turbulence modeling, and standard wall functions are used as wall treatment. The constructed grid contains about 181,000,000 elements, mainly hexahedrons. The computation is performed with the commercial CFD code STAR-CD, and despite the relatively large amount of cells, such kind of computation is fully accessible at an industrial scale with today available computational resources. A comparison with experimental data of the obtained results is carried out. The simulation results in the vessel are confronted to measurements issued from JULIETTE and ROMEO mock-ups, representative of the EPR lower and upper internals respectively. Regarding the steam generators, a benchmark with the dedicated code GENEPI is also performed. An overall good agreement with the reference data is underlined. The potential up-and-downstream effects of the different modeled components brought interesting knowledge, especially with regards to safety issues. These encouraging results allow in testing, in a near future, this model in other configurations such as unbalanced operation or accidental transients

  16. From EMPD to CFD – overview of different approaches for Heat Air and Moisture modeling in IEA Annex 41

    DEFF Research Database (Denmark)

    Janssens, Arnold; Woloszyn, Monica; Rode, Carsten;

    2008-01-01

    This paper provides an overview of the recent developments of Heat, Air and Moisture modeling of Whole Buildings, which were carried out within a collaborative project of the International Energy Agency. The project has strived to advance the possibilities to calculate the integrated phenomena of...

  17. From EMPD to CFD – overview of different approaches for Heat Air and Moisture modeling in IEA Annex 41

    DEFF Research Database (Denmark)

    Woloszyn, Monika; Rode, Carsten; Kalagasidis, Angela S.;

    2009-01-01

    This paper provides an overview of the recent developments of Heat, Air and Moisture modeling of Whole Buildings, which were carried out within a collaborative project of the International Energy Agency. The project has strived to advance the possibilities to calculate the integrated phenomena of...

  18. CFD modeling and experimental validation of heat and mass transfer in wood poles subjected to high temperatures: a conjugate approach

    Science.gov (United States)

    Younsi, R.; Kocaefe, D.; Poncsak, S.; Kocaefe, Y.; Gastonguay, L.

    2008-03-01

    In this article, a coupling method is presented in the case of high thermal treatment of a wood pole and a three-dimensional numerical simulation is proposed. The conservation equations for the wood sample are obtained using diffusion equation with variables diffusion coefficients and the incompressible Reynolds averaged Navier Stokes equations have been solved for the flow field. The connection between the two problems is achieved by expressing the continuity of the state variables and their respective fluxes through the interface. Turbulence closure is obtained by the use of the standard k ɛ model with the usual wall function treatment. The model equations are solved numerically by the commercial package ANSYS-CFX10. The wood pole was subjected to high temperature treatment under different operating conditions. The model validation is carried out via a comparison between the predicted values with those obtained experimentally. The comparison of the numerical and experimental results shows good agreement, implying that the proposed numerical algorithm can be used as a useful tool in designing high-temperature wood treatment processes. A parametric study was also carried out to determine the effects of several parameters such as initial moisture content, wood aspect ratio and final gas temperature on temperature and moisture content distributions within the samples during heat treatment.

  19. CFD modeling of the IRIS pressurizer dynamic

    Energy Technology Data Exchange (ETDEWEB)

    Sanz, Ronny R.; Montesinos, Maria E.; Garcia, Carlos; Bueno, Elizabeth D.; Mazaira, Leorlen R., E-mail: rsanz@instec.cu, E-mail: mmontesi@instec.cu, E-mail: cgh@instec.cu, E-mail: leored1984@gmail.com [Instituto Superior de Tecnologias y Ciencias Aplicadas (InSTEC), La Habana (Cuba); Bezerra, Jair L.; Lira, Carlos A.B. Oliveira, E-mail: jair.lima@ufpe.br, E-mail: cabol@ufpe.br [Universida Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear

    2015-07-01

    Integral layout of nuclear reactor IRIS makes possible the elimination of the spray system, which is usually used to mitigate in-surge transient and also help to Boron homogenization. The study of transients with deficiencies in the Boron homogenization in this technology is very important, because they can cause disturbances in the reactor power and insert a strong reactivity in the core. The detailed knowledge of the behavior of multiphase multicomponent flows is challenging due to the complex phenomena and interactions at the interface. In this context, the CFD modeling is employed in the design of equipment in the nuclear industry as it allows predicting accidents or predicting their performance in dissimilar applications. The aim of the present research is to model the IRIS pressurizer's dynamic using the commercial CFD code CFX. A symmetric tri dimensional model equivalent to 1/8 of the total geometry was adopted to reduce mesh size and minimize processing time. The model considers the coexistence of four phases and also takes into account the heat losses. The relationships for interfacial mass, energy, and momentum transport are programmed and incorporated into CFX. Moreover, two subdomains and several additional variables are defined to monitoring the boron dilution sequences and condensation-evaporation rates in different control volumes. For transient states a non - equilibrium stratification in the pressurizer is considered. This paper discusses the model developed and the behavior of the system for representative transients sequences. The results of analyzed transients of IRIS can be applied to the design of pressurizer internal structures and components. (author)

  20. Qualification of CFD-models for multiphase flows

    Energy Technology Data Exchange (ETDEWEB)

    Lucas, Dirk [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany)

    2016-05-15

    While Computational Fluid Dynamics (CFD) is already an accepted industrial tool for single phase flows it is not yet mature for two-phase flows. For this reason the qualification of CFD for reactor safety relevant applications which involve multiphase flows is a present topic of research. At the CFD division of Helmholtz-Zentrum Dresden-Rossendorf (HZDR) hereby beside an application-oriented model development and validation also more generic investigations are done. Thus, the baseline model strategy aims on the consolidation of the CFD-modelling for multiphase to enable reliable predictions for well-defined flow pattern in future. In addition the recently developed GENTOP-concept broadens the range of applicability of CFD. Different flow morphologies including transitions between them can be considered in frame of this concept.

  1. Qualification of CFD-models for multiphase flows

    International Nuclear Information System (INIS)

    While Computational Fluid Dynamics (CFD) is already an accepted industrial tool for single phase flows it is not yet mature for two-phase flows. For this reason the qualification of CFD for reactor safety relevant applications which involve multiphase flows is a present topic of research. At the CFD division of Helmholtz-Zentrum Dresden-Rossendorf (HZDR) hereby beside an application-oriented model development and validation also more generic investigations are done. Thus, the baseline model strategy aims on the consolidation of the CFD-modelling for multiphase to enable reliable predictions for well-defined flow pattern in future. In addition the recently developed GENTOP-concept broadens the range of applicability of CFD. Different flow morphologies including transitions between them can be considered in frame of this concept.

  2. CFD modeling of passive autocatalytic recombiners*

    Directory of Open Access Journals (Sweden)

    Orszulik Magdalena

    2015-06-01

    Full Text Available This study deals with numerical modeling of passive autocatalytic hydrogen recombiners (PARs. Such devices are installed within containments of many nuclear reactors in order to remove hydrogen and convert it to steam. The main purpose of this work is to develop a numerical model of passive autocatalytic recombiner (PAR using the commercial computational fluid dynamics (CFD software ANSYS-FLUENT and tuning the model using experimental results. The REKO 3 experiment was used for this purpose. Experiment was made in the Institute for Safety Research and Reactor Technology in Julich (Germany. It has been performed for different hydrogen concentrations, different flow rates, the presence of steam, and different initial temperatures of the inlet mixture. The model of this experimental recombiner was elaborated within the framework of this work. The influence of mesh, gas thermal conductivity coefficient, mass diffusivity coefficients, and turbulence model was investigated. The best results with a good agreement with REKO 3 data were received for k-ɛ model of turbulence, gas thermal conductivity dependent on the temperature and mass diffusivity coefficients taken from CHEMKIN program. The validated model of the PAR was next implemented into simple two-dimensional simulations of hydrogen behavior within a subcompartment of a containment building.

  3. MODELLING MANTLE TANKS FOR SDHW SYSTEMS USING PIV AND CFD

    DEFF Research Database (Denmark)

    Shah, Louise Jivan; Morrison, G.L.; Behnia, Masud

    1999-01-01

    Characteristics of vertical mantle heat exchanger tanks for SDHW systems have been investigated experimentally and theoretically using particle image velocimetry (PIV) and CFD modelling. A glass model of a mantle heat exchanger tank was constructed so that the flow distribution in the mantle could...... be studied using the PIV test facility. Two transient three-dimensional CFD-models of the glass model mantle tank were developed using the CFD-programmes CFX and FLUENT.The experimental results illustrate that the mantle flow structure in the mantle is complicated and the distribution of flow in the mantle...

  4. Indoor Airflow Simulation inside Lecture Room: A CFD Approach

    Science.gov (United States)

    Lin, S.; Tee, B. T.; Tan, C. F.

    2015-09-01

    Indoor air flow distribution is important as it will affect the productivity of the occupants. Poor air flow distribution not only cause discomfort to the occupants but also influence their ability to conduct their activities. The main purpose of this study is to investigate the indoor air flow inside lecture rooms through CFD simulation approach. Two types of air-conditioning configuration system in lecture rooms have been selected for this study which includes the split unit and centralized system. The air flow distribution between these two systems are analyzed and compared. Physical measurement is conducted using a velocity meter for validation purpose. CFD simulation is developed by using ANSYS Fluent software. The results specifically the air velocity and temperature data are compared and validated. Based on the findings, design recommendation is proposed with the aim to improve on the current air flow distribution in the lecture rooms.

  5. CFD and FEM modeling of PPOOLEX experiments

    Energy Technology Data Exchange (ETDEWEB)

    Paettikangas, T.; Niemi, J.; Timperi, A. (VTT Technical Research Centre of Finland (Finland))

    2011-01-15

    Large-break LOCA experiment performed with the PPOOLEX experimental facility is analysed with CFD calculations. Simulation of the first 100 seconds of the experiment is performed by using the Euler-Euler two-phase model of FLUENT 6.3. In wall condensation, the condensing water forms a film layer on the wall surface, which is modelled by mass transfer from the gas phase to the liquid water phase in the near-wall grid cell. The direct-contact condensation in the wetwell is modelled with simple correlations. The wall condensation and direct-contact condensation models are implemented with user-defined functions in FLUENT. Fluid-Structure Interaction (FSI) calculations of the PPOOLEX experiments and of a realistic BWR containment are also presented. Two-way coupled FSI calculations of the experiments have been numerically unstable with explicit coupling. A linear perturbation method is therefore used for preventing the numerical instability. The method is first validated against numerical data and against the PPOOLEX experiments. Preliminary FSI calculations are then performed for a realistic BWR containment by modeling a sector of the containment and one blowdown pipe. For the BWR containment, one- and two-way coupled calculations as well as calculations with LPM are carried out. (Author)

  6. CFD APPROACH FOR FLOW CHARACTERISTICS OF HYDRAULIC FRANCIS TURBINE

    OpenAIRE

    RUCHI KHARE,; DR. VISHNU PRASAD,; RUCHI KHARE, DR. VISHNU PRASAD,

    2010-01-01

    With the growth of computational mechanics, the virtual hydraulic machines are becoming more and more realistic to get minor details of the flow, which are not possible in model testing. In present work, 3D turbulent real flow analyses in hydraulic Francis turbine have been carried out at three guide vane opening and different rotation speed using Ansys CFX computational fluid dynamics (CFD) software. The average values of flow parameters like velocities and flow angles at the inlet and outle...

  7. An Integrated Modeling Approach for Predicting Process Maps of Residual Stress and Distortion in a Laser Weld: A Combined CFD-FE Methodology

    Science.gov (United States)

    Turner, Richard P.; Panwisawas, Chinnapat; Sovani, Yogesh; Perumal, Bama; Ward, R. Mark; Brooks, Jeffery W.; Basoalto, Hector C.

    2016-10-01

    Laser welding has become an important joining methodology within a number of industries for the structural joining of metallic parts. It offers a high power density welding capability which is desirable for deep weld sections, but is equally suited to performing thinner welded joints with sensible amendments to key process variables. However, as with any welding process, the introduction of severe thermal gradients at the weld line will inevitably lead to process-induced residual stress formation and distortions. Finite element (FE) predictions for weld simulation have been made within academia and industrial research for a number of years, although given the fluid nature of the molten weld pool, FE methodologies have limited capabilities. An improvement upon this established method would be to incorporate a computational fluid dynamics (CFD) model formulation prior to the FE model, to predict the weld pool shape and fluid flow, such that details can be fed into FE from CFD as a starting condition. The key outputs of residual stress and distortions predicted by the FE model can then be monitored against the process variables input to the model. Further, a link between the thermal results and the microstructural properties is of interest. Therefore, an empirical relationship between lamellar spacing and the cooling rate was developed and used to make predictions about the lamellar spacing for welds of different process parameters. Processing parameter combinations that lead to regions of high residual stress formation and high distortion have been determined, and the impact of processing parameters upon the predicted lamellar spacing has been presented.

  8. An Integrated Modeling Approach for Predicting Process Maps of Residual Stress and Distortion in a Laser Weld: A Combined CFD-FE Methodology

    Science.gov (United States)

    Turner, Richard P.; Panwisawas, Chinnapat; Sovani, Yogesh; Perumal, Bama; Ward, R. Mark; Brooks, Jeffery W.; Basoalto, Hector C.

    2016-07-01

    Laser welding has become an important joining methodology within a number of industries for the structural joining of metallic parts. It offers a high power density welding capability which is desirable for deep weld sections, but is equally suited to performing thinner welded joints with sensible amendments to key process variables. However, as with any welding process, the introduction of severe thermal gradients at the weld line will inevitably lead to process-induced residual stress formation and distortions. Finite element (FE) predictions for weld simulation have been made within academia and industrial research for a number of years, although given the fluid nature of the molten weld pool, FE methodologies have limited capabilities. An improvement upon this established method would be to incorporate a computational fluid dynamics (CFD) model formulation prior to the FE model, to predict the weld pool shape and fluid flow, such that details can be fed into FE from CFD as a starting condition. The key outputs of residual stress and distortions predicted by the FE model can then be monitored against the process variables input to the model. Further, a link between the thermal results and the microstructural properties is of interest. Therefore, an empirical relationship between lamellar spacing and the cooling rate was developed and used to make predictions about the lamellar spacing for welds of different process parameters. Processing parameter combinations that lead to regions of high residual stress formation and high distortion have been determined, and the impact of processing parameters upon the predicted lamellar spacing has been presented.

  9. CFD modeling of a boiler's tubes rupture

    International Nuclear Information System (INIS)

    This paper reports the results of a study on the reason for tubes damage in the superheater Platen section of the 320 MW Bisotoun power plant, Iran. The boiler has three types of superheater tubes and the damage occurs in a series of elbows belongs to the long tubes. A three-dimensional modeling was performed using an in-house computational fluid dynamics (CFD) code in order to explore the reason. The code has ability of simultaneous solving of the continuity, the Reynolds-Averaged Navier-Stokes (RANS) equations and employing the turbulence, combustion and radiation models. The whole boiler including; walls, burners, air channels, three types of tubes, etc., was modeled in the real scale. The boiler was meshed into almost 2,000,000 tetrahedral control volumes and the standard k-ε turbulence model and the Rosseland radiation model were used in the model. The theoretical results showed that the inlet 18.9 MPa saturated steam becomes superheated inside the tubes and exit at a pressure of 17.8 MPa. The predicted results showed that the temperature of the steam and tube's wall in the long tubes is higher than the short and medium size tubes. In addition, the predicted steam mass flow rate in the long tube was lower than other ones. Therefore, it was concluded that the main reason for the rupture in the long tubes elbow is changing of the tube's metal microstructure due to working in a temperature higher than the design temperature. In addition, the structural fatigue tension makes the last elbow of the long tube more ready for rupture in comparison with the other places. The concluded result was validated by observations from the photomicrograph of the tube's metal samples taken from the damaged and undamaged sections

  10. Controls/CFD Interdisciplinary Research Software Generates Low-Order Linear Models for Control Design From Steady-State CFD Results

    Science.gov (United States)

    Melcher, Kevin J.

    1997-01-01

    somewhat so that linear models can also be generated from two- and three-dimensional steady-state results. Standard techniques are adequate for reducing the order of one-dimensional CFD-based linear models. However, reduction of linear models based on two- and three-dimensional CFD results is complicated by very sparse, ill-conditioned matrices. Some novel approaches are being investigated to solve this problem.

  11. CFD modelling of Stirling engines with complex design topologies

    OpenAIRE

    Alexakis, Thanos

    2013-01-01

    This research is in the field of CFD modelling of heat engines, particularly the advanced CFD methodologies for the performance characterization of solar Stirling Engines with complex geometrical topologies. The research aims to investigate whether these methods can provide a more inclusive picture of the engine performance and how this information can be used for the design improvement of Stirling engines and the investigation of more complex engine topologies.

  12. CFD APPROACH FOR FLOW CHARACTERISTICS OF HYDRAULIC FRANCIS TURBINE

    Directory of Open Access Journals (Sweden)

    RUCHI KHARE,

    2010-08-01

    Full Text Available With the growth of computational mechanics, the virtual hydraulic machines are becoming more and more realistic to get minor details of the flow, which are not possible in model testing. In present work, 3D turbulent real flow analyses in hydraulic Francis turbine have been carried out at three guide vane opening and different rotation speed using Ansys CFX computational fluid dynamics (CFD software. The average values of flow parameters like velocities and flow angles at the inlet and outlet of runner, guide vane and stay vane of turbine are computed to derive flow characteristics.

  13. Study of indoor radon distribution using measurements and CFD modeling

    International Nuclear Information System (INIS)

    Measurement and/or prediction of indoor radon (222Rn) concentration are important due to the impact of radon on indoor air quality and consequent inhalation hazard. In recent times, computational fluid dynamics (CFD) based modeling has become the cost effective replacement of experimental methods for the prediction and visualization of indoor pollutant distribution. The aim of this study is to implement CFD based modeling for studying indoor radon gas distribution. This study focuses on comparison of experimentally measured and CFD modeling predicted spatial distribution of radon concentration for a model test room. The key inputs for simulation viz. radon exhalation rate and ventilation rate were measured as a part of this study. Validation experiments were performed by measuring radon concentration at different locations of test room using active (continuous radon monitor) and passive (pin-hole dosimeters) techniques. Modeling predictions have been found to be reasonably matching with the measurement results. The validated model can be used to understand and study factors affecting indoor radon distribution for more realistic indoor environment. - Highlights: • Indoor radon distribution has been studied using active and passive measurements and CFD simulation. • At low ventilation, non-uniformity of radon concentration was observed. • Measured wall radon flux and ventilation rate has been used in simulations. • CFD simulation results were found to be close to measurements

  14. Three dimensional analysis of turbulent steam jets in enclosed structures: a CFD approach

    International Nuclear Information System (INIS)

    This paper compares the three-dimensional numerical simulation with the experimental data of a steam blowdown event in a light water reactor containment building. The temperature and pressure data of a steam blowdown event was measured at the Purdue University Multi-Dimensional Integrated Test Assembly (PUMA), a scaled model of the General Electric simplified Boiling Water Reactor. A three step approach was used to analyze the steam jet behavior. First, a 1-Dimensional, system level RELAP5/Mod3.2 model of the steam blowdown event was created and the results used to set the initial conditions for the PUMA blowdown experiments. Second, 2-Dimensional CFD models of the discharged steam jets were computed using PHOENICS, a commercially available CFD package. Finally, 3-Dimensional model of the PUMA drywell was created with the boundary conditions based on experimental measurements. The results of the 1-D and 2-D models were reported in the previous meeting. This paper discusses in detail the formulation and the results of the 3-Dimensional PHOENICS model of the PUMA drywell. It is found that the 3-D CFD solutions compared extremely well with the measured data

  15. CFD modelling of moisture interactions between air and constructions

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Hohota, Raluca;

    2005-01-01

    There is a strong demand for accurate moisture modelling since moisture poses a risk for both the constructions and the indoor climate. Thus, in this investigation there is special focus on moisture modelling. The paper describes a new model based on a CFD tool that is enhanced to include both de...

  16. Investigating the advantages and disadvantages of realistic approach and porous approach for closely packed pebbles in CFD simulation

    Energy Technology Data Exchange (ETDEWEB)

    Wu, C.Y. [Department of Engineering and System Science, Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Sec. 2, Kuang-Fu Rd., Hsingchu 30013, 325 Taiwan (China); Ferng, Y.M., E-mail: ymferng@ess.nthu.edu.t [Department of Engineering and System Science, Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Sec. 2, Kuang-Fu Rd., Hsingchu 30013, 325 Taiwan (China); Chieng, C.C.; Liu, C.C. [Department of Engineering and System Science, Institute of Nuclear Engineering and Science, National Tsing Hua University, 101, Sec. 2, Kuang-Fu Rd., Hsingchu 30013, 325 Taiwan (China)

    2010-05-15

    A pebble bed geometry is usually adopted for high-temperature gas-cooled reactors (HTGRs), which exhibits inherently safe performance, high conversion efficiency, and low power density design. It is important to understand the thermal-hydraulic characteristics of HTGR core for optimum design and safe operation. Therefore, this study investigates the thermal-hydraulic behaviors in a segment of pebbles predicted by the Reynolds-averaged Navier-Stokes (RANS) computational fluid dynamics (CFD) model using porous and realistic approaches for the complicated geometry. The advantages of each approach's methodology for the closely packed pebble geometry can be revealed by comparing the calculated results. In an engineering application, a CFD simulation with the porous approach for the pebble geometry can quickly and reasonably capture the averaged behaviors of the thermal-hydraulic parameters as the gas flows through the core, including the pressure drop and temperature increase. However, it is necessary to utilize the realistic approach for this complicated geometry to obtain the detailed and localized characteristics within the fluid and solid fuel regions. The present simulation results can provide useful information to help CFD researchers to determine an appropriate approach to be used when investigating the thermal-hydraulic characteristics within the reactor core of a closely packed pebble bed.

  17. FSI and CFD Modeling of Cerebral Aneurysm Model and Comparing to PIV Experiments

    Science.gov (United States)

    Wang, Zhaopeng; Hao, Qing

    2014-11-01

    Wall shear stress or strain is considered as an important factor for cerebral aneurysm growth and even rupture. The objective of present study is to evaluate wall shear stress in aneurysm sac and neck by Fluid Structure Interaction (FSI) and solid wall Computational Fluid Dynamics (CFD) approaches and compare the simulation results against Particle Image Velocimetry (PIV) experimental data from an elastic in vitro aneurysm model. The FSI and CFD simulation results showed that both approaches captured the flow patterns inside the aneurysm sac under pulsatile flow, that in diastole time period the flow inside the aneurysm sac was a stable circular clock-wise flow; when higher velocity entered into the aneurysm sac during systole and in a short diastole time period an anti-clock circular flow pattern emerged near the distal neck. Both approaches showed that the shear stress near the proximal neck experienced higher shear stress than the distal neck, while in the aneurysm dome the shear stress was always the lowest. In this study, we also showed that shear stress values at proximal neck and distal neck from FSI approach were lower than solid wall CFD approach.

  18. CFD modeling of fouling in crude oil pre-heaters

    International Nuclear Information System (INIS)

    Highlights: ► A conceptual CFD-based model to predict fouling in industrial crude oil pre-heaters. ► Tracing fouling formation in the induction and developing continuation periods. ► Effect of chemical components, shell-side HTC and turbulent flow on the fouling rate. - Abstract: In this study, a conceptual procedure based on the computational fluid dynamic (CFD) technique has been developed to predict fouling rate in an industrial crude oil pre-heater. According to the developed CFD concept crude oil was assumed to be composed of three pseudo-components comprising of petroleum, asphaltene and salt. The binary diffusion coefficients were appropriately categorized into five different groups. The species transport model was applied to simulate the mixing and transport of chemical species. The possibility of adherence of reaction products to the wall was taken into account by applying a high viscosity for the products in competition with the shear stress on the wall. Results showed a reasonable agreement between the model predictions and the plant data. The CFD model could be applied to new operating conditions to investigate the details of the crude oil fouling in the industrial pre-heaters.

  19. CFD Simulation of Nanosufur Crystallization Incorporating Population Balance Modeling

    OpenAIRE

    Fatemeh Golkhou; Mahmod Tajee Hamed Mosavian

    2013-01-01

    A physical vapor condensation process for synthesizing nanosized sulfur powder as a precursor for various industries was simulated by the use of computational ?uid dynamic (CFD) modeling. The phase change, swirl flow and heat transfer taking place inside the cyclone are analyzed along with particle formation via gas condensation method. The population balance model is a mathematical framework for the modeling of crystal size distribution (CSD) and the study of gas-phase changes leading to nuc...

  20. A novel approach to CFD analysis of the urban environment

    Science.gov (United States)

    Nardecchia, F.; Gugliermetti, F.; Bisegna, F.

    2015-11-01

    The construction of cities, with their buildings and human activities, not only changes the landscape, but also influences the local climate in a manner that depends on many different factors and parameters: weather conditions, urban thermo-physical and geometrical characteristics, anthropogenic moisture and heat sources. Land-cover and canopy structure play an important role in urban climatology and every environmental assessment and city design face with them. Inside the previous frame, the objective of this study is both to identify both the key design variables that alter the environment surrounding the buildings, and to quantified the extension area of these phenomena. The tool used for this study is a 2D computational fluid dynamics (CFD) numerical simulation considering different heights for buildings, temperature gaps between undisturbed air and building's walls, velocities of undisturbed air. Results obtained allowed to find a novel approach to study urban canopies, giving a qualitative assessment on the contribution and definition of the total energy of the area surrounding the buildings.

  1. Study of indoor radon distribution using measurements and CFD modeling.

    Science.gov (United States)

    Chauhan, Neetika; Chauhan, R P; Joshi, M; Agarwal, T K; Aggarwal, Praveen; Sahoo, B K

    2014-10-01

    Measurement and/or prediction of indoor radon ((222)Rn) concentration are important due to the impact of radon on indoor air quality and consequent inhalation hazard. In recent times, computational fluid dynamics (CFD) based modeling has become the cost effective replacement of experimental methods for the prediction and visualization of indoor pollutant distribution. The aim of this study is to implement CFD based modeling for studying indoor radon gas distribution. This study focuses on comparison of experimentally measured and CFD modeling predicted spatial distribution of radon concentration for a model test room. The key inputs for simulation viz. radon exhalation rate and ventilation rate were measured as a part of this study. Validation experiments were performed by measuring radon concentration at different locations of test room using active (continuous radon monitor) and passive (pin-hole dosimeters) techniques. Modeling predictions have been found to be reasonably matching with the measurement results. The validated model can be used to understand and study factors affecting indoor radon distribution for more realistic indoor environment.

  2. Gasification CFD Modeling for Advanced Power Plant Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Zitney, S.E.; Guenther, C.P.

    2005-09-01

    In this paper we have described recent progress on developing CFD models for two commercial-scale gasifiers, including a two-stage, coal slurry-fed, oxygen-blown, pressurized, entrained-flow gasifier and a scaled-up design of the PSDF transport gasifier. Also highlighted was NETL’s Advanced Process Engineering Co-Simulator for coupling high-fidelity equipment models with process simulation for the design, analysis, and optimization of advanced power plants. Using APECS, we have coupled the entrained-flow gasifier CFD model into a coal-fired, gasification-based FutureGen power and hydrogen production plant. The results for the FutureGen co-simulation illustrate how the APECS technology can help engineers better understand and optimize gasifier fluid dynamics and related phenomena that impact overall power plant performance.

  3. Integration of CFD codes and advanced combustion models for quantitative burnout determination

    Energy Technology Data Exchange (ETDEWEB)

    Javier Pallares; Inmaculada Arauzo; Alan Williams [University of Zaragoza, Zaragoza (Spain). Centre of Research for Energy Resources and Consumption (CIRCE)

    2007-10-15

    CFD codes and advanced kinetics combustion models are extensively used to predict coal burnout in large utility boilers. Modelling approaches based on CFD codes can accurately solve the fluid dynamics equations involved in the problem but this is usually achieved by including simple combustion models. On the other hand, advanced kinetics combustion models can give a detailed description of the coal combustion behaviour by using a simplified description of the flow field, this usually being obtained from a zone-method approach. Both approximations describe correctly general trends on coal burnout, but fail to predict quantitative values. In this paper a new methodology which takes advantage of both approximations is described. In the first instance CFD solutions were obtained of the combustion conditions in the furnace in the Lamarmora power plant (ASM Brescia, Italy) for a number of different conditions and for three coals. Then, these furnace conditions were used as inputs for a more detailed chemical combustion model to predict coal burnout. In this, devolatilization was modelled using a commercial macromolecular network pyrolysis model (FG-DVC). For char oxidation an intrinsic reactivity approach including thermal annealing, ash inhibition and maceral effects, was used. Results from the simulations were compared against plant experimental values, showing a reasonable agreement in trends and quantitative values. 28 refs., 4 figs., 4 tabs.

  4. CFD methods for wind turbines

    Science.gov (United States)

    Suatean, Bogdan; Colidiuc, Alexandra; Galetuse, Slelian

    2012-11-01

    The purpose of this paper is to present different CFD models used to determine the aerodynamic performance of horizontal axis wind turbine (HAWT). The models presented have various levels of complexity to calculate the aerodynamic performances of HAWT, starting with a simple model, the actuator line method, and ending with a CFD approach.

  5. CFD and FEM Model of an Underwater Vehicle Propeller

    Directory of Open Access Journals (Sweden)

    Chruściel Tadeusz

    2014-10-01

    Full Text Available Within the framework of the project for design and optimization of the Remotely Operated Vehicle (ROV, research on its propulsion has been carried out. Te entire project was supported by CFD and FEM calculations taking into account the characteristics of the underwater vehicle. One of the tasks was to optimize the semi-open duct for horizontal propellers, which provided propulsion and controllability in horizontal plane. In order to create a measurable model of this task it was necessary to analyze numerical methodology of propeller design, along with the structure of a propellers with nozzles and contra-rotating propellers. It was confronted with theoretical solutions which included running of the analyzed propeller near an underwater vehicle. Also preliminary qualitative analyses of a simplified system with contra-rotating propellers and a semi-open duct were carried out. Te obtained results enabled to make a decision about the ROVs duct form. Te rapid prototyping SLS (Selective Laser Sintering method was used to fabricate a physical model of the propeller. As a consequence of this, it was necessary to verify the FEM model of the propeller, which based on the load obtained from the CFD model. Te article contains characteristics of the examined ROV, a theoretical basis of propeller design for the analyzed cases, and the results of CFD and FEM simulations.

  6. A CFD model for pollutant dispersion in rivers

    Directory of Open Access Journals (Sweden)

    Modenesi K.

    2004-01-01

    Full Text Available Studies have shown that humankind will experience a water shortage in the coming decades. It is therefore paramount to develop new techniques and models with a view to minimizing the impact of pollution. It is important to predict the environmental impact of new emissions in rivers, especially during periods of drought. Computational fluid dynamics (CFD has proved to be an invaluable tool to develop models able to analyze in detail particle dispersion in rivers. However, since these models generate grids with thousands (even millions of points to evaluate velocities and concentrations, they still require powerful machines. In this context, this work contributes by presenting a new three-dimensional model based on CFD techniques specifically developed to be fast, providing a significant improvement in performance. It is able to generate predictions in a couple of hours for a one-thousand-meter long section of river using Pentium IV computers. Commercial CFD packages would require weeks to solve the same problem. Another innovation inb this work is that a half channel with a constant elliptical cross section represents the river, so the Navier Stokes equations were derived for the elliptical system. Experimental data were obtained from REPLAN (PETROBRAS refining unit on the Atibaia River in São Paulo, Brazil. The results show good agreement with experimental data.

  7. CFD DPAL modeling for various schemes of flow configurations

    Science.gov (United States)

    Waichman, Karol; Barmashenko, Boris D.; Rosenwaks, Salman

    2014-10-01

    Comprehensive analysis of kinetic and fluid dynamic processes in flowing-gas diode pumped alkali lasers (DPALs) using two- and three-dimensional computational fluid dynamics (2D and 3D CFD) models is reported for Cs DPALs. The models take into account effects of temperature rise and losses of alkali atoms due to ionization. Various gas flow regimes and transverse and parallel flow-optics directions configurations are studied. Optimization of the Cs DPAL parameters, using 3D CFD modeling, shows that applying high flow velocity and narrowband pumping, maximum lasing power as high as 40 kW can be obtained at pump power of 80 kW for transverse flow configuration in a pumped volume of ~ 0.7 cm3. At high pump power the calculated laser power is higher for the transverse scheme than for the parallel scheme because of a more efficient heat convection from the beam volume in the transverse configuration. The CFD models are applied to experimental devices and the calculated results are in good agreement with the measurements.

  8. CFD Modeling in Development of Renewable Energy Applications

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2013-01-01

    Full Text Available Chapter 1: A Multi-fluid Model to Simulate Heat and Mass Transfer in a PEM Fuel Cell. Torsten Berning, Madeleine Odgaard, Søren K. Kær Chapter 2: CFD Modeling of a Planar Solid Oxide Fuel Cell (SOFC for Clean Power Generation. Meng Ni Chapter 3: Hydrodynamics and Hydropower in the New Paradigm for a Sustainable Engineering. Helena M. Ramos, Petra A. López-Jiménez Chapter 4: Opportunities for CFD in Ejector Solar Cooling. M. Dennis Chapter 5: Three Dimensional Modelling of Flow Field Around a Horizontal Axis Wind Turbine (HAWT. Chaouki Ghenai, Armen Sargsyan, Isam Janajreh Chapter 6: Scaling Rules for Hydrodynamics and Heat Transfer in Jetting Fluidized-Bed Biomass Gasifiers. K. Zhang, J. Chang, P. Pei, H. Chen, Y. Yang Chapter 7: Investigation of Low Reynolds Number Unsteady Flow around Airfoils in Pitching, Plunging and Flapping Motions. M.R. Amiralaei, H. Alighanbari, S.M. Hashemi Chapter 8: Justification of Computational Fluid Dynamics Simulation for Flat Plate Solar Energy Collector. Mohamed Selmi, Mohammed J. Al-Khawaja, Abdulhamid Marafia Chapter 9: Comparative Performance of a 3-Bladed Airfoil Chord H-Darrieus and a 3-Bladed Straight Chord H-Darrieus Turbines using CFD. R. Gupta, Agnimitra Biswas Chapter 10: Computational Fluid Dynamics for PEM Fuel Cell Modelling. A. Iranzo, F. Rosa Chapter 11: Analysis of the Performance of PEM Fuel Cells: Tutorial of Major Functional and Constructive Characteristics using CFD Analysis. P.J. Costa Branco, J.A. Dente Chapter 12: Application of Techniques of Computational Fluid Dynamics in the Design of Bipolar Plates for PEM Fuel Cells. A.P. Manso, F.F. Marzo, J. Barranco, M. Garmendia Mujika.

  9. CFD and FEM Model of an Underwater Vehicle Propeller

    OpenAIRE

    Chruściel Tadeusz; Ciba Ewelina; Dopke Julita

    2014-01-01

    Within the framework of the project for design and optimization of the Remotely Operated Vehicle (ROV), research on its propulsion has been carried out. Te entire project was supported by CFD and FEM calculations taking into account the characteristics of the underwater vehicle. One of the tasks was to optimize the semi-open duct for horizontal propellers, which provided propulsion and controllability in horizontal plane. In order to create a measurable model of this task it was necessary to ...

  10. Application of CFD techniques toward the validation of nonlinear aerodynamic models

    Science.gov (United States)

    Schiff, L. B.; Katz, J.

    1985-01-01

    Applications of computational fluid dynamics (CFD) methods to determine the regimes of applicability of nonlinear models describing the unsteady aerodynamic responses to aircraft flight motions are described. The potential advantages of computational methods over experimental methods are discussed and the concepts underlying mathematical modeling are reviewed. The economic and conceptual advantages of the modeling procedure over coupled, simultaneous solutions of the gas dynamic equations and the vehicle's kinematic equations of motion are discussed. The modeling approach, when valid, eliminates the need for costly repetitive computation of flow field solutions. For the test cases considered, the aerodynamic modeling approach is shown to be valid.

  11. Simulation of a semi-industrial pilot plant thickener using CFD approach

    Institute of Scientific and Technical Information of China (English)

    Majid Ebrahimzadeh Gheshlaghi; Ataallah Soltani Goharrizi; Alireza Aghajani Shahrivar

    2013-01-01

    Thickeners are important units for water recovery in various industries.In this study,a semi-industrial pilot plant thickener similar to the tailing thickener of the Sarcheshmeh Copper Mine was simulated by CFD modeling.The population balance was used to describe the particle aggregation and breakup.In this population balance,15 particle sizes categories were considered.The Eulerian-Eulerian approach with standard k-ε turbulence model was applied to describe two phases of slurry flow in the thickener under steady-state condition.The simulation results have been compared with the experimental measurements to validate the accuracy of the CFD modeling.After checking the numerical results,the effect of important parameters such as,feed flow rate,solid percentage in the feed,and solid particle size on the thickener performance.was studied.The thickener residence time distribution were obtained by the modeling and also compared with the experimental data.Finally,the effects of feedwell feeding on the average diameter of aggregate and turbulent intensity were evaluated.

  12. Modeling and verification of hemispherical solar still using ANSYS CFD

    Energy Technology Data Exchange (ETDEWEB)

    Panchal, Hitesh N. [KSV University, Gujarat Power Engineering and Research Institute, Mehsana (India); Shah, P.K. [Silver Oak College of Engineering and Technology, Ahmedabad, Gujarat (India)

    2013-07-01

    In every efficient solar still design, water temperature, vapor temperature and distillate output, and difference between water temperature and inner glass cover temperatures are very important. Here, two dimensional three phase model of hemispherical solar still is made for evaporation as well as condensation process in ANSYS CFD. Simulation results like water temperature, vapor temperature, distillate output compared with actual experimental results of climate conditions of Mehsana (latitude of 23° 59’ and longitude of 72° 38) of hemispherical solar still. Water temperature and distillate output were good agreement with actual experimental results. Study shows that ANSYS-CFD is very powerful as well as efficient tool for design, comparison purpose of hemispherical solar still.

  13. An approach to validation of coupled CFD and system thermal-hydraulics codes

    International Nuclear Information System (INIS)

    This paper discusses the development of approach and experimental facility for the validation of coupled Computational Fluid Dynamics (CFD) and System Thermal Hydraulics (STH) codes. The validation of a coupled code requires experiments which feature two way feedback between the component (CFD sub-domain) and the system (STH sub-domain). We present results of CFD analysis that are used in the development of a flexible design for the TALL-3D experimental facility. The facility consists of a lead-bismuth thermal-hydraulic loop operating in forced and natural circulation regimes with a heated pool-type 3D test section. The goal of the design is to achieve a feedback between mixing and stratification phenomena in the 3D tests section and forced / natural circulation flow conditions in the loop. Finally, we discuss the development of an experimental validation matrix for validation of coupled STH and CFD codes that considers the key physical phenomena of interest. (author)

  14. CFD modeling of sodium spray combustion

    International Nuclear Information System (INIS)

    A sodium cooled fast reactor is one of the attractive concept for the IVth generation advanced reactor designs. For the safety of a sodium cooled fast reactor, sodium-air and sodium-water reactions must be avoided. A sodium-air reaction typically occurs in two dominant modes, namely the spray fire and pool fire. The focus of the paper will be on spray fires. To avoid sodium-air accidents and to mitigate the consequences if a sodium fire occurs, it is essential to understand all the physical phenomena involved in sodium spray combustion. Numerical modeling is one of the methods, which can be used to understand all the physics involved. The goal of the work presented in this paper is to propose a numerical method to simulate sodium spray combustion and to validate this method against experiments. Free falling single droplet sodium spray combustion experiments are used as a validation case for the proposed numerical method. The trend obtained using our numerical simulations matches well with the experimental data. Further validation needs to be performed, before the presented modeling can be used for sodium fast reactor safety analyses. (author)

  15. CFD modeling of dust dispersion through Najaf historic city centre

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2014-01-01

    Full Text Available The aim of this project is to study the influences of the wind flow and dust particles dispersion through Najaf historic city centre. Two phase Computational Fluid Dynamics (CFD model using a Reynolds Average Navier Stokes (RANS equations has been used to simulate the wind flow and the transport and dispersion of the dust particles through the historic city centre. This work may provide useful insight to urban designers and planners interested in examining the variation of city breathability as a local dynamic morphological parameter with the local building packing density.

  16. CFD Modeling of Particulate Matter Dispersion from Kerman Cement Plant

    Directory of Open Access Journals (Sweden)

    M. Panahandeh

    2010-04-01

    Full Text Available "n "n "nBackgrounds and Objectives: The dispersion of particulate matter has been known as the most serious environmental pollution of cement plants. In the present work, dispersion of the particulate matter from stack of Kerman Cement Plant was investigated using Computational Fluid Dynamics (CFD modeling."nMaterials and Methods: In order to study the dispersion of particulate matter from the stack, a calculation domain with dimensions of 8000m × 800m × 400m was considered. The domain was divided to 936781 tetrahedral control volumes. The mixture two-phase model was employed to model the interaction of the particulate matter (dispersed phase and air (continuous phase. The Large Eddy Simulation (LES method was used for turbulence modeling."nResults: The concentration of particulate matter in the whole calculation domain was computed. The predicted concentrations were compared to the measured values from the literature and a good agreement was observed. The predicted concentration profiles at different cross sections were analyzed."nConclusion:The results of the present work showed that CFD is a useful tool for understanding the dispersion of particulate matter in air. Although the obtained results were promising, more investigations on the properties of the dispersed phase, turbulent parameters and the boundary layer effect is needed to obtain more accurate results.

  17. CFD-aided modelling of activated sludge systems - A critical review.

    Science.gov (United States)

    Karpinska, Anna M; Bridgeman, John

    2016-01-01

    Nowadays, one of the major challenges in the wastewater sector is the successful design and reliable operation of treatment processes, which guarantee high treatment efficiencies to comply with effluent quality criteria, while keeping the investment and operating cost as low as possible. Although conceptual design and process control of activated sludge plants are key to ensuring these goals, they are still based on general empirical guidelines and operators' experience, dominated often by rule of thumb. This review paper discusses the rationale behind the use of Computational Fluid Dynamics (CFD) to model aeration, facilitating enhancement of treatment efficiency and reduction of energy input. Several single- and multiphase approaches commonly used in CFD studies of aeration tank operation, are comprehensively described, whilst the shortcomings of the modelling assumptions imposed to evaluate mixing and mass transfer in AS tanks are identified and discussed. Examples and methods of coupling of CFD data with biokinetics, accounting for the actual flow field and its impact on the oxygen mass transfer and yield of the biological processes occurring in the aeration tanks, are also critically discussed. Finally, modelling issues, which remain unaddressed, (e.g. coupling of the AS tank with secondary clarifier and the use of population balance models to simulate bubbly flow or flocculation of the activated sludge), are also identified and discussed. PMID:26615385

  18. Lime Kiln Modeling. CFD and One-dimensional simulations

    Energy Technology Data Exchange (ETDEWEB)

    Svedin, Kristoffer; Ivarsson, Christofer; Lundborg, Rickard

    2009-03-15

    results indicate that there are practical means of maintaining the benefits of high mud dry solids content while giving up only a small fraction of the energy efficiency. An operating strategy that maintains high mud dry solids from the precoat filter, but adds back clean water to the mud going to the kiln provides this benefit. This approach takes advantage of the diminishing benefit in kiln energy efficiency above about 75% dry solids. The second study shows that the Adiabatic Flame Temperature (AFT) of a fuel is the dominant factor in determining lime kiln performance. Flame length (FL) has a modest impact on kiln performance within the range that is possible for a given kiln and burner, but has an impact similar to the AFT on the maximum refractory temperature. Investigation of the multiple pathways for the radiation heat transfer between the kiln flame and the lime solids shows the limited impact of flame emissivity on the total radiant heat transfer. This is due to the fact that higher emissivity flames have high direct radiation, but have less radiant heat transmitted through the flame from the refractory walls to the lime solids. Lower emissivity flames have lower direct radiation between the flame and the lime solids, but better transmission of radiation from the refractory walls. The net result is that kiln performance is not very sensitive to flame emissivity or luminosity. The correlation of the kiln performance with AFT and FL, along with the insensitivity of flame heat transfer to flame emissivity suggests a practical means of testing the impact of alternative fuels on an operating kiln. Firing the kiln with its conventional fuel, but with higher than normal excess air in order to match the AFT of the alternative fuel can be used to test the impact of an alternative fuel. The last study addresses the impact of oxygen enrichment in a lime kiln gasifier for alternative fuels. The news value of the project is in the detailed description of the CFD model

  19. Validation of NEPTUNE-CFD two-phase flow models using experimental data

    OpenAIRE

    Jorge Pérez Mañes; Victor Hugo Sánchez Espinoza; Sergio Chiva Vicent; Michael Böttcher; Robert Stieglitz

    2014-01-01

    This paper deals with the validation of the two-phase flow models of the CFD code NEPTUNEC-CFD using experimental data provided by the OECD BWR BFBT and PSBT Benchmark. Since the two-phase models of CFD codes are extensively being improved, the validation is a key step for the acceptability of such codes. The validation work is performed in the frame of the European NURISP Project and it was focused on the steady state and transient void fraction tests. The influence of different NEPTUNE-CFD ...

  20. A physical approach of the short-term wind power prediction based on CFD pre-calculated flow fields

    Institute of Scientific and Technical Information of China (English)

    LI Li; LIU Yong-qian; YANG Yong-ping; HAN Shuang; WANG Yi-mei

    2013-01-01

    A physical approach of the wind power prediction based on the CFD pre-calculated flow fields is proposed in this paper.The flow fields are obtained based on a steady CFD model with the discrete inflow wind conditions as the boundary conditions,and a database is established containing the important parameters including the inflow wind conditions,the flow fields and the corresponding wind power for each wind turbine.The power is predicted via the database by taking the Numerical Weather Prediction (NWP)wind as the input data.In order to evaluate the approach,the short-term wind power prediction for an actual wind farm is conducted as an example during the period of the year 2010.Compared with the measured power,the predicted results enjoy a high accuracy with the annual Root Mean Square Error (RMSE) of 15.2% and the annual MAE of 10.80%.A good performance is shown in predicting the wind power's changing trend.This approach is independent of the historical data and can be widely used for all kinds of wind farms including the newly-built wind farms.At the same time,it does not take much computation time while it captures the local air flows more precisely by the CFD model.So it is especially practical for engineering projects.

  1. A review of Computational Fluid Dynamics (CFD) airflow modelling over aeolian landforms

    Science.gov (United States)

    Smyth, Thomas A. G.

    2016-09-01

    Aeolian landforms occur on all earths' continents as well as on Mars, Titan and Venus and are typically formed where sediment is eroded and/or deposited by near surface wind flow. As wind flow approaches an aeolian landform, secondary flow patterns are created that cause wind to deviate in both speed and direction, producing complex patterns of sediment erosion, deposition and transportation. Computational Fluid Dynamics (CFD) modelling of wind flow has become a common tool to predict and understand secondary wind flow and resulting sediment transport. Its use has progressed from simulating wind flow over simple two dimensional dune shapes, to calculating a multitude of flow parameters over a range of increasingly complex landforms. Analysis of 25 peer reviewed journal articles, found that CFD has been crucial to providing additional insight to flow dynamics on the stoss slope of dunes, the structure and nature of wind flow separation in the lee of landforms and information on localised wind flow variations in large-scale dune fields. The findings of this assay demonstrate that further research is required regarding the parameterisation and modelling of surface roughness, the incorporation of accurate sediment transport to wind flow models, and the prediction of topographic surface changes. CFD is anticipated to be increasingly utilised in aeolian geomorphology and this work aims to be a starting point for aeolian geomorphologists wishing to better understand and review the utilisation of the technique to date.

  2. Two Phase Flow Models and Numerical Methods of the Commercial CFD Codes

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Sung Won; Jeong, Jae Jun; Chang, Seok Kyu; Cho, Hyung Kyu

    2007-11-15

    The use of commercial CFD codes extend to various field of engineering. The thermal hydraulic analysis is one of the promising engineering field of application of the CFD codes. Up to now, the main application of the commercial CFD code is focused within the single phase, single composition fluid dynamics. Nuclear thermal hydraulics, however, deals with abrupt pressure changes, high heat fluxes, and phase change heat transfer. In order to overcome the CFD limitation and to extend the capability of the nuclear thermal hydraulics analysis, the research efforts are made to collaborate the CFD and nuclear thermal hydraulics. To achieve the final goal, the current useful model and correlations used in commercial CFD codes should be reviewed and investigated. This report gives the summary information about the constitutive relationships that are used in the FLUENT, STAR-CD, and CFX. The brief information of the solution technologies are also enveloped.

  3. Two Phase Flow Models and Numerical Methods of the Commercial CFD Codes

    International Nuclear Information System (INIS)

    The use of commercial CFD codes extend to various field of engineering. The thermal hydraulic analysis is one of the promising engineering field of application of the CFD codes. Up to now, the main application of the commercial CFD code is focused within the single phase, single composition fluid dynamics. Nuclear thermal hydraulics, however, deals with abrupt pressure changes, high heat fluxes, and phase change heat transfer. In order to overcome the CFD limitation and to extend the capability of the nuclear thermal hydraulics analysis, the research efforts are made to collaborate the CFD and nuclear thermal hydraulics. To achieve the final goal, the current useful model and correlations used in commercial CFD codes should be reviewed and investigated. This report gives the summary information about the constitutive relationships that are used in the FLUENT, STAR-CD, and CFX. The brief information of the solution technologies are also enveloped

  4. Data-Driven CFD Modeling of Turbulent Flows Through Complex Structures

    CERN Document Server

    Wang, Jian-Xun

    2016-01-01

    The growth of computational resources in the past decades has expanded the application of Computational Fluid Dynamics (CFD) from the traditional fields of aerodynamics and hydrodynamics to a number of new areas. Examples range from the heat and fluid flows in nuclear reactor vessels and in data centers to the turbulence flows through wind turbine farms and coastal vegetation plants. However, in these new applications complex structures are often exist (e.g., rod bundles in reactor vessels and turbines in wind farms), which makes fully resolved, first-principle based CFD modeling prohibitively expensive. This obstacle seriously impairs the predictive capability of CFD models in these applications. On the other hand, a limited amount of measurement data is often available in the systems in the above-mentioned applications. In this work we propose a data-driven, physics-based approach to perform full field inversion on the effects of the complex structures on the flow. This is achieved by assimilating observati...

  5. Rockslide and Impulse Wave Modelling in the Vajont Reservoir by DEM-CFD Analyses

    Science.gov (United States)

    Zhao, T.; Utili, S.; Crosta, G. B.

    2016-06-01

    This paper investigates the generation of hydrodynamic water waves due to rockslides plunging into a water reservoir. Quasi-3D DEM analyses in plane strain by a coupled DEM-CFD code are adopted to simulate the rockslide from its onset to the impact with the still water and the subsequent generation of the wave. The employed numerical tools and upscaling of hydraulic properties allow predicting a physical response in broad agreement with the observations notwithstanding the assumptions and characteristics of the adopted methods. The results obtained by the DEM-CFD coupled approach are compared to those published in the literature and those presented by Crosta et al. (Landslide spreading, impulse waves and modelling of the Vajont rockslide. Rock mechanics, 2014) in a companion paper obtained through an ALE-FEM method. Analyses performed along two cross sections are representative of the limit conditions of the eastern and western slope sectors. The max rockslide average velocity and the water wave velocity reach ca. 22 and 20 m/s, respectively. The maximum computed run up amounts to ca. 120 and 170 m for the eastern and western lobe cross sections, respectively. These values are reasonably similar to those recorded during the event (i.e. ca. 130 and 190 m, respectively). Therefore, the overall study lays out a possible DEM-CFD framework for the modelling of the generation of the hydrodynamic wave due to the impact of a rapid moving rockslide or rock-debris avalanche.

  6. CFD Simulation of Nanosufur Crystallization Incorporating Population Balance Modeling

    Directory of Open Access Journals (Sweden)

    Fatemeh Golkhou

    2013-01-01

    Full Text Available A physical vapor condensation process for synthesizing nanosized sulfur powder as a precursor for various industries was simulated by the use of computational ?uid dynamic (CFD modeling. The phase change, swirl flow and heat transfer taking place inside the cyclone are analyzed along with particle formation via gas condensation method. The population balance model is a mathematical framework for the modeling of crystal size distribution (CSD and the study of gas-phase changes leading to nucleation of the first solid particles. In this paper the Direct Quadrature Method of Moments is used for solving the transport equations of the moments of the size distribution. The temperature, velocity and particle size distribution ranges inside the cyclone were computed. The results show the formation of nanosulfur particles in 1-7 nm range.

  7. CFD investigation of turbulence models for mechanical agitation of non-Newtonian fluids in anaerobic digesters.

    Science.gov (United States)

    Wu, Binxin

    2011-02-01

    This study evaluates six turbulence models for mechanical agitation of non-Newtonian fluids in a lab-scale anaerobic digestion tank with a pitched blade turbine (PBT) impeller. The models studied are: (1) the standard k-ɛ model, (2) the RNG k-ɛ model, (3) the realizable k-ɛ model, (4) the standard k-ω model, (5) the SST k-ω model, and (6) the Reynolds stress model. Through comparing power and flow numbers for the PBT impeller obtained from computational fluid dynamics (CFD) with those from the lab specifications, the realizable k-ɛ and the standard k-ω models are found to be more appropriate than the other turbulence models. An alternative method to calculate the Reynolds number for the moving zone that characterizes the impeller rotation is proposed to judge the flow regime. To check the effect of the model setup on the predictive accuracy, both discretization scheme and numerical approach are investigated. The model validation is conducted by comparing the simulated velocities with experimental data in a lab-scale digester from literature. Moreover, CFD simulation of mixing in a full-scale digester with two side-entry impellers is performed to optimize the installation. PMID:21216428

  8. CFD modelling of subcooled flow boiling for nuclear engineering applications

    International Nuclear Information System (INIS)

    In this work a general-purpose CFD code CFX-5 was used for simulations of subcooled flow boiling. The subcooled boiling model, available in a custom version of CFX-5, uses a special treatment of the wall boiling boundary, which assures the grid invariant solution. The simulation results have been validated against the published experimental data [1] of high-pressure flow boiling in a vertical pipe covering a wide range of conditions (relevant to the pressurized water reactor). In general, a good agreement with the experimental data has been achieved. To adequately predict the lateral distribution of two-phase flow parameters, the modelling of two-phase flow turbulence and non-drag forces under wall boiling conditions have been also investigated in the paper. (author)

  9. CFD modelling of condensers for freeze-drying processes

    Indian Academy of Sciences (India)

    Miriam Petitti; Antonello A Barresi; Daniele L Marchisio

    2013-12-01

    The aim of the present research is the development of a computational tool for investigating condensation processes and equipment with particular attention to freeze-dryers. These condensers in fact are usually operated at very low pressures, making it difficult to experimentally acquire quantitative knowledge of all the variables involved. Mathematical modelling and CFD (Computational Fluid Dynamics) simulations are used here to achieve a better comprehension of the flow dynamics and of the process of ice condensation and deposition in the condenser, in order to evaluate condenser efficiency and gain deeper insights of the process to be used for the improvement of its design. Both a complete laboratory-scale freeze-drying apparatus and an industrial-scale condenser have been investigated in this work, modelling the process of water vapour deposition. Different operating conditions have been considered and the influence exerted by the inert gas as well as other parameters has been investigated.

  10. CFD simulation of particle deposition on an array of spheres using an Euler/Lagrange approach

    Energy Technology Data Exchange (ETDEWEB)

    Dehbi, A., E-mail: abdel.dehbi@psi.ch [Laboratory for Thermal-Hydraulics, Paul Scherrer Institut, Villigen 5232 (Switzerland); Martin, S., E-mail: simon.martin@ec-lyon.f [Laboratoire de Mecanique des Fluides et d' Acoustique, Ecole Centrale de Lyon, 69130 Ecully (France)

    2011-08-15

    Highlights: > We use CFD to simulate particulate deposition around arrays of spheres and compare results with experimental data. > The Continuous Random Walk (CRW) is employed to supply fluctuating fluid velocity components. > Model predictions of particle deposition rates are generally within the scatter of the data. - Abstract: The Generation IV Pebble Bed Modular Reactor (PBMR) is being considered as a promising concept to produce electricity or process heat with high efficiencies and unique safety features. The PBMR is a high-temperature, helium-cooled, graphite moderated reactor. The fuel elements consist of 6 cm diameter spherical graphite 'pebbles' containing each thousands of uranium dioxide microspheres. As the pebbles continually rub against one another in the core, a significant quantity of graphite dust can be released in the reactor coolant system. These dust particles, which contain some amounts of fission products, are transported and deposited on pebbles as well as primary circuit surfaces. It is therefore of great safety interest to develop and benchmark numerical approaches for predicting deposition of dust particles in the various locations of the PBMR primary circuit. In this investigation, we use the ANSYS-Fluent CFD code to simulate particulate flows around linear arrays of spheres and compare deposition rates against experiments. It is found that the Reynolds Stress Model (RSM) combined with the Continuous Random Walk (CRW) to supply fluctuating velocity components predicts deposition rates that are generally within the scatter of the data. The methodology developed here can therefore be used to predict to first order the graphite dust deposition rates on pebbles in PBMR-type reactors.

  11. Model test and CFD calculation of a cavitating bulb turbine

    Energy Technology Data Exchange (ETDEWEB)

    Necker, J; Aschenbrenner, T, E-mail: joerg.necker@voith.co [Voith Hydro Holding GmbH and Co. KG Alexanderstrasse 11, 89522 Heidenheim (Germany)

    2010-08-15

    The flow in a horizontal shaft bulb turbine is calculated as a two-phase flow with a commercial Computational Fluid Dynamics (CFD-)-code including cavitation model. The results are compared with experimental results achieved at a closed loop test rig for model turbines. On the model test rig, for a certain operating point (i.e. volume flow, net head, blade angle, guide vane opening) the pressure behind the turbine is lowered (i.e. the Thoma-coefficient {sigma} is lowered) and the efficiency of the turbine is recorded. The measured values can be depicted in a so-called {sigma}-break curve or {eta}- {sigma}-diagram. Usually, the efficiency is independent of the Thoma-coefficient up to a certain value. When lowering the Thoma-coefficient below this value the efficiency will drop rapidly. Visual observations of the different cavitation conditions complete the experiment. In analogy, several calculations are done for different Thoma-coefficients {sigma}and the corresponding hydraulic losses of the runner are evaluated quantitatively. For a low {sigma}-value showing in the experiment significant efficiency loss, the the change of volume flow in the experiment was simulated. Besides, the fraction of water vapour as an indication of the size of the cavitation cavity is analyzed qualitatively. The experimentally and the numerically obtained results are compared and show a good agreement. Especially the drop in efficiency can be calculated with satisfying accuracy. This drop in efficiency is of high practical importance since it is one criterion to determine the admissible cavitation in a bulb-turbine. The visual impression of the cavitation in the CFD-analysis is well in accordance with the observed cavitation bubbles recorded on sketches and/or photographs.

  12. Simplistic Approach to Characterize Sloshing Phenomena using CFD Simulation

    Science.gov (United States)

    Mahmud, Md; Khan, Rafiqul; Xu, Qiang

    2015-03-01

    Liquid sloshing in vessels caused by forced acceleration has been the subject of intense investigations for last several decades both by experiments and numerical simulations. Many studies are done to minimize the sloshing induced forces on the vessel internals and some studies focused on different ways to describe the sloshing patterns. Most of the sloshing characterization methods are done using complex mathematical manipulation and more simplified method may be useful for better practical understanding. In this study, simple/easily understandable methods are explored to describe sloshing phenomenon through Computation Fluid Dynamics (CFD) simulation. Several parameters were varied including liquid level/tank length ratio, wave induced vessel motions, motion frequency, amplitudes in various sea state conditions. Parameters such as hydrodynamic force, pressure, moments, turbulent kinetic energy, height of the free surface, vorticity are used to quantify the sloshing intensity. In addition, visual inspections of sloshing motion are done through gas-liquid/oil-water interface fluctuation, streamlines, vector profiles. An equation connecting independent variables to resultant quantities will be established that will make it easier to describe the sloshing.

  13. Inertisation options for BG method and optimisation using CFD modelling

    Institute of Scientific and Technical Information of China (English)

    Morla Ramakrishna; Balusu Rao; Tanguturi Krishna; Ting Ren

    2015-01-01

    Spontaneous combustion (sponcom) is one of the issues of concern with the blasting gallery (BG) method of coal mining and has the potential to cause fires, and impact on production and safety, greenhouse gas (GHG) emissions and huge costs involved in controlling the aftermath situations. Some of the research attempts made to prevent and control coal mine fires and spontaneous combustion in thick seams worked with bord and pillar mining methods are presented in this paper. In the study, computational fluid dynamics (CFD) modelling techniques were used to simulate and assess the effects of various mining methods, layouts, designs, and different operational and ventilation parameters on the flow of goaf gases in BG panels. A wide range of parametric studies were conducted to develop proactive strategies to control and prevent ingress of oxygen into the goaf area preventing spontaneous combustion and mine fires.

  14. 3-D CFD Simulation and Validation of Oxygen-Rich Hydrocarbon Combustion in a Gas-Centered Swirl Coaxial Injector using a Flamelet-Based Approach

    Science.gov (United States)

    Richardson, Brian; Kenny, Jeremy

    2015-01-01

    Injector design is a critical part of the development of a rocket Thrust Chamber Assembly (TCA). Proper detailed injector design can maximize propulsion efficiency while minimizing the potential for failures in the combustion chamber. Traditional design and analysis methods for hydrocarbon-fuel injector elements are based heavily on empirical data and models developed from heritage hardware tests. Using this limited set of data produces challenges when trying to design a new propulsion system where the operating conditions may greatly differ from heritage applications. Time-accurate, Three-Dimensional (3-D) Computational Fluid Dynamics (CFD) modeling of combusting flows inside of injectors has long been a goal of the fluid analysis group at Marshall Space Flight Center (MSFC) and the larger CFD modeling community. CFD simulation can provide insight into the design and function of an injector that cannot be obtained easily through testing or empirical comparisons to existing hardware. However, the traditional finite-rate chemistry modeling approach utilized to simulate combusting flows for complex fuels, such as Rocket Propellant-2 (RP-2), is prohibitively expensive and time consuming even with a large amount of computational resources. MSFC has been working, in partnership with Streamline Numerics, Inc., to develop a computationally efficient, flamelet-based approach for modeling complex combusting flow applications. In this work, a flamelet modeling approach is used to simulate time-accurate, 3-D, combusting flow inside a single Gas Centered Swirl Coaxial (GCSC) injector using the flow solver, Loci-STREAM. CFD simulations were performed for several different injector geometries. Results of the CFD analysis helped guide the design of the injector from an initial concept to a tested prototype. The results of the CFD analysis are compared to data gathered from several hot-fire, single element injector tests performed in the Air Force Research Lab EC-1 test facility

  15. Coupling scales for modelling heavy metal vaporization from municipal solid waste incineration in a fluid bed by CFD

    Energy Technology Data Exchange (ETDEWEB)

    Soria, José, E-mail: jose.soria@probien.gob.ar [Institute for Research and Development in Process Engineering, Biotechnology and Alternative Energies (PROBIEN, CONICET – UNCo), 1400 Buenos Aires St., 8300 Neuquén (Argentina); Gauthier, Daniel; Flamant, Gilles [Processes, Materials and Solar Energy Laboratory (PROMES-CNRS, UPR 8521), 7 Four Solaire Street, Odeillo, 66120 Font-Romeu (France); Rodriguez, Rosa [Chemical Engineering Institute, National University of San Juan, 1109 Libertador (O) Avenue, 5400 San Juan (Argentina); Mazza, Germán [Institute for Research and Development in Process Engineering, Biotechnology and Alternative Energies (PROBIEN, CONICET – UNCo), 1400 Buenos Aires St., 8300 Neuquén (Argentina)

    2015-09-15

    Highlights: • A CFD two-scale model is formulated to simulate heavy metal vaporization from waste incineration in fluidized beds. • MSW particle is modelled with the macroscopic particle model. • Influence of bed dynamics on HM vaporization is included. • CFD predicted results agree well with experimental data reported in literature. • This approach may be helpful for fluidized bed reactor modelling purposes. - Abstract: Municipal Solid Waste Incineration (MSWI) in fluidized bed is a very interesting technology mainly due to high combustion efficiency, great flexibility for treating several types of waste fuels and reduction in pollutants emitted with the flue gas. However, there is a great concern with respect to the fate of heavy metals (HM) contained in MSW and their environmental impact. In this study, a coupled two-scale CFD model was developed for MSWI in a bubbling fluidized bed. It presents an original scheme that combines a single particle model and a global fluidized bed model in order to represent the HM vaporization during MSW combustion. Two of the most representative HM (Cd and Pb) with bed temperatures ranging between 923 and 1073 K have been considered. This new approach uses ANSYS FLUENT 14.0 as the modelling platform for the simulations along with a complete set of self-developed user-defined functions (UDFs). The simulation results are compared to the experimental data obtained previously by the research group in a lab-scale fluid bed incinerator. The comparison indicates that the proposed CFD model predicts well the evolution of the HM release for the bed temperatures analyzed. It shows that both bed temperature and bed dynamics have influence on the HM vaporization rate. It can be concluded that CFD is a rigorous tool that provides valuable information about HM vaporization and that the original two-scale simulation scheme adopted allows to better represent the actual particle behavior in a fluid bed incinerator.

  16. Coupling scales for modelling heavy metal vaporization from municipal solid waste incineration in a fluid bed by CFD

    International Nuclear Information System (INIS)

    Highlights: • A CFD two-scale model is formulated to simulate heavy metal vaporization from waste incineration in fluidized beds. • MSW particle is modelled with the macroscopic particle model. • Influence of bed dynamics on HM vaporization is included. • CFD predicted results agree well with experimental data reported in literature. • This approach may be helpful for fluidized bed reactor modelling purposes. - Abstract: Municipal Solid Waste Incineration (MSWI) in fluidized bed is a very interesting technology mainly due to high combustion efficiency, great flexibility for treating several types of waste fuels and reduction in pollutants emitted with the flue gas. However, there is a great concern with respect to the fate of heavy metals (HM) contained in MSW and their environmental impact. In this study, a coupled two-scale CFD model was developed for MSWI in a bubbling fluidized bed. It presents an original scheme that combines a single particle model and a global fluidized bed model in order to represent the HM vaporization during MSW combustion. Two of the most representative HM (Cd and Pb) with bed temperatures ranging between 923 and 1073 K have been considered. This new approach uses ANSYS FLUENT 14.0 as the modelling platform for the simulations along with a complete set of self-developed user-defined functions (UDFs). The simulation results are compared to the experimental data obtained previously by the research group in a lab-scale fluid bed incinerator. The comparison indicates that the proposed CFD model predicts well the evolution of the HM release for the bed temperatures analyzed. It shows that both bed temperature and bed dynamics have influence on the HM vaporization rate. It can be concluded that CFD is a rigorous tool that provides valuable information about HM vaporization and that the original two-scale simulation scheme adopted allows to better represent the actual particle behavior in a fluid bed incinerator

  17. CFD modeling and experience of waste-to-energy plant burning waste wood

    DEFF Research Database (Denmark)

    Rajh, B.; Yin, Chungen; Samec, N.;

    2013-01-01

    Computational Fluid Dynamics (CFD) is being increasingly used in industry for in-depth understanding of the fundamental mixing, combustion, heat transfer and pollutant formation in combustion processes and for design and optimization of Waste-to-Energy (WtE) plants. In this paper, CFD modeling...... of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is presented. As a validation effort, the temperature profiles at a number of ports in the furnace are measured and the experimental results are compared with the CFD predictions. In the simulation, a 1D model is developed to simulate...... the conversion of the waste wood in the fuel bed on the grate, which provides the appropriate inlet boundary condition for the freeboard 3D CFD simulation. The CFD analysis reveals the detailed mixing and combustion characteristics in the waste wood-fired furnace, pinpointing how to improve the design...

  18. CFD based combustion model for sewage sludge gasification in a fluidized bed

    Institute of Scientific and Technical Information of China (English)

    Yiqun WANG; Lifeng YAN

    2009-01-01

    Gasification is one potential way to use sewage sludge as renewable energy and solve the environmental problems caused by the huge amount of sewage sludge. In this paper, a three-dimensional Computational Fluid Dynamics (CFD) model has been developed to simulate the sewage sludge gasification process in a fluidized bed. The model describes the complex physical and chemical phenomena in the gasifier including turbulent flow, heat and mass transfer, and chemical reactions. The model is based on the Eulerian-Lagrangian concept using the non-premixed combustion modeling approach. In terms of the CFD software FLUENT, which represents a powerful tool for gasifIer analysis, the simulations provide detailed information on the gas products and temperature distribution in the gasifier. The model sensitivity is analyzed by performing the model in a laboratory-scale fluidized bed in the literature, and the model validation is carried out by comparing with experimental data from the literature. Results show that reasonably good agreement was achieved. Effects of temperature and Equivalence Ratio (ER) on the quality of product syngas (H2 + CO) are also studied.

  19. The CFD Investigation of Two Non-Aligned Turbines Using Actuator Disk Model and Overset Grids

    International Nuclear Information System (INIS)

    In this study flow over two axially non-aligned wind turbines is investigated via 3-D CFD analysis by solving Navier-Stokes equations. This setting is the test case geometry for the NTNU's ''Blind-Test'' Workshop 3 (BT3) and it aims to predict the performance of the wind turbines and their wake development under asymmetrical flow conditions. The performance of the turbine in the wake of the other turbine is numerically studied for different tip speed ratios. The measurements of velocity profile which is severely disturbed by both turbines are also carried out at the several locations of the wind tunnel. The computational results for NTNU wind turbine test case were obtained by 3-D CFD simulations with two different approaches. The first approach is to employ the actuator disk model, which is used in order to approximate the pressure jump across the rotor disk to simulate the impact of the wind turbines. At the second approach, the actual geometry of the turbine rotor was used, and the rotor blades were rotated using an overset grid methodology over the background grids. The thrust coefficients and the velocity profiles are calculated with two different approaches and the results are compared to experimental data presented in BT3

  20. Assessment of Computational Fluid Dynamics (CFD) Models for Shock Boundary-Layer Interaction

    Science.gov (United States)

    DeBonis, James R.; Oberkampf, William L.; Wolf, Richard T.; Orkwis, Paul D.; Turner, Mark G.; Babinsky, Holger

    2011-01-01

    A workshop on the computational fluid dynamics (CFD) prediction of shock boundary-layer interactions (SBLIs) was held at the 48th AIAA Aerospace Sciences Meeting. As part of the workshop numerous CFD analysts submitted solutions to four experimentally measured SBLIs. This paper describes the assessment of the CFD predictions. The assessment includes an uncertainty analysis of the experimental data, the definition of an error metric and the application of that metric to the CFD solutions. The CFD solutions provided very similar levels of error and in general it was difficult to discern clear trends in the data. For the Reynolds Averaged Navier-Stokes methods the choice of turbulence model appeared to be the largest factor in solution accuracy. Large-eddy simulation methods produced error levels similar to RANS methods but provided superior predictions of normal stresses.

  1. Modelling of a CFD Microscale Model and Its Application in Wind Energy Resource Assessment

    Directory of Open Access Journals (Sweden)

    Yue Jie-shun

    2016-01-01

    Full Text Available The prediction of a wind farm near the wind turbines has a significant effect on the safety as well as economy of wind power generation. To assess the wind resource distribution within a complex terrain, a computational fluid dynamics (CFD based wind farm forecast microscale model is developed. The model uses the Reynolds Averaged Navier-Stokes (RANS model to characterize the turbulence. By using the results of Weather Research and Forecasting (WRF mesoscale weather forecast model as the input of the CFD model, a coupled model of CFD-WRF is established. A special method is used for the treatment of the information interchange on the lateral boundary between two models. This established coupled model is applied in predicting the wind farm near a wind turbine in Hong Gang-zi, Jilin, China. The results from this simulation are compared to real measured data. On this basis, the accuracy and efficiency of turbulence characterization schemes are discussed. It indicates that this coupling system is easy to implement and can make these two separate models work in parallel. The CFD model coupled with WRF has the advantage of high accuracy and fast speed, which makes it valid for the wind power generation.

  2. The difficult challenge of a two-phase CFD modelling for all flow regimes

    International Nuclear Information System (INIS)

    Highlights: • The theoretical difficulties for modelling all flow regimes at CFD scale are identified. • The choice of the number of fields and of the time and space averaging or filtering are discussed and clarified. • Closure issues related to an all flow regime CFD model are listed and the main difficulties are identified. - Abstract: System thermalhydraulic codes model all two-phase flow regimes but they are limited to a macroscopic description. Two-phase CFD tools predict two-phase flow with a much finer space resolution but the current modelling capabilities are limited to dispersed bubbly or droplet flow and separate-phase flow. Much less experience exists on more complex flow regimes which combine the existence of dispersed fields with the presence of large interfaces such as a free surface or a film surface. A list of possible reactor issues which might benefit from an “all flow regime CFD model” is given. The first difficulty is to identify the various types of local flow configuration. It is shown that a 4-field model has much better capabilities than a two-fluid approach to identify most complex regimes. Then the choice between time averaging, space averaging, or even ensemble averaging is discussed. It is shown that only the RANS-2-fluid and a space-filtered 4-field model may be reasonably envisaged. The latter has the capabilities to identify all types of interfaces and should be privileged if a good accuracy is expected or if time fluctuations in intermittent flow have to be predicted while the former may be used when a high accuracy is not necessary and if time fluctuations in intermittent flow are not of interest. Finally the closure issue is presented including wall transfers, interfacial transfers, mass transfers between dispersed and continuous fields, and turbulent transfers. An important effort is required to model all interactions between sub-filter phenomena and the transfers from the sub-filter domain to the simulated domain. The

  3. Development and Verification of CFD Models for Modeling Wind Conditions on Forested Wind Turbine Sites

    DEFF Research Database (Denmark)

    Andersen, Morten Q.; Mortensen, Kasper; Nielsen, Daniel E.;

    2009-01-01

    This paper describes a proposed CFD model to simulate the wind conditions on a forested site. The model introduces porous subdomains representing the forests in the terrain. Obtained simulation values are compared to field measurements in- and outside a forest. Initial results are very promising...

  4. CFD Modeling of Free-Piston Stirling Engines

    Science.gov (United States)

    Ibrahim, Mounir B.; Zhang, Zhi-Guo; Tew, Roy C., Jr.; Gedeon, David; Simon, Terrence W.

    2001-01-01

    NASA Glenn Research Center (GRC) is funding Cleveland State University (CSU) to develop a reliable Computational Fluid Dynamics (CFD) code that can predict engine performance with the goal of significant improvements in accuracy when compared to one-dimensional (1-D) design code predictions. The funding also includes conducting code validation experiments at both the University of Minnesota (UMN) and CSU. In this paper a brief description of the work-in-progress is provided in the two areas (CFD and Experiments). Also, previous test results are compared with computational data obtained using (1) a 2-D CFD code obtained from Dr. Georg Scheuerer and further developed at CSU and (2) a multidimensional commercial code CFD-ACE+. The test data and computational results are for (1) a gas spring and (2) a single piston/cylinder with attached annular heat exchanger. The comparisons among the codes are discussed. The paper also discusses plans for conducting code validation experiments at CSU and UMN.

  5. Isothermal CFD-model of Peirce-Smith converting process

    Energy Technology Data Exchange (ETDEWEB)

    Vaarno, J.; Pitkaelae, J.; Ahokainen, T.; Jokilaakso, A.

    1997-12-31

    The Peirce-Smith converter has been a dominating copper and nickel matte refining process since 1905. Due to extremely difficult process conditions, very little measured data has been available for studying interactions of the gas injection and molten sulphide matte. Detailed information on fluid dynamics of the gas injection is needed in solving gas injection related problems like refractory wear, accretion growth and tuyere blockage as well as optimising the efficiency of momentum and mass transfer created by the gas jets. A commercial CFD-code PHOENICS was used to solve isothermal flow field of gas and liquid in a Peirce-Smith converter. An Euler-Euler based algorithm was chosen for modelling fluid dynamics and evaluating controlling forces of a submerged gas injection generally. Predictions were made with a {kappa}-{epsilon} turbulence model in the body fitted co-ordinate system. The model has been verified with a 1/4 scale water model, and a parametric study with the mathematical model of submerged gas injection was made for the PS-process and the ladle injection processes. Limits of the modelling technique used were recognised, but calculated results indicates that the present model predicts the general flow field with reasonable accuracy and it can be used as input for more detailed mathematical models of gas plumes. Predicted bubble distribution, pattern of the flow field and magnitude of flow velocities were also used to evaluate scaling factors of physical models and general flow conditions of an industrial PS-converter. (orig.) 28 refs.

  6. Two-dimensional CFD modeling of wave rotor flow dynamics

    Science.gov (United States)

    Welch, Gerard E.; Chima, Rodrick V.

    1993-01-01

    A two-dimensional Navier-Stokes solver developed for detailed study of wave rotor flow dynamics is described. The CFD model is helping characterize important loss mechanisms within the wave rotor. The wave rotor stationary ports and the moving rotor passages are resolved on multiple computational grid blocks. The finite-volume form of the thin-layer Navier-Stokes equations with laminar viscosity are integrated in time using a four-stage Runge-Kutta scheme. The Roe approximate Riemann solution scheme or the computationally less expensive Advection Upstream Splitting Method (AUSM) flux-splitting scheme are used to effect upwind-differencing of the inviscid flux terms, using cell interface primitive variables set by MUSCL-type interpolation. The diffusion terms are central-differenced. The solver is validated using a steady shock/laminar boundary layer interaction problem and an unsteady, inviscid wave rotor passage gradual opening problem. A model inlet port/passage charging problem is simulated and key features of the unsteady wave rotor flow field are identified. Lastly, the medium pressure inlet port and high pressure outlet port portion of the NASA Lewis Research Center experimental divider cycle is simulated and computed results are compared with experimental measurements. The model accurately predicts the wave timing within the rotor passage and the distribution of flow variables in the stationary inlet port region.

  7. Proposition of an outflow boundary approach for carotid artery stenosis CFD simulation.

    Science.gov (United States)

    Zhang, Yu; Furusawa, Toyoki; Sia, Sheau Fung; Umezu, Mitsuo; Qian, Yi

    2013-01-01

    The purpose of this study was to propose an innovative approach of setting outlet boundary conditions for the computational fluid dynamics (CFD) simulation of human common carotid arteries (CCAs) bifurcation based on the concept of energy loss minimisation at flow bifurcation. Comparisons between this new approach and previously reported boundary conditions were also made. The results showed that CFD simulation based on the proposed boundary conditions gave an accurate prediction of the critical stenosis ratio of carotid arteries (at around 65%). Other boundary conditions, such as the constant external pressure (P = 0) and constant outflow ratio, either overestimated or underestimated the critical stenosis ratio of carotid arteries. The patient-specific simulation results furthermore indicated that the calculated internal carotid artery flow ratio at CCA bifurcation (61%) coincided with the result obtained by clinical measurements through the use of Colour Doppler ultrasound. PMID:22288780

  8. RAPID CREATION OF CFD-CAPABLE CAD-MODELS FOR CABIN AIR VENTILATION SIMULATION

    OpenAIRE

    Fuchte, Jörg; Wick, Andreas; Rajkowski, Sergej

    2011-01-01

    The objective of this paper is to describe a method for rapid creation of cabin CAD (Computer Aided Design) models for usage in CFD (Computational Fluid Dynamics) simulations of cabin air ventilation. The intention is to automate the process of model creation in order to speed up the process and reduce the workload both in CAD modeling and mesh creation. The described method is part of a larger process intended to facilitate the usage of CFD cabin air ventilation simulations for passenger com...

  9. Towards a CFD-based mechanistic deposit formation model for straw-fired boilers

    DEFF Research Database (Denmark)

    Kær, Søren Knudsen; Rosendahl, Lasse Aistrup; Baxter, L.L.

    2006-01-01

    This paper discusses the application of FLUENTe in the analysis of grate-fired biomass boilers. A short description of the concept used to model fuel conversion on the grate and the coupling to the CFD code is offered. The development and implementation of a CFD-based deposition model is presented...... in the reminder of the paper. The growth of deposits on furnace walls and super heater tubes is treated including the impact on heat transfer rates determined by the CFD code. Based on the commercial CFD code FLUENTe, the overall model is fully implemented through the User Defined Functions. The model...... resistance changes. The model is applied to the straw-fired Masnedø boiler. Results are in good qualitative agreement with both measurements and observations at the plants. q 2005 Elsevier Ltd. All rights reserved....

  10. Application of a CFD based containment model to different large-scale hydrogen distribution experiments

    International Nuclear Information System (INIS)

    Highlights: • A CFD based model developed in ANSYS-FLUENT for simulating the distribution of hydrogen in the containment of a nuclear power plant during a severe accident is validated against four large-scale experiments. • The successive formation and mixing of a stratified gas-layer in experiments performed in the THAI and PANDA facilities are predicted well by the CFD model. • The pressure evolution and related condensation rate during different mixed convection flow conditions in the TOSQAN facility are predicted well by the CFD model. • The results give confidence in the general applicability of the CFD model and model settings. - Abstract: In the event of core degradation during a severe accident in water-cooled nuclear power plants (NPPs), large amounts of hydrogen are generated that may be released into the reactor containment. As the hydrogen mixes with the air in the containment, it can form a flammable mixture. Upon ignition it can damage relevant safety systems and put the integrity of the containment at risk. Despite the installation of mitigation measures, it has been recognized that the temporary existence of combustible or explosive gas clouds cannot be fully excluded during certain postulated accident scenarios. The distribution of hydrogen in the containment and mitigation of the risk are, therefore, important safety issues for NPPs. Complementary to lumped parameter code modelling, Computational Fluid Dynamics (CFD) modelling is needed for the detailed assessment of the hydrogen risk in the containment and for the optimal design of hydrogen mitigation systems in order to reduce this risk as far as possible. The CFD model applied by NRG makes use of the well-developed basic features of the commercial CFD package ANSYS-FLUENT. This general purpose CFD package is complemented with specific user-defined sub-models required to capture the relevant thermal-hydraulic phenomena in the containment during a severe accident as well as the effect of

  11. A CFD approach to the atmospheric dispersion of radionuclides in the vicinity of NPPs

    Energy Technology Data Exchange (ETDEWEB)

    Sampaio, Paulo A.B. [Programa de Pos-Graduacao em Ciencia e Tecnologia Nucleares, Instituto de Engenharia Nuclear/CNEN, CP 68550, CEP 21945-970, Rio de Janeiro, RJ (Brazil)], E-mail: sampaio@ien.gov.br; Junior, Milton A.G.; Lapa, Celso M.F. [Programa de Pos-Graduacao em Ciencia e Tecnologia Nucleares, Instituto de Engenharia Nuclear/CNEN, CP 68550, CEP 21945-970, Rio de Janeiro, RJ (Brazil)

    2008-01-15

    Most studies of atmospheric dispersion of radionuclides released from Nuclear Power Plants (NPPs) are based on Gaussian plume models or on the use of a convection-diffusion equation. Such methods, which do not involve solving the flow problem, are useful in the atmospheric mesoscale, of the order of 2-2000 km from the NPP. However, they do not account for the turbulence generated by the interaction of the wind with obstacles and with the released material stream, which are the dominant factors in the local scale, of the order of 0-2 km from the source of emission. Here, the authors advocate the use of computational fluid dynamics (CFD) to study the dispersion problem. The physical model comprises the Navier-Stokes equations, a convection-diffusion energy equation, and transport equations for the radionuclides. The paper details the stabilized finite element formulation used, stressing its connection with the variational multiscale/large eddy simulation approach. Adaptive techniques combining error estimation and remeshing are also employed. The method is implemented on a Beowulf parallel computing system using domain decomposition and the message passing interface (MPI). Controlled emissions from a chimney and release from severe accidents have been simulated, showing the importance of the local phenomena on the dispersion problem.

  12. Porous Media Approach of a CFD Code to Analyze a PWR Component with Tube or Rod Bundles

    International Nuclear Information System (INIS)

    This paper presents a strategy to innovate CFD code into a PWR component analysis code. A porous media approach is adapted to two-fluid model and conductor model, and a pack of constitutive relations to close the numerical model into component analysis code. The separate verification calculations on open media, conductor model and porous media approach are introduced. Based on the CUPID code, the component analysis code has been developed. For porous media model, constitutive correlations of a two-phase flow regime map, interfacial area, interfacial heat and mass transfer, interfacial drag, wall friction, wall heat transfer and heat partitioning in flows through tube or rod bundles are added. Separate calculations were also conducted to verify the developed code

  13. Summary of best guidelines and validation of CFD modeling in livestock buildings to ensure prediction quality

    DEFF Research Database (Denmark)

    Rong, Li; Nielsen, Peter Vilhelm; Bjerg, Bjarne Schmidt;

    2016-01-01

    scale pig barns was simulated to show the procedures of validating a CFD simulation in livestock buildings. After summarizing the guideline and/or best practice for CFD modeling, the authors addressed the issues related to numerical methods and the governing equations, which were limited to RANS models....... Although it is not necessary to maintain the same format of reporting the CFD modeling as presented in this paper, the authors would suggest including all the information related to the selection of turbulence models, difference schemes, convergence criteria, boundary conditions, geometry simplification......Computational Fluid Dynamics (CFD) is increasingly used to study airflow around and in livestock buildings, to develop technologies to mitigate emissions and to predict the contaminant dispersion from livestock buildings. In this paper, an example of air flow distribution in a room with two full...

  14. Coupling a CFD code with neutron kinetics and pin thermal models for nuclear reactor safety analyses

    International Nuclear Information System (INIS)

    Highlights: • A CFD/neutron kinetics coupled code FLUENT/PK for nuclear reactor transient safety was developed. • The mathematical models and coupling methods of FLUENT/PK were described. • The code-to-code validation between FLUENT/PK and SIMMER-III was conducted. - Abstract: Most system codes are based on the one-dimensional lumped-parameter method, which is unsuitable to simulate multi-dimensional thermal-hydraulics problems. CFD method is a good tool to simulate multi-dimensional thermal-hydraulics phenomena in the nuclear reactor, which can increase the accuracy of analysis results. However, since there is no neutron kinetics model and pin thermal model in current CFD codes, the application of the CFD method in the area of nuclear reactor safety analyses is still limited. Coupling a CFD code with the neutron kinetics model (PKM) and the pin thermal model (PTM) is a good way to use CFD code to simulate multi-dimensional thermal-hydraulics problems of nuclear reactors. The motivation for this work is to develop a CFD/neutron kinetics coupled code named FLUENT/PK for nuclear reactor safety analyses by coupling the commercial CFD code named FLUENT with the point kinetics model (PKM) and the pin thermal model (PTM). The mathematical models and the coupling method are described and the unprotected transient overpower (UTOP) accident of a liquid metal cooled fast reactor (LMFR) is chosen as an application case. As a general validation, the calculated results are used to compare with that of another multi-physics coupled code named SIMMER-III and good agreements are achieved for various characteristic parameters

  15. CFD Modeling of LNG Spill: Humidity Effect on Vapor Dispersion

    Science.gov (United States)

    Giannissi, S. G.; Venetsanos, A. G.; Markatos, N.

    2015-09-01

    The risks entailed by an accidental spill of Liquefied Natural Gas (LNG) should be indentified and evaluated, in order to design measures for prevention and mitigation in LNG terminals. For this purpose, simulations are considered a useful tool to study LNG spills and to understand the mechanisms that influence the vapor dispersion. In the present study, the ADREA-HF CFD code is employed to simulate the TEEX1 experiment. The experiment was carried out at the Brayton Fire Training Field, which is affiliated with the Texas A&M University system and involves LNG release and dispersion over water surface in open- obstructed environment. In the simulation the source was modeled as a two-phase jet enabling the prediction of both the vapor dispersion and the liquid pool spreading. The conservation equations for the mixture are solved along with the mass fraction for natural gas. Due to the low prevailing temperatures during the spill ambient humidity condenses and this might affect the vapor dispersion. This effect was examined in this work by solving an additional conservation equation for the water mass fraction. Two different models were tested: the hydrodynamic equilibrium model which assumes kinetic equilibrium between the phases and the non hydrodynamic equilibrium model, in order to assess the effect of slip velocity on the prediction. The slip velocity is defined as the difference between the liquid phase and the vapor phase and is calculated using the algebraic slip model. Constant droplet diameter of three different sizes and a lognormal distribution of the droplet diameter were applied and the results are discussed and compared with the measurements.

  16. Hydrogen production in a zigzag and straight catalytic wall coated micro channel reactor by CFD modeling

    Energy Technology Data Exchange (ETDEWEB)

    Fazeli, Ali; Behnam, Mohsen [Gas Research Division, Research Institute of Petroleum Industry (RIPI), P.O. Box 14665-137, Tehran (Iran)

    2010-09-15

    Hydrogen production from steam reforming of methanol for fuel cell application was modeled in a wall coated micro channel reactor by CFD approach. Heat of steam reforming (SR) was supplied from catalytic total oxidation (TOX) of methanol on Cu/ZnO/Al{sub 2}O{sub 3} catalyst and Heat conducts from TOX to SR zone through Steel divider wall between two channels. Heat integration was compared in zigzag and straight geometry of microreactor by CFD modeling. The model is two dimensional, steady state and containing five zones: TOX fluid, TOX catalyst layer, steel wall of the channel, SR catalyst layer and SR fluid. Set of partial differential equations (PDEs) including x and y momentum balance, continuity, partial mass balances and energy balance was solved by finite volume method. Stiff reaction rates were considered for methanol total oxidation (TOX), methanol steam reforming (SR), water gas shift (WGS) and methanol decomposition (MD) reactions. The results show that zigzag geometry is better than straight one because heat and mass transfer in zigzag reactor are more than straight. Conversion of methanol in zigzag geometry is greater than straight one. In the outlet of zigzag micro channels, carbon monoxide selectivity is less and hydrogen mole fraction is more than straight one. (author)

  17. CFD modeling of a spouted bed with a porous draft tube

    Institute of Scientific and Technical Information of China (English)

    Salar Azizi; Seyyed Hossein Hosseini; M. Moraveji; Goodarz Ahmadi

    2010-01-01

    Spouted bed with a porous draft tube is used for drying of grains and chemical products and thermal disinfestations process. This work provides a computational fluid dynamics (CFD) simulation of binary mixtures of glass particles in a spouted bed with a porous draft tube. The simulation used the multi-fluid Eulerian-Eulerian approach based on kinetic theory of granular flows, incorporating a kinetic-frictional constitutive model for dense assemblies of particulate solids and Gidaspow's drag model for the inter-action between gas and particles. Influences of solids mass fraction and inlet gas flow rate on pressure distribution, gas and particle velocities were studied. The modeling results were compared with the exper-imental work of Ishikura, Nagashima, and lde (2003) for the flow condition along the axis of the spouted bed. Good agreement between the modeling results and experimental data was observed.

  18. A Quasi-One-Dimensional CFD Model for Multistage Turbomachines

    Institute of Scientific and Technical Information of China (English)

    Olivier Léonard; Olivier Adam

    2008-01-01

    The objective of this paper is to present a fast and reliable CFD model that is able to simulate stationary and transient operations of multistage compressors and turbines. This analysis tool is based on an adapted version of the Euler equations solved by a time-marching, finite-volume method. The Euler equations have been extended by including source terms expressing the blade-flow interactions. These source terms are determined using the velocity triangles and a row-by-row representation of the blading at mid-span. The losses and deviations undergone by the fluid across each blade row are supplied by correlations. The resulting flow solver is a performance prediction tool based only on the machine geometry, offering the possibility of exploring the entire characteristic map of a multistage compressor or turbine. Its efficiency in terms of CPU time makes it possible to couple it to an optimization algorithm or to a gas turbine performance tool. Different test-cases are presented for which the calculated characteristic maps are compared to experimental ones.

  19. CFD of mixing of multi-phase flow in a bioreactor using population balance model.

    Science.gov (United States)

    Sarkar, Jayati; Shekhawat, Lalita Kanwar; Loomba, Varun; Rathore, Anurag S

    2016-05-01

    Mixing in bioreactors is known to be crucial for achieving efficient mass and heat transfer, both of which thereby impact not only growth of cells but also product quality. In a typical bioreactor, the rate of transport of oxygen from air is the limiting factor. While higher impeller speeds can enhance mixing, they can also cause severe cell damage. Hence, it is crucial to understand the hydrodynamics in a bioreactor to achieve optimal performance. This article presents a novel approach involving use of computational fluid dynamics (CFD) to model the hydrodynamics of an aerated stirred bioreactor for production of a monoclonal antibody therapeutic via mammalian cell culture. This is achieved by estimating the volume averaged mass transfer coefficient (kL a) under varying conditions of the process parameters. The process parameters that have been examined include the impeller rotational speed and the flow rate of the incoming gas through the sparger inlet. To undermine the two-phase flow and turbulence, an Eulerian-Eulerian multiphase model and k-ε turbulence model have been used, respectively. These have further been coupled with population balance model to incorporate the various interphase interactions that lead to coalescence and breakage of bubbles. We have successfully demonstrated the utility of CFD as a tool to predict size distribution of bubbles as a function of process parameters and an efficient approach for obtaining optimized mixing conditions in the reactor. The proposed approach is significantly time and resource efficient when compared to the hit and trial, all experimental approach that is presently used. © 2016 American Institute of Chemical Engineers Biotechnol. Prog., 32:613-628, 2016. PMID:26850863

  20. Recent advances on thermohydraulic simulation of HTR-10 nuclear reactor core using realistic CFD approach

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Alexandro S., E-mail: alexandrossilva@ifba.edu.br [Instituto Federal de Educacao, Ciencia e Tecnologia da Bahia (IFBA), Vitoria da Conquista, BA (Brazil); Mazaira, Leorlen Y.R., E-mail: leored1984@gmail.com, E-mail: cgh@instec.cu [Instituto Superior de Tecnologias y Ciencias Aplicadas (INSTEC), La Habana (Cuba); Dominguez, Dany S.; Hernandez, Carlos R.G., E-mail: alexandrossilva@gmail.com, E-mail: dsdominguez@gmail.com [Universidade Estadual de Santa Cruz (UESC), Ilheus, BA (Brazil). Programa de Pos-Graduacao em Modelagem Computacional; Lira, Carlos A.B.O., E-mail: cabol@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

    2015-07-01

    High-temperature gas-cooled reactors (HTGRs) have the potential to be used as possible energy generation sources in the near future, owing to their inherently safe performance by using a large amount of graphite, low power density design, and high conversion efficiency. However, safety is the most important issue for its commercialization in nuclear energy industry. It is very important for safety design and operation of an HTGR to investigate its thermal-hydraulic characteristics. In this article, it was performed the thermal-hydraulic simulation of compressible flow inside the core of the pebble bed reactor HTR (High Temperature Reactor)-10 using Computational Fluid Dynamics (CFD). The realistic approach was used, where every closely packed pebble is realistically modelled considering a graphite layer and sphere of fuel. Due to the high computational cost is impossible simulate the full core; therefore, the geometry used is a FCC (Face Centered Cubic) cell with the half height of the core, with 21 layers and 95 pebbles. The input data used were taken from the thermal-hydraulic IAEA Bechmark. The results show the profiles of velocity and temperature of the coolant in the core, and the temperature distribution inside the pebbles. The maximum temperatures in the pebbles do not exceed the allowable limit for this type of nuclear fuel. (author)

  1. Comparison of CFD and operational dispersion models in an urban-like environment

    Science.gov (United States)

    Antonioni, G.; Burkhart, S.; Burman, J.; Dejoan, A.; Fusco, A.; Gaasbeek, R.; Gjesdal, T.; Jäppinen, A.; Riikonen, K.; Morra, P.; Parmhed, O.; Santiago, J. L.

    2012-02-01

    Chemical plants, refineries, transportation of hazardous materials are some of the most attractive facilities for external attacks aimed at the release of toxic substances. Dispersion of these substances into the atmosphere forms a concentration distribution of airborne pollutants with severe consequences for exposed individuals. For emergency preparedness and management, the availability of assessed/validated dispersion models, which can be able to predict concentration distribution and thus dangerous zones for exposed individuals, is of primary importance. Air quality models, integral models and analytical models predict the transport and the turbulent dispersion of gases or aerosols after their release without taking into account in detail the presence of obstacles. Obstacles can modify the velocity field and in turn the concentration field. The Computational Fluid Dynamics (CFD) models on the other hand are able to describe such phenomena, but they need to be correctly set up, tested and validated in order to obtain reliable results. Within the project Europa-ERG1 TA 113.034 "NBC Modelling and Simulation" several different approaches in CFD modelling of turbulent dispersion in closed, semi-confined and urban-like environment were adopted and compared with experimental data and with operational models. In this paper the results of a comparison between models describing the dispersion of a neutral gas in an idealized urban-like environment are presented and discussed. Experimental data available in the literature have been used as a benchmark for assessing statistical performance for each model. Selected experimental trials include some water channel tests, that were performed by Coanda at 1:205 scale, and one full-scale case that was tested in the fall of 2001 at the Dugway Proving Grounds in Utah, using an array of shipping containers. The paper also suggests the adoption of improved statistical parameters in order to better address differences between models

  2. A new approach to design a control system for a FGR furnace using the combination of the CFD and linear system identification techniques

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, R.; Zhang, C.; Jiang, J. [University of Western Ontario, London, ON (Canada)

    2011-07-01

    A new approach to design control systems for an industrial furnace with flue gas recirculation (FGR) is presented. To facilitate the control system design, a linear dynamic model is needed for the furnace. Full-scale computational fluid dynamics (CFD) simulations are used to generate the required small signal input and output data sets. Subsequently, a least squares based system identification technique is used to obtained the linear dynamic models. After model validation, feedback controller is designed based on these linear dynamic models. Finally, the performance of the designed closed-loop control system is also evaluated using both linear dynamic model and full-scale nonlinear CFD model. The comparison shows that the control system designed using the proposed approach can minimize the deviation of nitric oxides (NO) emission from the design point by minimize the dynamic NO formation, hence to prevent any excessive NO formation in the combustion process when the system subjects to disturbances.

  3. Optimal Design of Two-Chamber Gas Distributor with CFD Approach

    Institute of Scientific and Technical Information of China (English)

    Dongfang Zhao; Fengguo Liu; Xueyi You; Xinhua Wang

    2015-01-01

    Computational fluid dynamics ( CFD) is used to investigate a new type of two⁃chamber natural gas distributor, which has a natural gas inlet and nine nozzle outlets. The uniformity at the outlet of distributor is practice proven to have significant degree influence on its comprehensive performance. To improve the uniformity at the nozzles of the gas distributor, CFD modeling with the RNG k⁃ε turbulence model is undertaken to understand the mass flow rate of nozzles with reference to different length of chambers and the most optimal length is obtained. The internal flow pattern of the natural gas distributor is analyzed. It is found that the local maximum deviation of the nozzle outflow rate increases with the increase of chambers length when the length is more than 64 mm. The results provide useful suggestions for the optimal design of two⁃chamber natural gas distributor.

  4. Recurrence CFD - a novel approach to simulate multiphase flows with strongly separated time scales

    CERN Document Server

    Lichtenegger, Thomas

    2016-01-01

    Classical Computational Fluid Dynamics (CFD) of long-time processes with strongly separated time scales is computationally extremely demanding if not impossible. Consequently, the state-of-the-art description of such systems is not capable of real-time simulations or online process monitoring. In order to bridge this gap, we propose a new method suitable to decouple slow from fast degrees of freedom in many cases. Based on the recurrence statistics of unsteady flow fields, we deduce a recurrence process which enables the generic representation of pseudo-periodic motion at high spatial and temporal resolution. Based on these fields, passive scalars can be traced by recurrence CFD. While a first, Eulerian Model A solves a passive transport equation in a classical implicit finite-volume environment, a second, Lagrangian Model B propagates fluid particles obeying a stochastic differential equation explicitly. Finally, this new concept is tested by two multiphase processes - a lab scale oscillating bubble column a...

  5. Simulation and Scale-up of Barium Sulphate Precipitation Process Using CFD Modeling

    Institute of Scientific and Technical Information of China (English)

    龚俊波; 卫宏远; 王静康; JohnGarsideb

    2005-01-01

    Some empirical mixing models were used to describe the imperfect mixing in precipitation process.However, the models can not, in general, reflect the details of interactions between mixing and crystallization in a vessel. In this study, CFD (computational fluid dynamics) technique were developed by simulating the precipitation of barium sulphate in stirred tanks by integration of population balance equations with a CFD solver. Two typical impellers, Rushton and pitched blade turbines, were employed for agitation. The influence of feed concentration and position on crystal product properties was investigated by CFD simulation. The scale-up of these precipitators was systematically studied. Significant effect on the crystal properties was found for the scale-up under some conditions.Keywords simulation, scale up, precipitation, CFD(computational fluid dynamics)

  6. cfd modelling and experimental study on the fluid flow and heat transfer in copper heat sink design

    OpenAIRE

    Karimpourian, Bijan

    2007-01-01

    Abstract This thesis is studying the heatsinks new designs for copper heatsinks which utilizes modelling and simulation by CFD, construction of prototypes and experimental works. Challenges and complications in manufacturing of copper heatsinks are expressed and finding the solutions to these hindrances involve in this work. Numerical efforts supported by fluent are made to promote investigation and approaching the goal in which serves the new opportunities for wider application of copper mat...

  7. Evaluation of gas radiation models in CFD modeling of oxy-combustion

    International Nuclear Information System (INIS)

    Highlights: • CFD modeling of a typical industrial water tube boiler is conducted. • Different combustion processes were considered including air and oxy-fuel combustion. • SGG, EWBM, Leckner, Perry and WSGG radiation models were considered in the study. • EWBM is the most accurate model and it’s considered to be the benchmark model. • Characteristics of oxy-fuel combustion are compared to those of air–fuel combustion. - Abstract: Proper determination of the radiation energy is very important for proper predictions of the combustion characteristics inside combustion devices using CFD modeling. For this purpose, different gas radiation models were developed and applied in the present work. These radiation models vary in their accuracy and complexity according to the application. In this work, a CFD model for a typical industrial water tube boiler was developed, considering three different combustion environments. The combustion environments are air–fuel combustion (21% O2 and 79% N2), oxy-fuel combustion (21% O2 and 79% CO2) and oxy-fuel combustion (27% O2 and 73% CO2). Simple grey gas (SGG), exponential wide band model (EWBM), Leckner, Perry and weighted sum of grey gases (WSGG) radiation models were examined and their influences on the combustion characteristics were evaluated. Among those radiation models, the EWBM was found to provide close results to the experimental data for the present boiler combustion application. The oxy-fuel combustion characteristics were analyzed and compared with those of air–fuel combustion

  8. Teaching CFD as a Black Box: A Validation and Verification Approach

    Science.gov (United States)

    Hertzberg, Jean

    2012-11-01

    There are a number of good reasons for NOT teaching computational fluid dynamics to undergraduates: a reluctance to make room in an already-compressed curriculum, the sophistication of the computational techniques and mathematics involved, the cost of licensing a professional quality code, and above all, the danger that a shallow understanding of CFD will lead to blithely accepted incorrect results. Nevertheless, as today's students enter the workplace they are routinely expected to be able to use CFD and other high level software packages. Industry's response to the necessity of minimally trained engineers using such software is a series of tests prior to accepting the results: verification and validation (V&V), or more specifically independent software verification and validation (ISVV). The verification question asks ``is the software producing correct answers, given the inputs?'' while the validation question asks ``is this the right set of inputs, are the right physics being addressed?'' A recent attempt to implement a V&V approach to CFD in the required undergraduate curriculum at the University of Colorado will be described.

  9. An Approach to Improved Credibility of CFD Simulations for Rocket Injector Design

    Science.gov (United States)

    Tucker, Paul K.; Menon, Suresh; Merkle, Charles L.; Oefelein, Joseph C.; Yang, Vigor

    2007-01-01

    Computational fluid dynamics (CFD) has the potential to improve the historical rocket injector design process by simulating the sensitivity of performance and injector-driven thermal environments to. the details of the injector geometry and key operational parameters. Methodical verification and validation efforts on a range of coaxial injector elements have shown the current production CFD capability must be improved in order to quantitatively impact the injector design process.. This paper documents the status of an effort to understand and compare the predictive capabilities and resource requirements of a range of CFD methodologies on a set of model problem injectors. Preliminary results from a steady Reynolds-Average Navier-Stokes (RANS), an unsteady Reynolds-Average Navier Stokes (URANS) and three different Large Eddy Simulation (LES) techniques used to model a single element coaxial injector using gaseous oxygen and gaseous hydrogen propellants are presented. Initial observations are made comparing instantaneous results, corresponding time-averaged and steady-state solutions in the near -injector flow field. Significant differences in the flow fields exist, as expected, and are discussed. An important preliminary result is the identification of a fundamental mixing mechanism, accounted for by URANS and LES, but missing in the steady BANS methodology. Since propellant mixing is the core injector function, this mixing process may prove to have a profound effect on the ability to more correctly simulate injector performance and resulting thermal environments. Issues important to unifying the basis for future comparison such as solution initialization, required run time and grid resolution are addressed.

  10. iCFD: Interpreted Computational Fluid Dynamics - Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design - The secondary clarifier.

    Science.gov (United States)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat; Plósz, Benedek Gy

    2015-10-15

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models - computationally light tools, used e.g., as sub-models in systems analysis. The objective is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method - presented in a straightforward and transparent way - is illustrated using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor screening study and system understanding, 50 different sets of design and flow conditions are selected using Latin Hypercube Sampling (LHS). The boundary condition sets are imposed on a 2-D axi-symmetrical CFD simulation model of the SST. In the framework, to degenerate the 2-D model structure, CFD model outputs are approximated by the 1-D model through the calibration of three different model structures for D. Correlation equations for the D parameter then are identified as a function of the selected design and flow boundary conditions (meta-models), and their accuracy is evaluated against D values estimated in each numerical experiment. The evaluation and validation of the iCFD model structure is carried out using scenario simulation results obtained with parameters sampled from the corners of the LHS experimental region. For the studied SST, additional iCFD model development was carried out in terms of (i) assessing different density current sub-models; (ii) implementation of a combined flocculation, hindered, transient and compression settling velocity function; and (iii

  11. iCFD: Interpreted Computational Fluid Dynamics - Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design - The secondary clarifier.

    Science.gov (United States)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat; Plósz, Benedek Gy

    2015-10-15

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models - computationally light tools, used e.g., as sub-models in systems analysis. The objective is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method - presented in a straightforward and transparent way - is illustrated using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor screening study and system understanding, 50 different sets of design and flow conditions are selected using Latin Hypercube Sampling (LHS). The boundary condition sets are imposed on a 2-D axi-symmetrical CFD simulation model of the SST. In the framework, to degenerate the 2-D model structure, CFD model outputs are approximated by the 1-D model through the calibration of three different model structures for D. Correlation equations for the D parameter then are identified as a function of the selected design and flow boundary conditions (meta-models), and their accuracy is evaluated against D values estimated in each numerical experiment. The evaluation and validation of the iCFD model structure is carried out using scenario simulation results obtained with parameters sampled from the corners of the LHS experimental region. For the studied SST, additional iCFD model development was carried out in terms of (i) assessing different density current sub-models; (ii) implementation of a combined flocculation, hindered, transient and compression settling velocity function; and (iii

  12. Active-passive measurements and CFD based modelling for indoor radon dispersion study

    International Nuclear Information System (INIS)

    Computational fluid dynamics (CFD) play a significant role in indoor pollutant dispersion study. Radon is an indoor pollutant which is radioactive and inert gas in nature. The concentration level and spatial distribution of radon may be affected by the dwelling's ventilation conditions. Present work focus at the study of indoor radon gas distribution via measurement and CFD modeling in naturally ventilated living room. The need of the study is the prediction of activity level and to study the effect of natural ventilation on indoor radon. Two measurement techniques (Passive measurement using pin-hole dosimeters and active measurement using continuous radon monitor (SRM)) were used for the validation purpose of CFD results. The CFD simulation results were compared with the measurement results at 15 points, 3 XY planes at different heights along with the volumetric average concentration. The simulation results found to be comparable with the measurement results. The future scope of these CFD codes is to study the effect of varying inflow rate of air on the radon concentration level and dispersion pattern. - Highlights: • The distribution of radon gas in indoor environment was simulated using CFD modelling. • The distribution of radon was found to be more homogenous in open room condition. • The radon concentration level in open room was low as compare to closed room due to enhanced ventilation rate. • Simulation results are in agreement with active and passive measurements results

  13. A CFD approach on simulation of hydrogen production from steam reforming of glycerol in a fluidized bed reactor

    Energy Technology Data Exchange (ETDEWEB)

    Dou, Binlin; Song, Yongchen [School of Energy and Power Engineering, Key Laboratory of Ocean Energy Utilization and Energy Conservation of Ministry of Education, Dalian University of Technology, Dalian 116023 (China)

    2010-10-15

    Hydrogen production from steam reforming of glycerol in a fluidized bed reactor has been simulated using a CFD method by an additional transport equation with a kinetic term. The Eulerian-Eulerian two-fluid approach was adopted to simulate hydrodynamics of fluidization, and chemical reactions were modelled by laminar finite-rate model. The bed expansion and pressure drop were predicted for different inlet gas velocities. The results showed that the flow system exhibited a more heterogeneous structure, and the core-annulus structure of gas-solid flow led to back-mixing and internal circulation behaviour, and thus gave a poor velocity distribution. This suggests the bed should be agitated to maintain satisfactory fluidizing conditions. Glycerol conversion and H{sub 2} production were decreased with increasing inlet gas velocity. The increase in the value of steam to carbon molar ratio increases the conversion of glycerol and H{sub 2} selectivity. H{sub 2} concentrations in the bed were uneven and increased downstream and high concentrations of H{sub 2} production were also found on walls. The model demonstrated a relationship between hydrodynamics and hydrogen production, implying that the residence time and steam to carbon molar ratio are important parameters. The CFD simulation will provide helpful data to design and operate a bench scale catalytic fluidized bed reactor. (author)

  14. From Detailed Description of Chemical Reacting Carbon Particles to Subgrid Models for CFD

    Directory of Open Access Journals (Sweden)

    Schulze S.

    2013-04-01

    Full Text Available This work is devoted to the development and validation of a sub-model for the partial oxidation of a spherical char particle moving in an air/steam atmosphere. The particle diameter is 2 mm. The coal particle is represented by moisture- and ash-free nonporous carbon while the coal rank is implemented using semi-global reaction rate expressions taken from the literature. The submodel includes six gaseous chemical species (O2, CO2, CO, H2O, H2, N2. Three heterogeneous reactions are employed, along with two homogeneous semi-global reactions, namely carbon monoxide oxidation and the water-gas-shift reaction. The distinguishing feature of the subgrid model is that it takes into account the influence of homogeneous reactions on integral characteristics such as carbon combustion rates and particle temperature. The sub-model was validated by comparing its results with a comprehensive CFD-based model resolving the issues of bulk flow and boundary layer around the particle. In this model, the Navier-Stokes equations coupled with the energy and species conservation equations were used to solve the problem by means of the pseudo-steady state approach. At the surface of the particle, the balance of mass, energy and species concentration was applied including the effect of the Stefan flow and heat loss due to radiation at the surface of the particle. Good agreement was achieved between the sub-model and the CFD-based model. Additionally, the CFD-based model was verified against experimental data published in the literature (Makino et al. (2003 Combust. Flame 132, 743-753. Good agreement was achieved between numerically predicted and experimentally obtained data for input conditions corresponding to the kinetically controlled regime. The maximal discrepancy (10% between the experiments and the numerical results was observed in the diffusion-controlled regime. Finally, we discuss the influence of the Reynolds number, the ambient O2 mass fraction and the ambient

  15. Thermohydraulic simulation of HTR-10 nuclear reactor core using realistic CFD approach; Simulacao termohidraulica do nucleo do reator nuclear HTR-10 com o uso da abordagem realistica CFD

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Alexandro S.; Dominguez, Dany S., E-mail: alexandrossilva@gmail.com, E-mail: dsdominguez@gmail.com [Universidade Estadual de Santa Cruz (UESC), Ilheus, BA (Brazil); Mazaira, Leorlen Y. Rojas; Hernandez, Carlos R.G., E-mail: leored1984@gmail.com, E-mail: cgh@instec.cu [Instituto Superior de Tecnologias y Ciencias Aplicadas, La Habana (Cuba); Lira, Carlos Alberto Brayner de Oliveira, E-mail: cabol@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)

    2015-07-01

    High-temperature gas-cooled reactors (HTGRs) have the potential to be used as possible energy generation sources in the near future, owing to their inherently safe performance by using a large amount of graphite, low power density design, and high conversion efficiency. However, safety is the most important issue for its commercialization in nuclear energy industry. It is very important for safety design and operation of an HTGR to investigate its thermal–hydraulic characteristics. In this article, it was performed the thermal–hydraulic simulation of compressible flow inside the core of the pebble bed reactor HTR (High Temperature Reactor)-10 using Computational Fluid Dynamics (CFD). The realistic approach was used, where every closely packed pebble is realistically modelled considering a graphite layer and sphere of fuel. Due to the high computational cost is impossible simulate the full core; therefore, the geometry used is a column of FCC (Face Centered Cubic) cells, with 41 layers and 82 pebbles. The input data used were taken from the thermohydraulic IAEA Benchmark (TECDOC-1694). The results show the profiles of velocity and temperature of the coolant in the core, and the temperature distribution inside the pebbles. The maximum temperatures in the pebbles do not exceed the allowable limit for this type of nuclear fuel. (author)

  16. Development of a compartment model based on CFD simulations for description of mixing in bioreactors

    Directory of Open Access Journals (Sweden)

    Crine, M.

    2010-01-01

    Full Text Available Understanding and modeling the complex interactions between biological reaction and hydrodynamics are a key problem when dealing with bioprocesses. It is fundamental to be able to accurately predict the hydrodynamics behavior of bioreactors of different size and its interaction with the biological reaction. CFD can provide detailed modeling about hydrodynamics and mixing. However, it is computationally intensive, especially when reactions are taken into account. Another way to predict hydrodynamics is the use of "Compartment" or "Multi-zone" models which are much less demanding in computation time than CFD. However, compartments and fluxes between them are often defined by considering global quantities not representative of the flow. To overcome the limitations of these two methods, a solution is to combine compartment modeling and CFD simulations. Therefore, the aim of this study is to develop a methodology in order to propose a compartment model based on CFD simulations of a bioreactor. The flow rate between two compartments can be easily computed from the velocity fields obtained by CFD. The difficulty lies in the definition of the zones in such a way they can be considered as perfectly mixed. The creation of the model compartments from CFD cells can be achieved manually or automatically. The manual zoning consists in aggregating CFD cells according to the user's wish. The automatic zoning defines compartments as regions within which the value of one or several properties are uniform with respect to a given tolerance. Both manual and automatic zoning methods have been developed and compared by simulating the mixing of an inert scalar. For the automatic zoning, several algorithms and different flow properties have been tested as criteria for the compartment creation.

  17. Improvement of AEP Predictions Using Diurnal CFD Modelling with Site-Specific Stability Weightings Provided from Mesoscale Simulation

    Science.gov (United States)

    Hristov, Y.; Oxley, G.; Žagar, M.

    2014-06-01

    The Bolund measurement campaign, performed by Danish Technical University (DTU) Wind Energy Department (also known as RISØ), provided significant insight into wind flow modeling over complex terrain. In the blind comparison study several modelling solutions were submitted with the vast majority being steady-state Computational Fluid Dynamics (CFD) approaches with two equation k-epsilon turbulence closure. This approach yielded the most accurate results, and was identified as the state-of-the-art tool for wind turbine generator (WTG) micro-siting. Based on the findings from Bolund, further comparison between CFD and field measurement data has been deemed essential in order to improve simulation accuracy for turbine load and long-term Annual Energy Production (AEP) estimations. Vestas Wind Systems A/S is a major WTG original equipment manufacturer (OEM) with an installed base of over 60GW in over 70 countries accounting for 19% of the global installed base. The Vestas Performance and Diagnostic Centre (VPDC) provides online live data to more than 47GW of these turbines allowing a comprehensive comparison between modelled and real-world energy production data. In previous studies, multiple sites have been simulated with a steady neutral CFD formulation for the atmospheric surface layer (ASL), and wind resource (RSF) files have been generated as a base for long-term AEP predictions showing significant improvement over predictions performed with the industry standard linear WAsP tool. In this study, further improvements to the wind resource file generation with CFD are examined using an unsteady diurnal cycle approach with a full atmospheric boundary layer (ABL) formulation, with the unique stratifications throughout the cycle weighted according to mesoscale simulated sectorwise stability frequencies.

  18. Improvement of AEP Predictions Using Diurnal CFD Modelling with Site-Specific Stability Weightings Provided from Mesoscale Simulation

    International Nuclear Information System (INIS)

    The Bolund measurement campaign, performed by Danish Technical University (DTU) Wind Energy Department (also known as RISØ), provided significant insight into wind flow modeling over complex terrain. In the blind comparison study several modelling solutions were submitted with the vast majority being steady-state Computational Fluid Dynamics (CFD) approaches with two equation k-ε turbulence closure. This approach yielded the most accurate results, and was identified as the state-of-the-art tool for wind turbine generator (WTG) micro-siting. Based on the findings from Bolund, further comparison between CFD and field measurement data has been deemed essential in order to improve simulation accuracy for turbine load and long-term Annual Energy Production (AEP) estimations. Vestas Wind Systems A/S is a major WTG original equipment manufacturer (OEM) with an installed base of over 60GW in over 70 countries accounting for 19% of the global installed base. The Vestas Performance and Diagnostic Centre (VPDC) provides online live data to more than 47GW of these turbines allowing a comprehensive comparison between modelled and real-world energy production data. In previous studies, multiple sites have been simulated with a steady neutral CFD formulation for the atmospheric surface layer (ASL), and wind resource (RSF) files have been generated as a base for long-term AEP predictions showing significant improvement over predictions performed with the industry standard linear WAsP tool. In this study, further improvements to the wind resource file generation with CFD are examined using an unsteady diurnal cycle approach with a full atmospheric boundary layer (ABL) formulation, with the unique stratifications throughout the cycle weighted according to mesoscale simulated sectorwise stability frequencies

  19. Investigation of Microclimate by CFD Modeling of Moisture Interactions between Air and Constructions

    DEFF Research Database (Denmark)

    Mortensen, Lone Hedegaard; Woloszyn, Monika; Rode, Carsten;

    2007-01-01

    There is a strong demand for accurate moisture modeling since moisture poses a risk for both the constructions and the indoor climate. This investigation has special focus on moisture modeling. The paper describes a new model based on a CFD tool enhanced to include both detailed modeling of airfl...

  20. Validation of cfd and simplified models with experimental data for multiphase flow in bends

    NARCIS (Netherlands)

    Nennie, E.D.; Belfroid, S.P.C.; O'Mahoney, T.S.D.

    2013-01-01

    In this paper details of the measurement results of the forces on the bends in a 4" setup are compared to two models. The first model is a simple analytical model and is used to estimate the forces. In the second model, CFD is used. In the experiments only resulting forces, including upstream and do

  1. Validation of vortex code viscous models using lidar wake measurements and CFD

    DEFF Research Database (Denmark)

    Branlard, Emmanuel; Machefaux, Ewan; Gaunaa, Mac;

    2014-01-01

    with sheared inflow are used to compare the vortex code performance with CFD and lidar measurements. Laminar CFD computations are used to evaluate the performance of the viscous models. Consistent results between the vortex code and CFD tool are obtained up to three diameters downstream. The modelling......The newly implemented vortex code Omnivor coupled to the aero-servo-elastic tool hawc2 is described in this paper. Vortex wake improvements by the implementation of viscous effects are considered. Different viscous models are implemented and compared with each other. Turbulent flow fields...... of viscous boundaries appear more important than the modelling of viscosity in the wake. External turbulence and shear appear sufficient but their full potential flow modelling would be preferred....

  2. Two-phase CFD modeling of flow causing the heater vibration

    International Nuclear Information System (INIS)

    Vibrations of heater rods were observed in a heated annulus with water flow under boiling conditions. In order to find out the cause of such vibrations, CFD model of this annulus has been prepared in CFD code STAR-CCM+. Two-phase flow in the annulus was described using a two-fluid model with number of sub-models to describe the mass, momentum and energy transfer between phases. The model was validated using experimental data from reference. The validated model was used to perform a steady state calculation of flow parameters under different conditions. Results of CFD simulations were compared to experimentally detected vibration offset. It was found out that vibration increase caused by heating the channel is connected with the vibration offset. The results and their extension to nuclear safety were discussed. (author)

  3. Prediction of steam condensation in the presence of noncondensable gases using a CFD-based approach

    Energy Technology Data Exchange (ETDEWEB)

    Dehbi, A., E-mail: abdel.dehbi@psi.ch [Laboratory for Thermal-Hydraulics, Paul Scherrer Institut, Villigen 5232 (Switzerland); Janasz, F., E-mail: filip.janasz@psi.ch [Laboratory for Thermal-Hydraulics, Paul Scherrer Institut, Villigen 5232 (Switzerland); Bell, B., E-mail: brian.bell@ansys.com [ANSYS Inc., Lebanon, NH 03766 (United States)

    2013-05-15

    Highlights: ► A model of condensation with noncondensable gases is integrated in the Fluent code. ► Condensation is modeled as sink terms in the conservation equations. ► A best-estimate parameter is proposed for heat transfer enhancement due to suction. ► Validation is conducted for a wide range of flow conditions and geometries. ► Predictions are in good agreement with experimental correlations. -- Abstract: We integrate in the ANSYS CFD code Fluent a model for wall condensation from a vapor–noncondensable gas mixture. The condensation phenomenon is modeled from first principles as sink terms for the mass, momentum, species and energy conservation equations. The condensation rate is obtained by requiring the condensate–gas interface to be impermeable to the noncondensable gas. The model assumes in addition that the thermal resistance of the liquid film is negligible, and hence the predictions are only valid for relatively large mass fractions of the noncondensable gas (above 0.1). When the condensation rates are high, a best-estimate suction correction factor is proposed for CFD codes that impose the no-slip boundary conditions at the wall surfaces. In such a way, the enhancement in the heat transfer due to suction is accounted for. We first simulate condensation in laminar and turbulent forced flows along a cold flat plate. More challenging simulations are subsequently conducted for the case where vapor is introduced into closed vessels containing a noncondensable gas and in which stand condensing surfaces held at constant cold temperature. The flow transient is computed until steady conditions are reached, at which point the condensation flow rate equals the injected steam flow rate. Overall, the predicted heat transfer rates are in good agreement with available analytical solutions as well as experimental correlations. CFD Best Practice Guidelines are followed to a large extent. In particular, a hierarchy of grids is used to ensure mesh

  4. Realistic Representation of Grain Shapes in CFD--DEM Simulations of Sediment Transport: A Bonded-Sphere Approach

    CERN Document Server

    Sun, Rui

    2016-01-01

    Development of algorithms and growth of computational resources in the past decades have enabled simulations of sediment transport processes with unprecedented fidelities. The Computational Fluid Dynamics--Discrete Element Method (CFD--DEM) is one of the high-fidelity approaches, where the motions of and collisions among the sediment grains as well as their interactions with surrounding fluids are resolved. In most DEM solvers the particles are modeled as soft spheres due to computational efficiency and implementation complexity considerations, although natural sediments are usually mixture of non-spherical particles. Previous attempts to extend sphere-based DEM to treat irregular particles neglected fluid-induced torques on particles, and the method lacked flexibility to handle sediments with an arbitrary mixture of particle shapes. In this contribution we proposed a simple, efficient approach to represent common sediment grain shapes with bonded spheres, where the fluid forces are computed and applied on ea...

  5. A synergistic use of CFD, experiments and effective convectivity model to reduce uncertainty in BWR severe accident analysis

    International Nuclear Information System (INIS)

    In a previous work we presented an analysis approach developed to effectively and accurately assess thermal loads on vessel and structures in a Boiling Water Reactor (BWR) lower head during a severe accident. Central to the assessment is the Effective Convectivity Model (ECM) that makes use of experimental heat transfer correlations to capture the effect of turbulent natural convection in a volumetrically heated liquid pool, while retaining the pool three-dimensional energy splitting and ability to represent local heat transfer effects. Thanking to its features, the ECM is unique in enabling calculations of complex heat transfer phenomena during long severe accident transients that would not be otherwise feasible using higher-fidelity methods such as Computational Fluid Dynamics (CFD). Efficiency notwithstanding, the natural questions are: (i) how good are those ECM-calculated results, and, (ii) if required, what can be done (with the highest return-on-investment) to improve the quality of ECM prediction results. The approach refers to experiments and CFD simulations as the main resources to address (i) and (ii). However, validation of ECM against simulant-fluid experiments by itself does not reveal deficiencies (due to non-prototypicality factors). In the present work we focus on the use of CFD-based numerical 'experiments' to identify and quantify source of epistemic uncertainty in the calculated thermal loads due to modeling assumptions in ECM. Specifically, heat transfer correlations that underlie the ECM are obtained as surface-averaged (even though implemented as spatially distributed) and derived from experiments conducted at different geometries and using fluids that are not reactor prototypical (molten corium in the present case of severe accident). The CFD simulations exhibit so-called fluid Prandtl number effect on local peaking of the pool's downward heat flux for corium as working fluid. The main premise is a synergistic use of a fast-running model

  6. iCFD: Interpreted Computational Fluid Dynamics – Degeneration of CFD to one-dimensional advection-dispersion models using statistical experimental design – The secondary clarifier

    DEFF Research Database (Denmark)

    Guyonvarch, Estelle; Ramin, Elham; Kulahci, Murat;

    2015-01-01

    The present study aims at using statistically designed computational fluid dynamics (CFD) simulations as numerical experiments for the identification of one-dimensional (1-D) advection-dispersion models – computationally light tools, used e.g., as sub-models in systems analysis. The objective...... is to develop a new 1-D framework, referred to as interpreted CFD (iCFD) models, in which statistical meta-models are used to calculate the pseudo-dispersion coefficient (D) as a function of design and flow boundary conditions. The method – presented in a straightforward and transparent way – is illustrated...... using the example of a circular secondary settling tank (SST). First, the significant design and flow factors are screened out by applying the statistical method of two-level fractional factorial design of experiments. Second, based on the number of significant factors identified through the factor...

  7. Application of a new drag coefficient model at CFD-simulations on free surface flows relevant for the nuclear reactor safety analysis

    International Nuclear Information System (INIS)

    Highlights: ► New drag law in AIAD model was implemented in a CFD code to simulate the flows in nuclear reactor. ► The problems include the CCFL, hydraulic jump and pressurized thermal shock (PTS). ► The model is able to distinguish the local flow morphologies in frame of the Euler–Euler. ► CFD calculations agree well with the experimental data. - Abstract: This paper presents different CFD-simulations on flows which are relevant for nuclear reactor safety using a new modeling approach for the interfacial drag at free surfaces. The developed drag coefficient model was implemented together with the Algebraic Interfacial Area Density (AIAD) model () into the three-dimensional (3-D) computational fluid dynamics (CFD) code ANSYS-CFX. The applications considered include the prediction of counter-current flow limitations (CCFL) in a PWR hot leg, the development of hydraulic jump during the air–water co-current flow in a horizontal channel, and pressurized thermal shock (PTS) phenomena in a PWR cold leg and downcomer. For the modeling of these tasks, an Euler–Euler approach was used. This approach allows the use of different models depending on the local morphology. In the frame of an Euler–Euler simulation, the local morphology of the phases has to be considered in the drag model. To demonstrate the feasibility of the present approach, the computed main parameters of each case were compared with experimental data. It is shown that the CFD calculations agree well with the experimental data. This indicates that the AIAD model combined with new drag force modeling is a promising way to simulate the phenomena in frame of the Euler–Euler approach. Moreover the further validation of the model by including mass transfer effects should be carried out.

  8. CFD aided analysis of a scaled down model of the Brazilian Multipurpose Reactor (RMB) pool

    International Nuclear Information System (INIS)

    Research reactors are commonly built inside deep pools that provide radiological and thermal protection and easy access to its core. Reactors with thermal power in the order of MW usually use an auxiliary thermal-hydraulic circuit at the top of its pool to create a purified hot water layer (HWL). Thermal-hydraulic analysis of the flow configuration in the pool and HWL is paramount to insure radiological protection. A useful tool for these analyses is the application of CFD (Computational Fluid Dynamics). To obtain satisfactory results using CFD it is necessary the verification and validation of the CFD numerical model. Verification is divided in code and solution verifications. In the first one establishes the correctness of the CFD code implementation and in the former estimates the numerical accuracy of a particular calculation. Validation is performed through comparison of numerical and experimental results. This paper presents a dimensional analysis of the RMB (Brazilian Multipurpose Reactor) pool to determine a scaled down experimental installation able to aid in the HWL numerical investigation. Two CFD models were created one with the same dimensions and boundary conditions of the reactor prototype and the other with 1/10 proportion size and boundary conditions set to achieve the same inertial and buoyant forces proportions represented by Froude Number between the two models. Results comparing the HWL thickness show consistence between the prototype and the scaled down model behavior. (author)

  9. CFD aided analysis of a scaled down model of the Brazilian Multipurpose Reactor (RMB) pool

    Energy Technology Data Exchange (ETDEWEB)

    Schweizer, Fernando L.A.; Lima, Claubia P.B.; Costa, Antonella L.; Veloso, Maria A.F., E-mail: ando.schweizer@gmail.com, E-mail: claubia@nuclear.ufmg.br, E-mail: antonella@nuclear.ufmg.br, E-mail: mdora@nuclear.ufmg.br [Universidade Federal de Minas Gerais (DEN/UFMG), Belo Horizonte, MG (Brazil). Departamento de Engenharia Nuclear; Santos, Andre A.C.; Costa, Antonio C.L., E-mail: aacs@cdtn.br, E-mail: aclc@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN/-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    Research reactors are commonly built inside deep pools that provide radiological and thermal protection and easy access to its core. Reactors with thermal power in the order of MW usually use an auxiliary thermal-hydraulic circuit at the top of its pool to create a purified hot water layer (HWL). Thermal-hydraulic analysis of the flow configuration in the pool and HWL is paramount to insure radiological protection. A useful tool for these analyses is the application of CFD (Computational Fluid Dynamics). To obtain satisfactory results using CFD it is necessary the verification and validation of the CFD numerical model. Verification is divided in code and solution verifications. In the first one establishes the correctness of the CFD code implementation and in the former estimates the numerical accuracy of a particular calculation. Validation is performed through comparison of numerical and experimental results. This paper presents a dimensional analysis of the RMB (Brazilian Multipurpose Reactor) pool to determine a scaled down experimental installation able to aid in the HWL numerical investigation. Two CFD models were created one with the same dimensions and boundary conditions of the reactor prototype and the other with 1/10 proportion size and boundary conditions set to achieve the same inertial and buoyant forces proportions represented by Froude Number between the two models. Results comparing the HWL thickness show consistence between the prototype and the scaled down model behavior. (author)

  10. CFD-model of the mass transfer in the vertical settler

    Directory of Open Access Journals (Sweden)

    E. K. Nagornaya

    2013-02-01

    Full Text Available Purpose. Nowadays the mathematical models of the secondary settlers are intensively developed. As a rule the engineers use the 0-D models or 1-D models to design settlers. But these models do not take into account the hydrodynamics process inside the settler and its geometrical form. That is why the CFD-models based on Navier - Stokes equations are not widely used in practice now. The use of CFD-models based on Navier - Stokes equations needs to incorporate very refine grid. It is very actually now to develop the CFD-models which permit to take into account the geometrical form of the settler, the most important physical processes and needs small computer time for calculation. That is why the development of the 2-D numerical model for the investigation of the waste waters transfer in the vertical settlers which permits to take into account the geometrical form and the constructive features of the settler is essential. Methodology. The finite - difference schemes are applied. Findings. The new 2-D-CFD-model was developed, which permits to perform the CFD investigation of the vertical settler. This model takes into account the geometrical form of the settler, the central pipe inside it and others peculiarities. The method of «porosity technique» is used to create the geometrical form of the settler in the numerical model. This technique permits to build any geometrical form of the settler for CFD investigation. Originality. Making of CFD-model which permits on the one hand to take into account the geometrical form of the settler, basic physical processes of mass transfer in construction and on the other hand requiring the low time cost in order to obtain results. Practical value. CFD-model is designed and code which is constructed on its basis allows at low cost of computer time and about the same as in the calculation of the 1-D model to solve complex multiparameter problems that arise during the design of vertical settlers with their shape and

  11. CFD simulation of wood chip combustion on a grate using an Euler-Euler approach

    Science.gov (United States)

    Kurz, D.; Schnell, U.; Scheffknecht, G.

    2012-04-01

    Due to the increase of computational power, it is nowadays common practice to use CFD calculations for various kinds of firing systems in order to understand the internal physical phenomena and to optimise the overall process. Within the last years, biomass combustion for energy purposes has gained rising popularity. On an industrial scale, mainly grate firing systems are used for this purpose. Generally, such systems consist of a dense-packed fuel bed on the grate and the freeboard region above, where in the field of numerical modelling, it is common practice to use different sub-models for both zones. To avoid this, the objective of this paper is the presentation of a numerical model including a detailed three-dimensional description of the fuel bed and the freeboard region within the same CFD code. Because of the implementation as an Eulerian multiphase model, both zones are fully coupled in terms of flow and heat transfer, and appropriate models for the treatment of turbulence, radiation, and global reactions are presented. The model results are validated against detailed measurements of temperature and gaseous species close to the bed surface and within the radiative section of a 240 kW grate firing test facility.

  12. Combining a 2-D multiphase CFD model with a Response Surface Methodology to optimize the gasification of Portuguese biomasses

    International Nuclear Information System (INIS)

    Highlights: • A multiphase CFD model was combined with RSM. • Gasification optimal operating conditions were found in a pilot scale reactor. • Syngas quality indices were optimized in a biomass gasification process. • Propagation of error methodology was combined with a CFD model and RSM. - Abstract: This paper presents a study to evaluate the potential of Portuguese biomasses (coffee husks, forest residues and vine pruning residues) to produce syngas for different applications. By using a 2-D Eulerian–Eulerian approach within the CFD framework, a design of several computer experiments was developed and were used as analysis tools the response surface method (RSM) and the propagation of error (POE) approach. The CFD model was validated under experimental results collected at a semi-industrial reactor. For design purposes, temperature, steam to biomass ratio (SBR) and the type of biomass were selected as input factors. The responses were the H2 generation, the H2/CO ratio, the CH4/H2 ratio, the carbon conversion and the cold gas efficiency. It was concluded that after an optimization procedure to determine the operating conditions, vine pruning residues could show very promising results considering some of the typical syngas indice standards for commercial purposes. From the optimization procedure, it was also concluded that forest residues are preferable for domestic natural gas applications and vine pruning residues for fuel cells and integrated gasification systems application. By using the RSM combined with POE, it was verified that the operating conditions to get higher performances do not always coincide with those necessary to obtain a stable syngas composition

  13. Well-posedness and convergence of cfd two-fluid model for bubbly flows

    Science.gov (United States)

    Vaidheeswaran, Avinash

    The current research is focused on developing a well-posed multidimensional CFD two-fluid model (TFM) for bubbly flows. Two-phase flows exhibit a wide range of local flow instabilities such as Kelvin-Helmholtz, Rayleigh-Taylor, plume and jet instabilities. They arise due to the density difference and/or the relative velocity between the two phases. A physically correct TFM is essential to model these instabilities. However, this is not the case with the TFMs in numerical codes, which can be shown to have complex eigenvalues due to incompleteness and hence are ill-posed as initial value problems. A common approach to regularize an incomplete TFM is to add artificial physics or numerically by using a coarse grid or first order methods. However, it eliminates the local physical instabilities along with the undesired high frequency oscillations resulting from the ill-posedness. Thus, the TFM loses the capability to predict the inherent local dynamics of the two-phase flow. The alternative approach followed in the current study is to introduce appropriate physical mechanisms that make the TFM well-posed. First a well-posed 1-D TFM for vertical bubbly flows is analyzed with characteristics, and dispersion analysis. When an incomplete TFM is used, it results in high frequency oscillations in the solution. It is demonstrated through the travelling void wave problem that, by adding the missing short wavelength physics to the numerical TFM, this can be removed by making the model well-posed. To extend the limit of well-posedness beyond the well-known TFM of Pauchon and Banerjee [1], the mechanism of collision is considered, and it is shown by characteristics analysis that the TFM then becomes well-posed for all void fractions of practical interest. The aforementioned ideas are then extended to CFD TFM. The travelling void wave problem is again used to demonstrate that by adding appropriate physics, the problem of ill-posedness is resolved. Furthermore, issues pertaining to

  14. CFD analysis of a cask for spent fuel dry storage: Model fundamentals and sensitivity studies

    International Nuclear Information System (INIS)

    Highlights: • A dry storage cask has been evaluated by a CFD code, FLUENT 14. • An alternative methodology for thermal-fluid dynamic modeling has been performed. • Fuel maximum temperature obtained is around 50 K below the regulation limit (673 K). • Even in the most unfavorable heat load distribution temperature increase is smaller than 4%. - Abstract: Dry storage technology must ensure spent fuel cooling under any conditions. This turns thermo-fluid dynamics within dry storage casks a key aspect to investigate, as it would heavily affect fuel rod temperatures. This paper introduces a Computational Fluid Dynamic (CFD) model and analyses of a HI-STORM 100S cask with FLUENT 14.0. Fuel assemblies have been modeled as a porous medium characterized by a thermal conductivity and pressure drop that have been derived from specific approximations, algorithms and methods. This approach has been verified by comparing its results to those published by Holtec International for the HI-STORM cask. The application of the 3D model to HI-STORM 100S cask type under normal conditions, confirms that fuel maximum temperatures more than about 50 K below the regulation limit (673 K) should be expected. In addition, the effect on these results of aspects such as cask design (inlet/outlet orientation), heat load (regionalization) and local climate (external temperature), have been explored. The results indicate that the most relevant factor is heat load distribution and that, even in the most unfavorable regionalization feasible, temperature increase is smaller than 4%. Nonetheless, it should be highlighted that thermal margin to regulatory setting might be reduced down to around 40%

  15. Towards CFD modeling of turbulent pipeline material transportation

    Science.gov (United States)

    Shahirpour, Amir; Herzog, Nicoleta; Egbers, Cristoph

    2013-04-01

    Safe and financially efficient pipeline transportation of carbon dioxide is a critical issue in the developing field of the CCS Technology. In this part of the process, carbon dioxide is transported via pipes with diameter of 1.5 m and entry pressure of 150 bar, with Reynolds number of 107 and viscosity of 8×10(-5) Pa.s as dense fluid [1]. Presence of large and small scale structures in the pipeline, high Reynolds numbers at which CO2 should be transferred, and 3 dimensional turbulence caused by local geometrical modifications, increase the importance of simulation of turbulent material transport through the individual components of the CO2 chain process. In this study, incompressible turbulent channel flow and pipe flow have been modeled using OpenFoam, an open source CFD software. In the first step, simulation of a turbulent channel flow has been considered using LES for shear Reynolds number of 395. A simple geometry has been chosen with cyclic fluid inlet and outlet boundary conditions to simulate a fully developed flow. The mesh is gradually refined towards the wall to provide values close enough to the wall for the wall coordinate (y+). Grid resolution study has been conducted for One-Equation model. The accuracy of the results is analyzed with respect to the grid smoothness in order to reach an optimized resolution for carrying out the next simulations. Furthermore, three LES models, One-Equation, Smagorinsky and Dynamic Smagorinsky are applied for the grid resolution of (60 × 100 × 80) in (x, y, z) directions. The results are then validated with reference to the DNS carried out by Moser et al.[2] for the similar geometry using logarithmic velocity profile (U+) and Reynolds stress tensor components. In the second step the similar flow is modeled using Reynolds averaged method. Several RANS models, like K-epsilon and Launder-Reece-Rodi are applied and validated against DNS and LES results in a similar fashion. In the most recent step, it has been intended

  16. Source strength and dispersion of CO2 releases from high-pressure pipelines: CFD model using real gas equation of state

    International Nuclear Information System (INIS)

    Highlights: • Validated CFD models for decompression and dispersion of CO2 releases from pipelines. • Incorporation of real gas EOS into CFD code for source strength estimation. • Demonstration of better performance of SST k–ω turbulence model for jet flow. • Demonstration of better performance of real gas EOS compared to ideal gas EOS. • Demonstration of superiority of CFD models over a commercial risk assessment package. - Abstract: Transportation of CO2 in high-pressure pipelines forms a crucial link in the ever-increasing application of Carbon Capture and Storage (CCS) technologies. An unplanned release of CO2 from a pipeline presents a risk to human and animal populations and the environment. Therefore it is very important to develop a deeper understanding of the atmospheric dispersion of CO2 before the deployment of CO2 pipelines, to allow the appropriate safety precautions to be taken. This paper presents a two-stage Computational Fluid Dynamics (CFD) study developed (1) to estimate the source strength, and (2) to simulate the subsequent dispersion of CO2 in the atmosphere, using the source strength estimated in stage (1). The Peng–Robinson (PR) EOS was incorporated into the CFD code. This enabled accurate modelling of the CO2 jet to achieve more precise source strength estimates. The two-stage simulation approach also resulted in a reduction in the overall computing time. The CFD models were validated against experimental results from the British Petroleum (BP) CO2 dispersion trials, and also against results produced by the risk management package Phast. Compared with the measurements, the CFD simulation results showed good agreement in both source strength and dispersion profile predictions. Furthermore, the effect of release direction on the dispersion was studied. The presented research provides a viable method for the assessment of risks associated with CCS

  17. Simulation of Solid Suspension in a Stirred Tank Using CFD-DEM Coupled Approach

    Institute of Scientific and Technical Information of China (English)

    邵婷; 胡银玉; 王文坦; 金涌; 程易

    2013-01-01

    Computational fluid dynamics-discrete element method (CFD-DEM) coupled approach was employed to simulate the solid suspension behavior in a Rushton stirred tank with consideration of transitional and rotational motions of millions of particles with complex interactions with liquid and the rotating impeller. The simulations were satisfactorily validated with experimental data in literature in terms of measured particle velocities in the tank. Influences of operating conditions and physical properties of particles (i.e., particle diameter and density) on the two-phase flow field in the stirred tank involving particle distribution, particle velocity and vortex were studied. The wide distribution of particle angular velocity ranging from 0 to 105 r·min-1 is revealed. The Magnus force is comparable to the drag force during the particle movement in the tank. The strong particle rotation will generate extra shear force on the particles so that the particle morphology may be affected, especially in the bio-/polymer-product related processes. It can be concluded that the CFD-DEM coupled approach provides a theoretical way to under-stand the physics of particle movement in micro-to macro-scales in the solid suspension of a stirred tank.

  18. Computational Fluid Dynamics (CFD) Modeling for High Rate Pulverized Coal Injection (PCI) into the Blast Furnace

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Chenn Zhou

    2008-10-15

    Pulverized coal injection (PCI) into the blast furnace (BF) has been recognized as an effective way to decrease the coke and total energy consumption along with minimization of environmental impacts. However, increasing the amount of coal injected into the BF is currently limited by the lack of knowledge of some issues related to the process. It is therefore important to understand the complex physical and chemical phenomena in the PCI process. Due to the difficulty in attaining trus BF measurements, Computational fluid dynamics (CFD) modeling has been identified as a useful technology to provide such knowledge. CFD simulation is powerful for providing detailed information on flow properties and performing parametric studies for process design and optimization. In this project, comprehensive 3-D CFD models have been developed to simulate the PCI process under actual furnace conditions. These models provide raceway size and flow property distributions. The results have provided guidance for optimizing the PCI process.

  19. Towards a CFD Model for Prediction of Wind Turbine Power Losses due to Icing in Cold Climate

    DEFF Research Database (Denmark)

    Pedersen, Marie Cecilie; Sørensen, Henrik

    Icing induced power losses is an important issue when operating wind turbines in cold climate. This paper presents a concept of modelling ice accretion on wind turbines using Computational Fluid Dynamics (CFD). The modelling concept works towards unifying the processes of modelling ice accretion...... and the aerodynamic analysis of the iced object into one CFD-based icing model. Modelling of icing and obtaining ice shapes in combination with mesh update by surface boundary displacement was demonstrated in the paper. It has been done by expressing in-cloud icing in CFD by an Eulerian multiphase model, implementing...... an icing module into the CFD solution and finally by surface boundary displacement also included in the CFD solution. The model has been developed using ANSYS-FLUENT and user-defined functions. The naca profile, NACA64618, has been used to illustrate the functionality of the model. Running ice accretion...

  20. CFD Wake Modelling with a BEM Wind Turbine Sub-Model

    Directory of Open Access Journals (Sweden)

    Anders Hallanger

    2013-01-01

    Full Text Available Modelling of wind farms using computational fluid dynamics (CFD resolving the flow field around each wind turbine's blades on a moving computational grid is still too costly and time consuming in terms of computational capacity and effort. One strategy is to use sub-models for the wind turbines, and sub-grid models for turbulence production and dissipation to model the turbulent viscosity accurately enough to handle interaction of wakes in wind farms. A wind turbine sub-model, based on the Blade Momentum Theory, see Hansen (2008, has been implemented in an in-house CFD code, see Hallanger et al. (2002. The tangential and normal reaction forces from the wind turbine blades are distributed on the control volumes (CVs at the wind turbine rotor location as sources in the conservation equations of momentum. The classical k-epsilon turbulence model of Launder and Spalding (1972 is implemented with sub-grid turbulence (SGT model, see Sha and Launder (1979 and Sand and Salvesen (1994. Steady state CFD simulations were compared with flow and turbulence measurements in the wake of a model scale wind turbine, see Krogstad and Eriksen (2011. The simulated results compared best with experiments when stalling (boundary layer separation on the wind turbine blades did not occur. The SGT model did improve turbulence level in the wake but seems to smear the wake flow structure. It should be noted that the simulations are carried out steady state not including flow oscillations caused by vortex shedding from tower and blades as they were in the experiments. Further improvement of the simulated velocity defect and turbulence level seems to rely on better parameter estimation to the SGT model, improvements to the SGT model, and possibly transient- instead of steady state simulations.

  1. CFD model of multiphase flow in the abrasive water jet tool

    OpenAIRE

    Říha, Zdeněk

    2015-01-01

    The possibility of using CFD fluid flow modeling in area of tools with abrasive water jet is described in the paper. The correct function of such tool is based on proper setting of multiphase flow of water, air and solid particles in the inner space of the tool. The multiphase fluid flow numerical simulation can provide information which show relation between the geometry and the flow field. Then, this stable CFD model of multiphase flow creates key to design of the tool able to work wi...

  2. Towards a generic, reliable CFD modelling methodology for waste-fired grate boilers

    DEFF Research Database (Denmark)

    Rajh, Boštjan; Yin, Chungen; Samec, Niko;

    Computational Fluid Dynamics (CFD) is increasingly used in industry for detailed understanding of the combustion process and for appropriate design and optimization of Waste–to–Energy (WtE) plants. In this paper, CFD modelling of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is...... presented. To reduce the risk of slagging, optimize the temperature control and enhance turbulent mixing, part of the flue gas is recycled into the grate boiler. In the simulation, a 1D in–house bed model is developed to simulate the conversion of the waste wood in the fuel bed on the grate, which provides...

  3. A hybrid DEM/CFD approach for solid-liquid flows

    Institute of Scientific and Technical Information of China (English)

    QIU Liu-chao; WU Chuan-yu

    2014-01-01

    A hybrid scheme coupling the discrete element method (DEM) with the computational fluid dynamics (CFD) is developed to model solid-liquid flows. Instead of solving the pressure Poisson equation, we use the compressible volume-averaged continuity and momentum equations with an isothermal stiff equation of state for the liquid phase in our CFD scheme. The motion of the solid phase is obtained by using the DEM, in which the particle-particle and particle-wall interactions are modelled by using the theoretical contact mechanics. The two phases are coupled through the Newton’s third law of motion. To verify the proposed method, the sedi-mentation of a single spherical particle is simulated in water, and the results are compared with experimental results reported in the literature. In addition, the drafting, kissing, and tumbling (DKT) phenomenon between two particles in a liquid is modelled and rea-sonable results are obtained. Finally, the numerical simulation of the density-driven segregation of a binary particulate suspension in-volving 10 000 particles in a closed container is conducted to show that the presented method is potentially powerful to simulate real particulate flows with large number of moving particles.

  4. Modeling chemical reactions in the indoor environment by CFD

    DEFF Research Database (Denmark)

    Sørensen, Dan Nørtoft; Weschler, Charles J.

    2002-01-01

    The concentrations of ozone and a terpene that react in the gas-phase to produce a hypothetical product were investigated by computational fluid dynamics (CFD) for two different air exchange rates. Ozone entered the room with the ventilation air. The terpenes were introduced as a localized source...... with an emission pattern similar to an air freshener; this was in contrast to an otherwise identical earlier study in which the terpene was introduced as a floor source with an emission pattern similar to a floor care product (Sørensen and Weschler, 2002). The results show that there are large concentration...

  5. Turbulence modeling needs of commercial CFD codes: Complex flows in the aerospace and automotive industries

    Science.gov (United States)

    Befrui, Bizhan A.

    1995-01-01

    This viewgraph presentation discusses the following: STAR-CD computational features; STAR-CD turbulence models; common features of industrial complex flows; industry-specific CFD development requirements; applications and experiences of industrial complex flows, including flow in rotating disc cavities, diffusion hole film cooling, internal blade cooling, and external car aerodynamics; and conclusions on turbulence modeling needs.

  6. An integral CFD approach for the thermal simulation of the PBMR Reactor Unit

    Energy Technology Data Exchange (ETDEWEB)

    Janse van Rensburg, J.J., E-mail: cobusjvr1@gmail.com [North-West University, Potchefstroom Campus (South Africa); Parsons Brinckerhoff Africa, Craighall (South Africa); Kleingeld, M. [North-West University (South Africa)

    2011-08-15

    Highlights: > Establishment of a modeling capability to simulate the integral thermal operation of an HTR. > The focus was on the capability rather than improving the assumptions and correlations. > All assumptions and correlations applied were taken from previous credible research. > It was shown that it is possible to establish such a capability using current information. > With this capability, it is now possible to test updated correlations and determine the integral effect. - Abstract: A CFD method was developed to conduct integral thermal reactor analysis for the complete Reactor Unit of the Pebble Bed Modular Reactor (Pty) Ltd (PBMR). The requirement was however also to include very detailed aspects such as leakage and bypass flow paths through the reflector blocks and sleeves. The aim was therefore to investigate the influence of leakage and bypass flow on the thermal performance of the Reactor Unit in an integral fashion. The focus of this paper is to discuss the methodology that was developed. The discussion will firstly highlight all the required inputs, elaborate briefly on the underlying theory and how this was implemented into the CFD modeling capability. Results will be discussed briefly, but the focus is on the methodology.

  7. CFD modeling and experience of waste-to-energy plant burning waste wood

    OpenAIRE

    Rajh, B.; Yin, Chungen; Samec, N.; M. HRIBERSEK; Kokalj, F.

    2013-01-01

    Computational Fluid Dynamics (CFD) is being increasingly used in industry for in-depth understanding of the fundamental mixing, combustion, heat transfer and pollutant formation in combustion processes and for design and optimization of Waste-to-Energy (WtE) plants. In this paper, CFD modeling of waste wood combustion in a 13 MW grate-fired boiler in a WtE plant is presented. As a validation effort, the temperature profiles at a number of ports in the furnace are measured and the experimental...

  8. The Crucial Role of Error Correlation for Uncertainty Modeling of CFD-Based Aerodynamics Increments

    Science.gov (United States)

    Hemsch, Michael J.; Walker, Eric L.

    2011-01-01

    The Ares I ascent aerodynamics database for Design Cycle 3 (DAC-3) was built from wind-tunnel test results and CFD solutions. The wind tunnel results were used to build the baseline response surfaces for wind-tunnel Reynolds numbers at power-off conditions. The CFD solutions were used to build increments to account for Reynolds number effects. We calculate the validation errors for the primary CFD code results at wind tunnel Reynolds number power-off conditions and would like to be able to use those errors to predict the validation errors for the CFD increments. However, the validation errors are large compared to the increments. We suggest a way forward that is consistent with common practice in wind tunnel testing which is to assume that systematic errors in the measurement process and/or the environment will subtract out when increments are calculated, thus making increments more reliable with smaller uncertainty than absolute values of the aerodynamic coefficients. A similar practice has arisen for the use of CFD to generate aerodynamic database increments. The basis of this practice is the assumption of strong correlation of the systematic errors inherent in each of the results used to generate an increment. The assumption of strong correlation is the inferential link between the observed validation uncertainties at wind-tunnel Reynolds numbers and the uncertainties to be predicted for flight. In this paper, we suggest a way to estimate the correlation coefficient and demonstrate the approach using code-to-code differences that were obtained for quality control purposes during the Ares I CFD campaign. Finally, since we can expect the increments to be relatively small compared to the baseline response surface and to be typically of the order of the baseline uncertainty, we find that it is necessary to be able to show that the correlation coefficients are close to unity to avoid overinflating the overall database uncertainty with the addition of the increments.

  9. Coupling of FVCOM and CFD Model for Simulation of Multiscale Coastal Flows

    Science.gov (United States)

    Tang, H.; Qu, K.

    2013-12-01

    In correspondence with the need to simulate many emerging problems, especially those in nearshore regions such as deepwater oil spill, it is necessary to develop capabilities to predict small-scale, fully 3D phenomena in coastal ocean flows. A feasible as well as effective approach for the development is a hybrid method that couples different models designed for physics at different scales. We have developed a two-way coupling between a fully 3D CFD model and the FVCOM, in which the former captures small-scale 3D flows and the latter predicts large-scale background currents. In this presentation, a few new applications of such approach will be illustrated. The following figures show a result on tidal flow in a bay and past bridge peers. Tests and analysis are made on solution accuracy and computation efficiency, and discussions are presented on how to achieve seamless solution transition at the model interfaces. Computed large-scale background flow Simulated flow past a brigde

  10. CFD modeling of the turbulent precipitation of plutonium oxalate in a vortex reactor

    International Nuclear Information System (INIS)

    Full text of publication follows:The nuclear fuel reprocessing, as it is done in La Hague COGEMA's plant, involves a precipitation in an un-baffled stirred tank to turn plutonium nitrate into plutonium oxalate prior to a calcination for using it in MOX fuel (Mixed Oxides). In every crystallization and precipitation (reactive crystallization), the key variable is sur-saturation, resulting from either a chemical reaction between two liquids, a liquid and a solid, a gas and a solid, or a decrease in the product solubility induced by temperature gradient or mixing of a solvent and an anti-solvent. According to the local sur-saturation degree, different mechanisms may occur leading to the solid dispersed phase: nucleation, growth and eventually aggregation, breakage and ripening. The challenge in that kind of modeling lies in the non linear behavior of the physical and chemical phenomenons, and in the different time and length scales involved which can not be solved without resorting to computational fluid dynamics (CFD). The modeling philosophy used here is divided in two parts: (1) a lower mesh statistical mixing model (FM-PDF) and a liquid energy spectrum model coupled to the RANS equations, for taking into account the continuous liquid phase mixing at various levels: reactor scale, turbulent dispersion and molecular diffusion; (2) a population balance model for the solid dispersed phase to link flow pattern to the morphology and chemical properties of particles. Many approaches have been developed so far to solve PBE but the recent breakthrough that allowed implementation of that equation in CFD codes is QMOM: quadrature method of moments, that represents the particle size distribution (PSD) in a finite number of delta functions, corresponding to abscissas and weights of the quadrature, which are used to calculate the mean particle size or whatever moment of the PSD. Part (1) has been successfully validated experimentally by means of an acid-base neutralization

  11. CFD activities in support of thermal-hydraulic modeling of SFR fuel bundles

    International Nuclear Information System (INIS)

    Extensive testing and validation work is being performed to assess and validate Computational Fluid Dynamics (CFD) applicability to the simulation of SFR fuel assemblies. The demonstrated robustness of the method allows extending the CFD analysis to distorted fuel configurations, which will inevitably occur during extended fuel operation. The subchannel code COBRA-IV-I-MIT is adopted to evaluate the range of applicability of lumped parameter methods. Comparisons of mixing simulations show some intrinsic limitation in the subchannel methods, but allow confirming its overall applicability to nominal and mildly deformed assembly configurations. For significantly deformed geometries CFD is the recommend approach and is applied in this work. Deformed geometries considered include duct swelling, rod swelling, rod bowing, rod twisting, and various combinations of the simple deformations. While not derived from the realistic analysis of the in-core fuel behavior, the distorted geometries have been designed to embrace all conceptual worst case scenarios. The work focuses on the evaluation of the influence of the deformation on the fuel behavior, rather than on the actual fuel performance. Such approach is driven by the objective of deriving general understanding, and evaluating the applicability of subchannel analysis codes to long life fuel design, possibly in combination with distorted-channel factors derived from the CFD analyses. (author)

  12. A CFD based approach for thermal hydraulic design of main vessel cooling system of pool type fast reactors

    International Nuclear Information System (INIS)

    Highlights: ► We study thermal hydraulic design of main vessel cooling system of fast reactors. ► A CFD based approach is proposed for determination of coolant flow rate. ► Effect of cooling system ovality on temperature asymmetry is quantified. ► Suitable flow distribution device is identified to achieve acceptable flow field. ► To compare efficacy of various devices, a flow mal-distribution index is defined. - Abstract: A computational fluid dynamics (CFDs) based approach is proposed for the thermal hydraulic design of the main vessel cooling system for pool type sodium cooled reactors. Usage of the proposed method is demonstrated by applying it to a future Indian commercial fast breeder reactor. Towards quantifying the amount of sodium flow rate for the main vessel cooling system, two-dimensional CFD investigations have been performed. The conjugate conduction–convection models adopted for this purpose are validated against sodium experiments available in literature. The required flow fraction has been determined to be 2.6% of core flow, which is 175.6 kg/s at full power conditions. The heat loss from the hot pool to the cold pool through the main vessel cooling system is estimated to be 10.6 MW at full power and 3.7 MW at 20% power conditions. By detailed three-dimensional CFD studies, the effect of ovality in the main vessel cooling annuli due to manufacturing tolerances has been assessed and the associated circumferential temperature difference in the main vessel is determined to be 14 °C, which is less than the permissible upper limit of 30 °C. The uniformity of sodium flow in the cooling annulus has been investigated by a three-dimensional hydraulic analysis with a view to identify a suitable passive device that can render a uniform velocity distribution. To compare the effectiveness of various devices, a flow mal-distribution index is defined. Detailed parametric studies have been carried out to identify an appropriate porous jet breaker

  13. Simulation of a MW rotor equipped with vortex generators using CFD and an actuator shape model

    DEFF Research Database (Denmark)

    Troldborg, Niels; Zahle, Frederik; Sørensen, Niels N.

    2015-01-01

    This article presents a comparison of CFD simulations of the DTU 10 MW reference wind turbine with and without vortex generators installed on the inboard part of the blades. The vortex generators are modelled by introducing body forces determined using a modified version of the so-called BAY mode...

  14. Integrated DEM–CFD modeling of the contact charging of pneumatically conveyed powders

    NARCIS (Netherlands)

    Korevaar, M.W.; Padding, J.T.; Hoef, van der M.A.; Kuipers, J.A.M.

    2014-01-01

    A model is proposed that incorporates contact charging (also known as triboelectric charging) of pneumatically conveyed powders in a DEM–CFD framework, which accounts for the electrostatic interactions, both between particles and between the particles and conducting walls. The simulation results rev

  15. Aspects of Using CFD for Wind Comfort Modeling Around Tall Buildings

    DEFF Research Database (Denmark)

    Rasmussen, Michael R.; Andersen, Lars

    2008-01-01

    The Light*House complex is investigated for uncomfortable wind climate and dangerous winds at pedestrian level. A CFD model is used for simulating the wind effect for 12 different directions and correlated to the wind statistics of a nearby meteorological station. Comparing to practical standards...

  16. Comparison of CFD Simulation of a Hyundai I20 Model with Four Different Turbulence Models

    Directory of Open Access Journals (Sweden)

    Vivekanandan

    2016-07-01

    Full Text Available This article describes the CFD analysis of a Hyundai i20 car Model. The focus of this study is to investigate the aerodynamics characteristics of Hyundai i20 car model and the flow obtained by solving the steady-state governing continuity equations as well as the momentum conservation equations combined with one of four turbulence models (1.Spalart-Allmaras 2.k-ε Standard 3.Transition k-kl-ω 4.Transition Shear Stress Transport (SST and the solutions obtained using these different models were compared. Except transition k-kl-ω model, other three models show nearly similar velocity variations plot. Pressure variation plot are almost similar with K-ε and transition-SST models. Eddy viscosity plot are almost similar with K-ε and transition k-kl-ω models

  17. Development of a three-dimensional CFD model for rotary lime kilns

    Energy Technology Data Exchange (ETDEWEB)

    Lixin Tao; Blom, Roger (FS Dynamics Sweden AB, Goeteborg (Sweden)); Nordgren, Daniel (Innventia, Stockholm (Sweden))

    2010-11-15

    In the calcium loop of the recovery cycle in a Kraft process of pulp and paper production, rotary lime kilns are used to convert the lime mud, mainly CaCO3, back to quick lime, CaO, for re-use in the causticizing process. The lime kilns are one of the major energy consumption devices for paper and pulp industry. Because of the rising oil price and new emission limits, the pulp mills have been forced to look for alternative fuels for their lime kilns. One interesting alternative to oil, often easily available at pulp mills, is biofuels such as sawdust and bark. However the practical kiln operation often encounters some difficulties because of the uncertainties around the biofuel impact on the lime kiln performance. A deeper understanding of the flame characteristics is required when shifting from oil to biofuels. Fortunately recent advances in modern Computational Fluid Dynamics, CFD, have provided the possibility to study and predict the detailed flame characteristics regarding the lime kiln performance. In this project a three-dimensional CFD model for rotary lime kilns has been developed. To simulate a rotary lime kiln the developed CFD model integrates the three essential sub-models, i.e. the freeboard hot flow model, the lime bed model and the rotating refractory wall model and it is developed based on the modern CFD package: FLUENT which is commercially available on the market. The numerical simulations using the developed CFD model have been performed for three selected kiln operations fired with three different fuel mixtures. The predicted results from the CFD modelling are presented and discussed in order to compare the impacts on the kiln performance due to the different firing conditions. During the development, the lime kiln at the Soedra Cell Moensteraas mill has been used as reference kiln. To validate the CFD model, in-plant measurements were carried out in the Moensteraas lime kiln during an experiment campaign. The results obtained from the

  18. Numerical modeling of immiscible two-phase flow in micro-models using a commercial CFD code

    Energy Technology Data Exchange (ETDEWEB)

    Crandall, Dustin; Ahmadia, Goodarz; Smith, Duane H.

    2009-01-01

    Off-the-shelf CFD software is being used to analyze everything from flow over airplanes to lab-on-a-chip designs. So, how accurately can two-phase immiscible flow be modeled flowing through some small-scale models of porous media? We evaluate the capability of the CFD code FLUENT{trademark} to model immiscible flow in micro-scale, bench-top stereolithography models. By comparing the flow results to experimental models we show that accurate 3D modeling is possible.

  19. Improvement of core effective thermal conductivity model of GAMMA+ code based on CFD analysis

    International Nuclear Information System (INIS)

    Highlights: • We assessed the core effective thermal conductivity (ETC) model of GAMMA+ code. • The analytical model of GAMMA+ code was compared with the result of CFD analysis. • Effects of material property of composite and geometric configuration were studied. • The GAMMA+ model agreed with the CFD result when the fuel gap is ignored. • The GAMMA+ model was improved by the ETC model of fuel compact including fuel gap. - Abstract: The GAMMA+ code has been developed for the thermo-fluid and safety analyses of a high temperature gas-cooled reactor (HTGR). In order to calculate the core effective thermal conductivity, this code adopts a heterogeneous model derived from the Maxwell’s theory that accounts for three distinct materials in a fuel block of the reactor core. In this model, the fuel gap is neglected since the gap thickness is quite small. In addition, the configuration of the fuel block is assumed to be homogeneous, and the volume fraction and material properties of each component are taken into account. In the accident condition, the conduction and radiation are major heat transfer mechanism. Therefore, the core effective thermal conductivity model should be validated in order to estimate the heat transfer in the core appropriately. In this regard, the objective of this study is to validate the core effective thermal conductivity model of the GAMMA+ code by a computational fluid dynamics (CFD) analysis using a commercial CFD code, CFX-13. The effects of the temperature condition, material property and geometric modeling on the core effective thermal conductivity were investigated. When the fuel gap is not modeled in the CFD analysis, the result of the GAMMA+ code shows a good agreement with the CFD result. However, when the fuel gap is modeled, the GAMMA+ model overestimates the core effective thermal conductivity considerably for all cases. This is because of the increased thermal resistance by the fuel gap which is not taken into account in

  20. Euler-Lagrange CFD modelling of unconfined gas mixing in anaerobic digestion.

    Science.gov (United States)

    Dapelo, Davide; Alberini, Federico; Bridgeman, John

    2015-11-15

    A novel Euler-Lagrangian (EL) computational fluid dynamics (CFD) finite volume-based model to simulate the gas mixing of sludge for anaerobic digestion is developed and described. Fluid motion is driven by momentum transfer from bubbles to liquid. Model validation is undertaken by assessing the flow field in a labscale model with particle image velocimetry (PIV). Conclusions are drawn about the upscaling and applicability of the model to full-scale problems, and recommendations are given for optimum application.

  1. CFD simulation on hydrodynamics in fluidized beds: assessment of gradient approximations and turbulence models

    Science.gov (United States)

    Guo, Yuan; Deng, Baoqing; Ge, Daqiang; Shen, Xiuzhong

    2015-08-01

    CFD simulations of gas-solid fluidized beds have been performed in Euler-Euler framework. Green-Gauss Cell Based gradient approximation can predict the solid velocity well among gradient approximations. The dispersed choice in the turbulence model can reproduce the solid velocity correctly while the mixture and per phase choices cannot. The standard k-ɛ model, RNG k-ɛ model and SST k-ω model with the dispersed choice can predict the solid velocity well.

  2. COMPUTATIONAL FLUID DYNAMICS MODELING OF SCALED HANFORD DOUBLE SHELL TANK MIXING - CFD MODELING SENSITIVITY STUDY RESULTS

    Energy Technology Data Exchange (ETDEWEB)

    JACKSON VL

    2011-08-31

    The primary purpose of the tank mixing and sampling demonstration program is to mitigate the technical risks associated with the ability of the Hanford tank farm delivery and celtification systems to measure and deliver a uniformly mixed high-level waste (HLW) feed to the Waste Treatment and Immobilization Plant (WTP) Uniform feed to the WTP is a requirement of 24590-WTP-ICD-MG-01-019, ICD-19 - Interface Control Document for Waste Feed, although the exact definition of uniform is evolving in this context. Computational Fluid Dynamics (CFD) modeling has been used to assist in evaluating scaleup issues, study operational parameters, and predict mixing performance at full-scale.

  3. Application Of CFD To Modeling Of Squeeze Mode Magnetorheological Dampers

    Directory of Open Access Journals (Sweden)

    Gołdasz Janusz

    2015-09-01

    Full Text Available The so-called squeeze flow involves a magnetorheological (MR fluid sandwiched between two planar surfaces setting up a flow channel. The height of the channel varies according to a prescribed displacement or force profile. When exposed to a magnetic field of sufficient strength MR fluids develop a yield stress. In squeeze-mode devices the yield stress varies with both the magnetic field magnitude and the channel height. In this paper an unsteady flow model of an MR fluid in squeeze mode is proposed. The model is developed in Ansys Fluent R16. The MR material flow model is based on the apparent viscosity approach. In order to investigate the material's behaviour the authors prepared a model of an idealized squeeze-mode damper in which the fluid flow is enforced by varying the height of the channel. Using mesh animation, the model plate is excited, and as the mesh moves, the fluid is squeezed out of the gap. In the simulations the model is subjected to a range of displacement inputs of frequencies from 10 to 20 Hz, and local yield stress levels up to 30 kPa. The results are presented in the form of time histories of the normal force on the squeezing plate and loops of force vs. displacement (velocity.

  4. CFD modelling of an open core downdraft moving bed biomass gasifier; Modelado de un gasificador estratificado de lecho movil de biomasa, utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Rogel-Ramirez, A [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)]. E-mail: ARogelR@iingen.unam.mx

    2008-10-15

    This paper contains the description of a bidimensional Computational Fluid Dynamics (CFD), model Developer to simulate the flow and reaction in a stratified downdraft biomass gasifier, whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model is based on the PHOENICS package and represents a tool which can be used in gasifier analysis and design. Contributions of chemical kinetics and the mixing rate using the EBU approach are considered in the gas phase global homogeneous reactions. The harmonic blending of chemical kinetics and mass transfer effects, determine the global heterogeneous reactions between char and O{sub 2}, CO{sub 2} and H{sub 2}O. The turbulence effect in the gas phase is accounted by the standard {kappa}-{epsilon} approach. The model provides information of the producer gas composition, velocities and temperature at the outlet, and allows different operating parameters and feed properties to be changed. Finally, a comparison with experimental data available in literature was done, which showed satisfactory agreement from a qualitative point of view, though further validation is required. [Spanish] Este estudio describe un modelo numerico bidimensional, basado en Dinamica de Fluidos Computacional (CFD), desarrollado para simular el flujo y las reacciones que ocurren en un gasificador estratificado de flujos paralelos, en el que se resuelven ecuaciones de conservacion Eulerianas para los componentes de la fase gaseosa, la fase solida, velocidades y entalpias especificas. El modelo esta basado en el codigo PHOENICS y representa una herramienta que puede ser utilizada en el analisis y diseno de gasificadores. En las reacciones globales homogeneas se consideran las contribuciones de la cinetica quimica y la rapidez de mezclado, usando el modelo Eddy Brake-UP (EBU). La medida harmonica de la cinetica quimica y la transferencia de masa, determinan las velocidades globales de

  5. CFD Modeling of Melt Spreading on the Reactor Cavity Floor

    Energy Technology Data Exchange (ETDEWEB)

    Yeon, Wan Sik; Bang, Kwang Hyun [Korea Maritime University, Busan (Korea, Republic of); Cho, Young Jo; Lee, Jae Gon [Korea Hydro and Nuclear Power Co., Daejeon (Korea, Republic of)

    2010-05-15

    In the very unlikely event of a severe reactor accident involving core melt and reactor pressure vessel failure, it is important to provide an accident management strategy that would allow the molten core material to cool down, resolidify and bring the core debris to a stable coolable state for Light Water Reactors (LWRs). One approach to achieve a stable coolable state is to quench the core melt after its relocation from the reactor pressure vessel into the reactor cavity. This approach typically requires a large cavity floor area on which a large amount of core melt spreads well and forms a shallow melt thickness for small thermal resistance across the melt pool. Spreading of high temperature (approx3000 K), low superheat (approx200 K) core melt over a wide cavity floor has been a key question to the success of the ex-vessel core coolability and it has brought a number of experimental work (CORINE, ECOKATS, VULCANO) and analytical work (CORFLOW, MELTSPREAD, THEMA). These computational models are currently able to predict well the spreading of stimulant materials but yet have shown a limitation for prototypic core melt of UO{sub 2}+ZrO{sub 2} mixture. A computational model for the melt spreading requires a multiphase treatment of liquid melt, solidified melt, and air. Also solidification and thermal radiation physics should be included. The present work uses ANSYS-CFX code to simulate core melt spreading on the reactor cavity. The CFX code is a general-purpose multiphase code and the present work is focused on exploring the code's capability to model melt spreading problem in a step by step approach

  6. CFD Modelling of Abdominal Aortic Aneurysm on Hemodynamic Loads Using a Realistic Geometry with CT

    Directory of Open Access Journals (Sweden)

    Eduardo Soudah

    2013-01-01

    Full Text Available The objective of this study is to find a correlation between the abdominal aortic aneurysm (AAA geometric parameters, wall stress shear (WSS, abdominal flow patterns, intraluminal thrombus (ILT, and AAA arterial wall rupture using computational fluid dynamics (CFD. Real AAA 3D models were created by three-dimensional (3D reconstruction of in vivo acquired computed tomography (CT images from 5 patients. Based on 3D AAA models, high quality volume meshes were created using an optimal tetrahedral aspect ratio for the whole domain. In order to quantify the WSS and the recirculation inside the AAA, a 3D CFD using finite elements analysis was used. The CFD computation was performed assuming that the arterial wall is rigid and the blood is considered a homogeneous Newtonian fluid with a density of 1050 kg/m3 and a kinematic viscosity of 4×10-3 Pa·s. Parallelization procedures were used in order to increase the performance of the CFD calculations. A relation between AAA geometric parameters (asymmetry index (β, saccular index (γ, deformation diameter ratio (χ, and tortuosity index (ε and hemodynamic loads was observed, and it could be used as a potential predictor of AAA arterial wall rupture and potential ILT formation.

  7. CFD modeling of methane distribution at a continuous miner face with various curtain setback distances

    Institute of Scientific and Technical Information of China (English)

    Zhou Lihong; Pritchard Christopher; Zheng Yi

    2015-01-01

    Knowledge of the airflow patterns and methane distributions at a continuous miner face under different ventilation conditions can minimize the risks of explosion and injury to miners by accurately forecasting potentially hazardous face methane levels. This study focused on validating a series of computational fluid dynamics (CFD) models using full-scale ventilation gallery data that assessed how curtain setback distance impacted airflow patterns and methane distributions at an empty mining face (no continuous miner present). Three CFD models of face ventilation with 4.6, 7.6 and 10.7 m (15, 25, and 35 ft) blowing curtain setback distances were constructed and validated with experimental data collected in a full-scale ventilation test facility. Good agreement was obtained between the CFD simulation results and this data. Detailed airflow and methane distribution information are provided. Elevated methane zones at the working faces were identified with the three curtain setback distances. Visualization of the setback dis-tance impact on the face methane distribution was performed by utilizing the post-processing capability of the CFD software.

  8. Validation of CFD-models for non-stoichiometric oxycoal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, Jan-Peter; Goanta, Adrian; Baumgartner, Andreas; Blume, Maximilian; Spliethoff, Hartmut [Technische Univ. Muenchen, Garching (Germany). Inst. of Energy Systems

    2013-07-01

    To compensate the drawback of high flue gas recirculation rates specific for oxyfuel processes, a new concept based on staged combustion, called controlled staging with non-stoichiometric burners (CSNB) was investigated. A combination of over- and sub-stoichiometric burners avoids inadmissible high flame temperatures even with oxygen concentrations up to 40 vol.-% in the oxidant. The non-stoichiometric burners are arranged in such a way that the overall stoichiometry at the combustion chamber outlet is slightly over-stoichiometric similar to conventional combustion processes, so that full burn out is secured. This concept aims at a more efficient oxyfuel process due to the decreasing effort in the recirculation loop and a new designed, more cost effective, steam generator. For further process optimization of the CSNB concept and the adjacent steam generator layout are validated CFD simulations urgently required. This paper shows first steps in validation of the CSNB combustion concept against state of the art CFD codes. The CFD code was optimized for oxyfuel combustion including a new char combustion and gas radiation model. Experimental investigations and CFD modelling are showing good agreement in concerns of temperature, CO and CO{sub 2} profiles. However the prediction of the oxygen concentration differs significantly between experiment and simulation.

  9. CFD Modelling of Abdominal Aortic Aneurysm on Hemodynamic Loads Using a Realistic Geometry with CT

    Science.gov (United States)

    Ng, E. Y. K.; Loong, T. H.; Bordone, Maurizio; Pua, Uei; Narayanan, Sriram

    2013-01-01

    The objective of this study is to find a correlation between the abdominal aortic aneurysm (AAA) geometric parameters, wall stress shear (WSS), abdominal flow patterns, intraluminal thrombus (ILT), and AAA arterial wall rupture using computational fluid dynamics (CFD). Real AAA 3D models were created by three-dimensional (3D) reconstruction of in vivo acquired computed tomography (CT) images from 5 patients. Based on 3D AAA models, high quality volume meshes were created using an optimal tetrahedral aspect ratio for the whole domain. In order to quantify the WSS and the recirculation inside the AAA, a 3D CFD using finite elements analysis was used. The CFD computation was performed assuming that the arterial wall is rigid and the blood is considered a homogeneous Newtonian fluid with a density of 1050 kg/m3 and a kinematic viscosity of 4 × 10−3 Pa·s. Parallelization procedures were used in order to increase the performance of the CFD calculations. A relation between AAA geometric parameters (asymmetry index (β), saccular index (γ), deformation diameter ratio (χ), and tortuosity index (ε)) and hemodynamic loads was observed, and it could be used as a potential predictor of AAA arterial wall rupture and potential ILT formation. PMID:23864906

  10. Modeling flow inside an anaerobic digester by CFD techniques

    Directory of Open Access Journals (Sweden)

    Alexandra Martínez Mendoza, Tatiana Montoya Martínez, Vicente Fajardo Montañana, P. Amparo López Jiménez

    2011-11-01

    Full Text Available Anaerobic processes are used to treat high strength organic wastewater as well as for the treatment of primary and secondary sludge from conventional wastewater treatment plants. In these processes, heterotrophic microorganisms convert biodegradable organic matter to methane and carbon dioxide in the absence of dissolved oxygen and nitrate. Some of the most important aspects of the design of anaerobic digesters are related to hydraulic considerations. In spite of its important role in performance, hydraulics of flow inside digesters has not been quantified or adequately characterized. In this contribution a three-dimensional steady-state computational fluid dynamics (CFD simulation has been performed for a particular anaerobic digester, in order to visualize the flow patterns. Flow and velocities profiles have been represented inside the digester to identify possible dead zones or stratifications. The geometry of a real digester installed in Valencia Waste Water Treatment Plant (located in Quart-Benager, Valencia, Spain has been used in order to consider the proposed methodology.

  11. CFD MODEL OF THE CNG DIRECT INJECTION ENGINE

    Directory of Open Access Journals (Sweden)

    Zbigniew Czyż

    2014-09-01

    Full Text Available The paper presents CFD analysis of fuel flow in the CNG injector. The issues such a pressure drop along an injector channel, mass flow through the key sections of the injector geometry, flow rates, the impact of the needle shape on the deflection of the sprayed gas cone and the impact of the wall head are analyzed in the article. The simulation was made in the transient states conditions for full injection process, including the opening and closing of the injector. An injection time of 6 ms, velocity of 0.33 mm/ms and a lift of 0.5 mm were selected for opening and closing of injector based on experimental test. The simulation shows that the volume inside the injector is a kind of fuel accumulator, and the opening process of the needle influence the flow parameters in an inlet cross-section after a certain time, depending on a channel cross section. The calculations allowed to select the ratio of an injector duct cross sectional area to the aperture area of the injection capable of the reducing pressure loss. The unusual location of the injector in the socket of a glow plug in the Andoria ADCR engine makes a stream be impaired by a part of the head. This research result would be useful in developing an injector construction which will be used for an investigation of CNG addition into diesel engine.

  12. Modelling die filling with charged particles using DEM/CFD

    Institute of Scientific and Technical Information of China (English)

    Emmanuel Nkem Nwose; Chunlei Pei; Chuan-Yu Wu

    2012-01-01

    The effects of electrostatic charge on powder flow behaviour during die filling in a vacuum and in air were analysed using a coupled discrete element method and computational fluid dynamics (DEM/CFD) code,in which long range electrostatic interactions were implemented.The present 2D simulations revealed that both electrostatic charge and the presence of air can affect the powder flow behaviour during die filling.It was found that the electrostatic charge inhibited the flow of powders into the die and induced a loose packing structure.At the same filling speed,increasing the electrostatic charge led to a decrease in the fill ratio which quantifies the volumetric occupancy of powder in the die.In addition,increasing the shoe speed caused a further decrease in the fill ratio,which was characterised using the concept of critical filling speed.When the electrostatic charge was low,the air/particle interaction was strong so that a lower critical filling speed was obtained for die filling in air than in a vacuum.With high electrostatic charge,the electrostatic interactions became dominant.Consequently,similar fill ratio and critical filling speed were obtained for die filling in air and in a vacuum.

  13. Improved similarity criterion for seepage erosion using mesoscopic coupled PFC-CFD model

    Institute of Scientific and Technical Information of China (English)

    倪小东; 王媛; 陈珂; 赵帅龙

    2015-01-01

    Conventional model tests and centrifuge tests are frequently used to investigate seepage erosion. However, the centrifugal test method may not be efficient according to the results of hydraulic conductivity tests and piping erosion tests. The reason why seepage deformation in model tests may deviate from similarity was first discussed in this work. Then, the similarity criterion for seepage deformation in porous media was improved based on the extended Darcy-Brinkman-Forchheimer equation. Finally, the coupled particle flow code–computational fluid dynamics (PFC−CFD) model at the mesoscopic level was proposed to verify the derived similarity criterion. The proposed model maximizes its potential to simulate seepage erosion via the discrete element method and satisfy the similarity criterion by adjusting particle size. The numerical simulations achieved identical results with the prototype, thus indicating that the PFC−CFD model that satisfies the improved similarity criterion can accurately reproduce the processes of seepage erosion at the mesoscopic level.

  14. Coupling scales for modelling heavy metal vaporization from municipal solid waste incineration in a fluid bed by CFD.

    Science.gov (United States)

    Soria, José; Gauthier, Daniel; Flamant, Gilles; Rodriguez, Rosa; Mazza, Germán

    2015-09-01

    Municipal Solid Waste Incineration (MSWI) in fluidized bed is a very interesting technology mainly due to high combustion efficiency, great flexibility for treating several types of waste fuels and reduction in pollutants emitted with the flue gas. However, there is a great concern with respect to the fate of heavy metals (HM) contained in MSW and their environmental impact. In this study, a coupled two-scale CFD model was developed for MSWI in a bubbling fluidized bed. It presents an original scheme that combines a single particle model and a global fluidized bed model in order to represent the HM vaporization during MSW combustion. Two of the most representative HM (Cd and Pb) with bed temperatures ranging between 923 and 1073K have been considered. This new approach uses ANSYS FLUENT 14.0 as the modelling platform for the simulations along with a complete set of self-developed user-defined functions (UDFs). The simulation results are compared to the experimental data obtained previously by the research group in a lab-scale fluid bed incinerator. The comparison indicates that the proposed CFD model predicts well the evolution of the HM release for the bed temperatures analyzed. It shows that both bed temperature and bed dynamics have influence on the HM vaporization rate. It can be concluded that CFD is a rigorous tool that provides valuable information about HM vaporization and that the original two-scale simulation scheme adopted allows to better represent the actual particle behavior in a fluid bed incinerator. PMID:26050934

  15. New weighted sum of gray gases model applicable to Computational Fluid Dynamics (CFD) modeling of oxy-fuel combustion

    DEFF Research Database (Denmark)

    Yin, Chungen; Johansen, Lars Christian Riis; Rosendahl, Lasse;

    2010-01-01

    Radiation is the principal mode of heat transfer in furnaces. Models for gaseous radiative properties have been well established for air combustion. However, there is uncertainty regarding their applicability to oxy-fuel conditions. In this paper, a new and complete set of weighted sum of gray......), and the calculated results are validated in very details against data in literature. Then the validated code is used to generate emissivity databases for representative air-firing and oxy-firing conditions, for each of which a refined WSGGM with new parameters is derived. The practical way to implement the model...... into CFD simulations of combustion systems is given. Finally, as a demonstration, the new model is implemented into CFD modeling of two furnaces of very different beam lengths, respectively. The CFD results are compared with those based on the widely used WSGGM in literature, from which some useful...

  16. CFD Study of NOx Emissions in a Model Commercial Aircraft Engine Combustor

    Institute of Scientific and Technical Information of China (English)

    ZHANG Man; FU Zhenbo; LIN Yuzhen; LI Jibao

    2012-01-01

    Air worthiness requirements of the aircraft engine emission bring new challenges to the combustor research and design.With the motivation to design high performance and clean combustor,computational fluid dynamics (CFD) is utilized as the powerful design approach.In this paper,Reynolds averaged Navier-Stokes (RANS) equations of reactive two-phase flow in an experimental low emission combustor is performed.The numerical approach uses an implicit compressible gas solver together with a Lagrangian liquid-phase tracking method and the extended coherent flamelet model for turbulence-combustion interaction.The NOx formation is modeled by the concept of post-processing,which resolves the NOx transport equation with the assumption of frozen temperature distribution.Both turbulence-combustion interaction model and NOx formation model are firstly evaluated by the comparison of experimental data published in open literature of a lean direct injection (LDI) combustor.The test rig studied in this paper is called low emission stirred swirl (LESS) combustor,which is a two-stage model combustor,fueled with liquid kerosene (RP-3) and designed by Beihang University (BUAA).The main stage of LESS combustor employs the principle of lean prevaporized and premixed (LPP) concept to reduce pollutant,and the pilot stage depends on a diffusion flame for flame stabilization.Detailed numerical results including species distribution,turbulence performance and burning performance are qualitatively and quantitatively evaluated.Numerical prediction of NOx emission shows a good agreement with test data at both idle condition and full power condition of LESS combustor.Preliminary results of the flame structure are shown in this paper.The flame stabilization mechanism and NOx reduction effort are also discussed with in-depth analysis.

  17. Aerosol-CFD modelling of ultrafine and black carbon particle emission, dilution, and growth near roadways

    Science.gov (United States)

    Huang, L.; Gong, S. L.; Gordon, M.; Liggio, J.; Staebler, R. M.; Stroud, C. A.; Lu, G.; Mihele, C.; Brook, J. R.; Jia, C. Q.

    2014-05-01

    Many studies have shown that on-road vehicle emissions are the dominant source of ultrafine particles (UFP; diameter advance our knowledge on the complex interactions and competition among atmospheric dilution, dispersion and dynamics of UFPs, an aerosol dynamics-CFD coupled model is developed and validated against field measurements. A unique approach of applying periodic boundary conditions is proposed to model pollutant dispersion and dynamics in one unified domain from the tailpipe level to the ambient near-road environment. This approach significantly reduces the size of the computational domain, and therefore, allows fast simulation of multiple scenarios. The model is validated against measured turbulent kinetic energy (TKE) and pollution gradients near a major highway. Through a model sensitivity analysis, the relative importance of individual aerosol dynamical processes on the total particle number concentration (N) and particle number-size distribution (PSD) near a highway is investigated. The results demonstrate that (1) coagulation has a negligible effect on N and particle growth, (2) binary homogeneous nucleation (BHN) of H2SO4-H2O is likely responsible for elevated N closest to the road, (3) N and particle growth are very sensitive to the condensation of semi-volatile organics (SVOCs), particle dry deposition, and the interaction between these processes. The results also indicate that, without the proper treatment of atmospheric boundary layer (i.e. its wind profile and turbulence quantities), the nucleation rate would be underestimated by a factor of 5 in the vehicle wake region due to overestimated mixing. Therefore, introducing ABL conditions to activity-based emission models may potentially improve their performance in estimating UFP traffic emissions.

  18. CFD modelling and validation of wall condensation in the presence of non-condensable gases

    Energy Technology Data Exchange (ETDEWEB)

    Zschaeck, G., E-mail: guillermo.zschaeck@ansys.com [ANSYS Germany GmbH, Staudenfeldweg 12, Otterfing 83624 (Germany); Frank, T. [ANSYS Germany GmbH, Staudenfeldweg 12, Otterfing 83624 (Germany); Burns, A.D. [ANSYS UK Ltd, 97 Milton Park, Abingdon, Oxfordshire OX14 4RY (United Kingdom)

    2014-11-15

    Highlights: • A wall condensation model was implemented and validated in ANSYS CFX. • Condensation rate is assumed to be controlled by the concentration boundary layer. • Validation was done using two laboratory scale experiments. • CFD calculations show good agreement with experimental data. - Abstract: The aim of this paper is to present and validate a mathematical model implemented in ANSYS CFD for the simulation of wall condensation in the presence of non-condensable substances. The model employs a mass sink at isothermal walls or conjugate heat transfer (CHT) domain interfaces where condensation takes place. The model was validated using the data reported by Ambrosini et al. (2008) and Kuhn et al. (1997)

  19. Investigation of Drag Force on Fibres of Bonded Spherical Elements using a Coupled CFD-DEM Approach

    DEFF Research Database (Denmark)

    Jensen, Anna Lyhne; Sørensen, Henrik; Rosendahl, Lasse Aistrup;

    2016-01-01

    are quantified. The drag coefficient on the resolved cylinder is compared to a CFD-DEM simulation of a flexible fiber made by a chain of bonded spherical discrete elements, using a free steam drag formulation on each particle. Based on the results, a drag force model can distinguish between the outermost...

  20. Enhancement of energy efficiency in a paint curing oven via CFD approach: Case study in an air-conditioning plant

    International Nuclear Information System (INIS)

    Highlights: • We use CFD model to simulate air temperature in an industrial-scale paint curing oven. • Comparison of temperature is made for two proposed options to achieve energy saving. • Both proposed options provide the increase in average air temperature for the oven. - Abstract: An oven has been commonly employed to cure powder painted on metal parts for an air-conditioning production. There are many options to improve efficiency in fuel use for the paint curing oven; however some options need deep understanding to prove the possibility of thermal performance. In this work, computational fluid dynamic (CFD) modeling and simulation have been applied to study the temperature distribution and the flow pattern in the paint curing oven on a large scale. The CFD model has been validated against real data. The validated CFD model is used to investigate the temperature distribution and the flow pattern for two proposed options: eliminating stored heat and rearranging airflow. Results demonstrate that both cases provide temperature increase of 1.9 and 1.3 °C for air compared to the present paint curing oven. It can be concluded that the two proposed options are applicable for further implementation to the present paint curing oven

  1. A Simplified CFD Model for Simulation of the Suction Process Of Reciprocating Compressors

    OpenAIRE

    Pereira, Evandro L. L.; Santos, Claudio J.; Deschamps, Cesar J.; Kremer, Rodrigo

    2012-01-01

    The suction process in reciprocating compressors is strongly affected by the valve dynamics and the pulsating flow throughout the suction muffler. This paper describes a simplified computational fluid dynamics (CFD) model to simulate the flow through the muffler, suction valve and a small region inside the cylinder. The proposed method is applied to predict the suction process of a small reciprocating compressor and its adequacy is compared with a more time elaborate model in terms of accurac...

  2. CFD Modelling of Abdominal Aortic Aneurysm on Hemodynamic Loads Using a Realistic Geometry with CT

    OpenAIRE

    Loong, T. H.; Maurizio Bordone; Uei Pua; Sriram Narayanan; Eduardo Soudah; E. Y. K. Ng

    2013-01-01

    The objective of this study is to find a correlation between the abdominal aortic aneurysm (AAA) geometric parameters, wall stress shear (WSS), abdominal flow patterns, intraluminal thrombus (ILT), and AAA arterial wall rupture using computational fluid dynamics (CFD). Real AAA 3D models were created by three-dimensional (3D) reconstruction of in vivo acquired computed tomography (CT) images from 5 patients. Based on 3D AAA models, high quality volume meshes were created using an optimal tetr...

  3. CFD modeling of multiphase reacting flow in blast furnace shaft with layered burden

    International Nuclear Information System (INIS)

    The ironmaking blast furnace is a counter-current chemical reactor which includes the ascending gas flow and the counter-current descending porous bed (burden). A Computational Fluid Dynamics (CFD) model has been developed to simulate the multiphase reacting flow in blast furnace shaft. The gas flow dynamics, burden movement, chemical reactions, heat and mass transfer between the gas phase and burden phase are included in the CFD model. The blast furnace burden consists of alternative layers of iron ore and coke. A novel methodology is proposed to efficiently model the effects of alternative burden layer structure on gas flow, heat transfer, mass transfer and chemical reactions. Different reactions and heat transfer characteristics are applied for difference types of layer. In addition, the layered CFD model accurately predicts the Cohesive Zone (CZ) shape where the melting of solid burden taking place. The shape and location of the CZ are determined by an iterative method based on the ore temperature distribution. The theoretical formation and the methodology of the CFD model are presented and the model is applied to simulate industry blast furnaces. The proposed method can be applied to investigate the blast furnace shaft process and other moving bed system with periodic burden structure configuration. - Highlights: •A novel methodology is proposed to efficiently model the blast furnace shaft with layered burden. •The effects of layered burden on flow, heat transfer, and chemical reactions are considered in the model. •The shape and location of the cohesive zone is determined by an iterative method

  4. Local CFD kinetic model of cadmium vaporization during fluid bed incineration of municipal solid waste

    Energy Technology Data Exchange (ETDEWEB)

    Soria, J. [Instituto Multidisciplinario de Investigación y Desarrollo de la Patagonia Norte (IDEPA, CONICET-UNCo) y Facultad de Ingeniería, Universidad Nacional del Comahue, Buenos Aires 1400, 8300 Neuquén (Argentina); Laboratoire Procédés, Matériaux et Energie Solaire (CNRS-PROMES), 7 Rue du Four Solaire, Odeillo, 66120 Font-Romeu (France); Gauthier, D., E-mail: Daniel.Gauthier@promes.cnrs.fr [Laboratoire Procédés, Matériaux et Energie Solaire (CNRS-PROMES), 7 Rue du Four Solaire, Odeillo, 66120 Font-Romeu (France); Falcoz, Q.; Flamant, G. [Laboratoire Procédés, Matériaux et Energie Solaire (CNRS-PROMES), 7 Rue du Four Solaire, Odeillo, 66120 Font-Romeu (France); Mazza, G. [Instituto Multidisciplinario de Investigación y Desarrollo de la Patagonia Norte (IDEPA, CONICET-UNCo) y Facultad de Ingeniería, Universidad Nacional del Comahue, Buenos Aires 1400, 8300 Neuquén (Argentina)

    2013-03-15

    Highlights: ► A 2-D local CFD model for simulating the Cd vaporization process is presented. ► It includes a kinetic expression of Cd vaporization into the incineration process. ► Pyrolysis, volatiles’ combustion and residual carbon combustion are also taken into account. ► It fits very well the experimental results obtained on a lab-scale fluidized bed reported in literature. ► It also compares favorably with a model developed previously by the group. -- Abstract: The emissions of heavy metals during incineration of Municipal Solid Waste (MSW) are a major issue to health and the environment. It is then necessary to well quantify these emissions in order to accomplish an adequate control and prevent the heavy metals from leaving the stacks. In this study the kinetic behavior of Cadmium during Fluidized Bed Incineration (FBI) of artificial MSW pellets, for bed temperatures ranging from 923 to 1073 K, was modeled. FLUENT 12.1.4 was used as the modeling framework for the simulations and implemented together with a complete set of user-defined functions (UDFs). The CFD model combines the combustion of a single solid waste particle with heavy metal (HM) vaporization from the burning particle, and it takes also into account both pyrolysis and volatiles’ combustion. A kinetic rate law for the Cd release, derived from the CFD thermal analysis of the combusting particle, is proposed. The simulation results are compared with experimental data obtained in a lab-scale fluidized bed incinerator reported in literature, and with the predicted values from a particulate non-isothermal model, formerly developed by the authors. The comparison shows that the proposed CFD model represents very well the evolution of the HM release for the considered range of bed temperature.

  5. A CFD numerical model for the flow distribution in a MTR fuel element

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Delvonei Alves de; Santos, Pedro Henrique Di Giovanni; Oliveira, Fabio Branco Vaz de; Torres, Walmir Maximo; Umbehaun, Pedro Ernesto; Souza, Jose Antonio Batista de; Belchior Junior, Antonio; Sabundjian, Gaiane; Prado, Adelk de Carvalho, E-mail: acprado@ipen.br, E-mail: delvonei@ipen.br, E-mail: dpedro_digiovanni_s@hotmail.com, E-mail: fabio@ipen.br, E-mail: wmtorres@ipen.br, E-mail: umbehaun@ipen.br, E-mail: jasouza@ipen.br, E-mail: abelchior@ipen.br, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Engenharia Nuclear; Angelo, Edvaldo, E-mail: eangelo@mackenzie.br [Universidade Presbiteriana Mackenzie, Sao Paulo, SP (Brazil); Angelo, Gabriel, E-mail: gangelo@fei.edu.br [Fundacao Educacional Inaciana (FEI), Sao Bernardo do Campo, SP (Brazil)

    2015-07-01

    Previously, an instrumented dummy fuel element (DMPV-01), with the same geometric characteristics of a MTR fuel element, was designed and constructed for pressure drop and flow distribution measurement experiments at the IEA-R1 reactor core. This dummy element was also used to measure the flow distribution among the rectangular flow channels formed by element fuel plates. A CFD numerical model was developed to complement the studies. This work presents the proposed CFD model as well as a comparison between numerical and experimental results of flow rate distribution among the internal flow channels. Numerical results show that the model reproduces the experiments very well and can be used for the studies as a more convenient and complementary tool. (author)

  6. A CFD model for biomass combustion in a packed bed furnace

    Science.gov (United States)

    Karim, Md. Rezwanul; Ovi, Ifat Rabbil Qudrat; Naser, Jamal

    2016-07-01

    Climate change has now become an important issue which is affecting environment and people around the world. Global warming is the main reason of climate change which is increasing day by day due to the growing demand of energy in developed countries. Use of renewable energy is now an established technique to decrease the adverse effect of global warming. Biomass is a widely accessible renewable energy source which reduces CO2 emissions for producing thermal energy or electricity. But the combustion of biomass is complex due its large variations and physical structures. Packed bed or fixed bed combustion is the most common method for the energy conversion of biomass. Experimental investigation of packed bed biomass combustion is difficult as the data collection inside the bed is challenging. CFD simulation of these combustion systems can be helpful to investigate different operational conditions and to evaluate the local values inside the investigation area. Available CFD codes can model the gas phase combustion but it can't model the solid phase of biomass conversion. In this work, a complete three-dimensional CFD model is presented for numerical investigation of packed bed biomass combustion. The model describes the solid phase along with the interface between solid and gas phase. It also includes the bed shrinkage due to the continuous movement of the bed during solid fuel combustion. Several variables are employed to represent different parameters of solid mass. Packed bed is considered as a porous bed and User Defined Functions (UDFs) platform is used to introduce solid phase user defined variables in the CFD. Modified standard discrete transfer radiation method (DTRM) is applied to model the radiation heat transfer. Preliminary results of gas phase velocity and pressure drop over packed bed have been shown. The model can be useful for investigation of movement of the packed bed during solid fuel combustion.

  7. Massive separation around bluff bodies: comparisons among different cfd solvers and turbulence models

    Science.gov (United States)

    Armenio, Vincenzo; Fakhari, Ahmad; Petronio, Andrea; Padovan, Roberta; Pittaluga, Chiara; Caprino, Giovanni

    2015-11-01

    Massive flow separation is ubiquitous in industrial applications, ruling drag and hydrodynamic noise. In spite of considerable efforts, its numerical prediction still represents a challenge for CFD models in use in engineering. Aside commercial software, over the latter years the opensource software OpenFOAMR (OF) has emerged as a valid tool for prediction of complex industrial flows. In the present work, we simulate two flows representative of a class of situations occurring in industrial problems: the flow around sphere and that around a wall-mounted square cylinder at Re = 10000 . We compare the performance two different tools, namely OF and ANSYS CFX 15.0 (CFX) using different unstructured grids and turbulence models. The grids have been generated using SNAPPYHEXMESH and ANSYS ICEM CFD 15.0 with different near wall resolutions. The codes have been run in a RANS mode using k - ɛ model (OF) and SST - k - ω (CFX) with and without wall-layer models. OF has been also used in LES, WMLES and DES mode. Regarding the sphere, RANS models were not able to catch separation, while good prediction of separation and distribution of stresses over the surface were obtained using LES, WMLES and DES. Results for the second test case are currently under analysis. Financial support from COSMO ``cfd open source per opera mortta'' PAR FSC 2007-2013, Friuli Venezia Giulia.

  8. Numerical modelling of pressure suppression pools with CFD and FEM codes

    Energy Technology Data Exchange (ETDEWEB)

    Paettikangas, T.; Niemi, J.; Timperi, A. (VTT Technical Research Centre of Finland (Finland))

    2011-06-15

    Experiments on large-break loss-of-coolant accident for BWR is modeled with computational fluid (CFD) dynamics and finite element calculations. In the CFD calculations, the direct-contact condensation in the pressure suppression pool is studied. The heat transfer in the liquid phase is modeled with the Hughes-Duffey correlation based on the surface renewal model. The heat transfer is proportional to the square root of the turbulence kinetic energy. The condensation models are implemented with user-defined functions in the Euler-Euler two-phase model of the Fluent 12.1 CFD code. The rapid collapse of a large steam bubble and the resulting pressure source is studied analytically and numerically. Pressure source obtained from simplified calculations is used for studying the structural effects and FSI in a realistic BWR containment. The collapse results in volume acceleration, which induces pressure loads on the pool walls. In the case of a spherical bubble, the velocity term of the volume acceleration is responsible of the largest pressure load. As the amount of air in the bubble is decreased, the peak pressure increases. However, when the water compressibility is accounted for, the finite speed of sound becomes a limiting factor. (Author)

  9. Local CFD kinetic model of cadmium vaporization during fluid bed incineration of municipal solid waste.

    Science.gov (United States)

    Soria, J; Gauthier, D; Falcoz, Q; Flamant, G; Mazza, G

    2013-03-15

    The emissions of heavy metals during incineration of Municipal Solid Waste (MSW) are a major issue to health and the environment. It is then necessary to well quantify these emissions in order to accomplish an adequate control and prevent the heavy metals from leaving the stacks. In this study the kinetic behavior of Cadmium during Fluidized Bed Incineration (FBI) of artificial MSW pellets, for bed temperatures ranging from 923 to 1073 K, was modeled. FLUENT 12.1.4 was used as the modeling framework for the simulations and implemented together with a complete set of user-defined functions (UDFs). The CFD model combines the combustion of a single solid waste particle with heavy metal (HM) vaporization from the burning particle, and it takes also into account both pyrolysis and volatiles' combustion. A kinetic rate law for the Cd release, derived from the CFD thermal analysis of the combusting particle, is proposed. The simulation results are compared with experimental data obtained in a lab-scale fluidized bed incinerator reported in literature, and with the predicted values from a particulate non-isothermal model, formerly developed by the authors. The comparison shows that the proposed CFD model represents very well the evolution of the HM release for the considered range of bed temperature. PMID:23410804

  10. Semi-analytical and 3D CFD DPAL modeling: feasibility of supersonic operation

    Science.gov (United States)

    Rosenwaks, Salman; Barmashenko, Boris D.; Waichman, Karol

    2014-02-01

    The feasibility of operating diode pumped alkali lasers (DPALs) with supersonic expansion of the gaseous laser mixture, consisting of alkali atoms, He atoms and (frequently) hydrocarbon molecules, is explored. Taking into account fluid dynamics and kinetic processes, both semi-analytical and three-dimensional (3D) computational fluid dynamics (CFD) modeling of supersonic DPALs is reported. Using the semi-analytical model, the operation of supersonic DPALs is compared with that measured and modeled in subsonic lasers for both Cs and K. The maximum power of supersonic Cs and K lasers is found to be higher than that of subsonic lasers with the same resonator and alkali density at the laser inlet by 25% and 70%, respectively. Using the 3D CFD model, the flow pattern and spatial distributions of the pump and laser intensities in the resonator are calculated for Cs DPALs. Comparison between the semi-analytical and 3D CFD models for Cs shows that the latter predicts much larger maximum achievable laser power than the former. These results indicate that for scaling-up the power of DPALs, supersonic expansion should be considered.

  11. Investigation of mucus transport in an idealized lung airway model using multiphase CFD analysis

    Science.gov (United States)

    Rajendran, Rahul; Banerjee, Arindam

    2015-11-01

    Mucus, a Bingham fluid is transported in the pulmonary airways by consistent beating of the cilia and exhibits a wide range of physical properties in response to the core air flow and various pathological conditions. A better understanding of the interfacial instability is required as it plays a crucial role in gas transport, mixing, mucus clearance and drug delivery. In the current study, mucus is modelled as a Newtonian fluid and the two phase gas-liquid flow in the airways is investigated using an inhomogeneous Eulerian-Eulerian approach. The complex interface between the phases is tracked using the conventional VOF (Volume of Fluid) method. Results from our CFD simulations which are performed in idealized single and double bifurcation geometries will be presented and the influence of airflow rate, mucus layer thickness, mucus viscosity, airway geometry (branching & diameter) and surface tension on mucus flow behavior will be discussed. Mean mucus layer thickness, pressure drop due to momentum transfer & increased airway resistance, mucus transport speed and the flow morphology will be compared to existing experimental and theoretical data.

  12. A comparative study of the CFD modeling of a ventilated active façade including phase change materials

    International Nuclear Information System (INIS)

    Highlights: • A CFD model of a ventilated active façade with PCM was developed. • Results were validated against real-scale experimental data. • Convection effects within PCM can be neglected in for the façade under study. • DO radiation model and RNG k–ε showed accurate results for air turbulent flow regime. • k–ω models showed better accuracy than the RNG k–ε model for transitional air flows. - Abstract: This article describes the development of a CFD 2D model of a new type of ventilated active façade which includes a PCM (Phase Change Material) in its outer layer. The model was carried out using the software Fluent. The numerical results were compared against experimental data obtained by means of a real-scale PASLINK test facility. Two different approaches were tested to model the PCM. To model the radiation, S2S and DO sub-models were tested. RNG k–ε, Standard k–ω and SST k–ω turbulence models were compared to model the air flow inside the ventilated layer. The results showed that for the geometry under consideration it was suitable to consider the PCM to be a solid material with variable Cp. The DO model accurately reproduced the radiation phenomena. For an air flow rate that resulted in a turbulent regime inside the air chamber, the RNG k–ε model showed good agreement between the experimental data and the simulated results. The developed model can be considered suitable for the simulation and optimization of the fa ade under turbulent flow conditions. Further research should be conducted to improve the accuracy of the model for low-Reynolds-number turbulence conditions

  13. Validation of Hydrodynamic Load Models Using CFD for the OC4-DeepCwind Semisubmersible: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Benitz, M. A.; Schmidt, D. P.; Lackner, M. A.; Stewart, G. M.; Jonkman, J.; Robertson, A.

    2015-03-01

    Computational fluid dynamics (CFD) simulations were carried out on the OC4-DeepCwind semi-submersible to obtain a better understanding of how to set hydrodynamic coefficients for the structure when using an engineering tool such as FAST to model the system. The focus here was on the drag behavior and the effects of the free-surface, free-ends and multi-member arrangement of the semi-submersible structure. These effects are investigated through code-to-code comparisons and flow visualizations. The implications on mean load predictions from engineering tools are addressed. The work presented here suggests that selection of drag coefficients should take into consideration a variety of geometric factors. Furthermore, CFD simulations demonstrate large time-varying loads due to vortex shedding, which FAST's hydrodynamic module, HydroDyn, does not model. The implications of these oscillatory loads on the fatigue life needs to be addressed.

  14. Validation and Analysis of Forward Osmosis CFD Model in Complex 3D Geometries

    Directory of Open Access Journals (Sweden)

    Lars Yde

    2012-11-01

    Full Text Available In forward osmosis (FO, an osmotic pressure gradient generated across a semi-permeable membrane is used to generate water transport from a dilute feed solution into a concentrated draw solution. This principle has shown great promise in the areas of water purification, wastewater treatment, seawater desalination and power generation. To ease optimization and increase understanding of membrane systems, it is desirable to have a comprehensive model that allows for easy investigation of all the major parameters in the separation process. Here we present experimental validation of a computational fluid dynamics (CFD model developed to simulate FO experiments with asymmetric membranes. Simulations are compared with experimental results obtained from using two distinctly different complex three-dimensional membrane chambers. It is found that the CFD model accurately describes the solute separation process and water permeation through membranes under various flow conditions. It is furthermore demonstrated how the CFD model can be used to optimize membrane geometry in such as way as to promote the mass transfer.

  15. Modeling and Simulation of Hamburger Cooking Process Using Finite Difference and CFD Methods

    Directory of Open Access Journals (Sweden)

    J. Sargolzaei

    2011-01-01

    Full Text Available Unsteady-state heat transfer in hamburger cooking process was modeled using one dimensional finite difference (FD and three dimensional computational fluid dynamic (CFD models. A double-sided cooking system was designed to study the effect of pressure and oven temperature on the cooking process. Three different oven temperatures (114, 152, 204°C and three different pressures (20, 332, 570 pa were selected and 9 experiments were performed. Applying pressure to hamburger increases the contact area of hamburger with heating plate and hence the heat transfer rate to the hamburger was increased and caused the weight loss due to water evaporation and decreasing cooking time, while increasing oven temperature led to increasing weight loss and decreasing cooking time. CFD predicted results were in good agreement with the experimental results than the finite difference (FD ones. But considering the long time needed for CFD model to simulate the cooking process (about 1 hour, using the finite difference model would be more economic.

  16. A CFD approach to the atmospheric dispersion of radionuclides in the vicinity of NPPs

    Energy Technology Data Exchange (ETDEWEB)

    Sampaio, Paulo A.B. de; Goncalves Junior, Milton A.; Lapa, Celso M.F. [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)]. E-mails: sampaio@ien.gov.br; miago@ien.gov.br; lapa@ien.gov.br

    2007-07-01

    Most studies of atmospheric dispersion of radionuclides released from Nuclear Power Plants (NPPs) are based on Gaussian plume models or on the use of a convection-diffusion equation. Such methods, which do not involve solving the flow problem, are useful in the atmospheric mesoscale, of the order of 2-2000 km from the NPP. However, they do not account for the turbulence generated by the interaction of the wind with obstacles and with the released material stream, which are the dominant factors in the local scale, of the order of 0-2 km from the source of emission. In order to study the dispersion of radionuclides in the vicinity of NPPs, the authors advocate the use of Computational Fluid Dynamics (CFD). The physical model is based on the Navier- Stokes equations, a convection-diffusion energy equation, and transport equations for the radionuclides. The stabilized finite element formulation employed results in a Large Eddy Simulation procedure, where no explicit subgrid modeling is required. The code uses adaptive techniques combining error estimation and remeshing. It has been implemented in a Beowulf parallel computing system using domain decomposition and the Message Passing Interface (MPI) for communication among processors. Both controlled emissions from a chimney and severe accidents have been simulated, showing the importance of the local phenomena on the dispersion of radionuclides. (author)

  17. A CFD model of the wake of an offshore wind farm: Using a prescribed wake inflow

    DEFF Research Database (Denmark)

    Réthoré, P.-E.; Bechmann, Andreas; Sørensen, Niels N.;

    2007-01-01

      An CFD model of the wake of an offshore wind farm, expanding existing measurements is proposed. The method is based on solving the Navier Stokes equation in a large domain downstream an offshore wind farm. The inflow of the domain is estimated using existing met mast measurements from both free...... stream and directly in-wake conditions. A comparison between the simulation results and measurements from a met mast are presented and the shortcomings of the methods are discussed.  ...

  18. CFD and Ventilation Research

    DEFF Research Database (Denmark)

    Li, Y.; Nielsen, Peter V.

    2011-01-01

    of scientific research and engineering development of complex air distribution and ventilation systems in buildings. This review discusses the major and specific challenges of CFD in terms of turbulence modelling, numerical approximation, and boundary conditions relevant to building ventilation. We emphasize...... the growing need for CFD verification and validation, suggest on-going needs for analytical and experimental methods to support the numerical solutions, and discuss the growing capacity of CFD in opening up new research areas. We suggest that CFD has not become a replacement for experiment and theoretical......There has been a rapid growth of scientific literature on the application of computational fluid dynamics (CFD) in the research of ventilation and indoor air science. With a 1000–10,000 times increase in computer hardware capability in the past 20 years, CFD has become an integral part...

  19. A CFD-based wind solver for a fast response transport and dispersion model

    Energy Technology Data Exchange (ETDEWEB)

    Gowardhan, Akshay A [Los Alamos National Laboratory; Brown, Michael J [Los Alamos National Laboratory; Pardyjak, Eric R [UNIV OF UTAH; Senocak, Inanc [BOISE STATE UNIV

    2010-01-01

    In many cities, ambient air quality is deteriorating leading to concerns about the health of city inhabitants. In urban areas with narrow streets surrounded by clusters of tall buildings, called street canyons, air pollution from traffic emissions and other sources is difficult to disperse and may accumulate resulting in high pollutant concentrations. For various situations, including the evacuation of populated areas in the event of an accidental or deliberate release of chemical, biological and radiological agents, it is important that models should be developed that produce urban flow fields quickly. For these reasons it has become important to predict the flow field in urban street canyons. Various computational techniques have been used to calculate these flow fields, but these techniques are often computationally intensive. Most fast response models currently in use are at a disadvantage in these cases as they are unable to correlate highly heterogeneous urban structures with the diagnostic parameterizations on which they are based. In this paper, a fast and reasonably accurate computational fluid dynamics (CFD) technique that solves the Navier-Stokes equations for complex urban areas has been developed called QUIC-CFD (Q-CFD). This technique represents an intermediate balance between fast (on the order of minutes for a several block problem) and reasonably accurate solutions. The paper details the solution procedure and validates this model for various simple and complex urban geometries.

  20. Low Reynolds turbulence model CFD simulation for complex electronic system: an industrial point of view

    Science.gov (United States)

    Giannuzzi, M.

    2014-07-01

    In electronic systems the presence of bluff bodies, sharp corners and bends are the cause of flow separation and large recirculation bubbles. Since the recirculation vortices develop they encapsulate the heat from an electronic component becoming one of the major contributors of malfunction. Going in depth in this, some numerical simulations of conjugate heat transfer for a heat wall-mounted cube have been performed using the commercial CFD code scSTREAM V11 by Software Cradle Co, Ltd. It is well known that the reliability of CFD analysis depends heavily on the turbulent model employed together with the wall functions implemented. The three low- Reynolds k - epsilon turbulent models developed by Abe-Nagano-Kondoh have been validated against experimental data consisting mainly of velocity profiles and surface temperature distributions provided in literature. The performed validation shows a satisfactory agreement between the measured and simulated data. The turbulent model chosen is then used for the CFD simulation of a complex electronic system.

  1. Low Reynolds turbulence model CFD simulation for complex electronic system: an industrial point of view

    International Nuclear Information System (INIS)

    In electronic systems the presence of bluff bodies, sharp corners and bends are the cause of flow separation and large recirculation bubbles. Since the recirculation vortices develop they encapsulate the heat from an electronic component becoming one of the major contributors of malfunction. Going in depth in this, some numerical simulations of conjugate heat transfer for a heat wall-mounted cube have been performed using the commercial CFD code scSTREAM V11 by Software Cradle Co, Ltd. It is well known that the reliability of CFD analysis depends heavily on the turbulent model employed together with the wall functions implemented. The three low- Reynolds k – ε turbulent models developed by Abe-Nagano-Kondoh have been validated against experimental data consisting mainly of velocity profiles and surface temperature distributions provided in literature. The performed validation shows a satisfactory agreement between the measured and simulated data. The turbulent model chosen is then used for the CFD simulation of a complex electronic system.

  2. Electrical capacitance tomography (ECT) and gamma radiation meter for comparison with and validation and tuning of computational fluid dynamics (CFD) modeling of multiphase flow

    International Nuclear Information System (INIS)

    The electrical capacitance tomographic (ECT) approach is increasingly seen as attractive for measurement and control applications in the process industries. Recently, there is increased interest in using the tomographic details from ECT for comparing with and validating and tuning CFD models of multiphase flow. Collaboration with researchers working in the field of computational fluid dynamics (CFD) modeling of multiphase flows gives valuable information for both groups of researchers in the field of ECT and CFD. By studying the ECT tomograms of multiphase flows under carefully monitored inflow conditions of the different media and by obtaining the capacitance values, C(i, j, t) with i = 1…N, j = 1, 2,…N and i ≠ j obtained from ECT modules with N electrodes, it is shown how the interface heights in a pipe with stratified flow of oil and air can be fruitfully compared to the values of those obtained from ECT and gamma radiation meter (GRM) for improving CFD modeling. Monitored inflow conditions in this study are flow rates of air, water and oil into a pipe which can be positioned at varying inclinations to the horizontal, thus emulating the pipelines laid in subsea installations. It is found that ECT-based tomograms show most of the features seen in the GRM-based visualizations with nearly one-to-one correspondence to interface heights obtained from these two methods, albeit some anomalies at the pipe wall. However, there are some interesting features the ECT manages to capture: features which the GRM or the CFD modeling apparently do not show, possibly due to parameters not defined in the inputs to the CFD model or much slower response of the GRM. Results presented in this paper indicate that a combination of ECT and GRM and preferably with other modalities with enhanced data fusion and analysis combined with CFD modeling can help to improve the modeling, measurement and control of multiphase flow in the oil and gas industries and in the process industries

  3. Modelling Thermal Environmental Performance In Top-lit Malaysian Atrium Using Computational Fluid Dynamics (CFD

    Directory of Open Access Journals (Sweden)

    A.H. Abdullah

    2009-12-01

    Full Text Available Computational Fluid Dynamics (CFD programs are powerful design tools that can predict detailed flow movement, temperature distribution, and contaminant dispersion. This paper reports the steady-state 3-D CFD modelling of air movement and temperature distribution due to thermal buoyancy within top-lit three-storey representative Malaysian atrium forms using the computer code PHOENICS. Details of temperature distribution, airflow patterns and other comfort parameters would provide a better picture of the resultant thermal performance within the atrium in response to the changes of design variables. The CFD modelling studies were to investigate quantitatively the effects of varying inlet to outlet opening area ratios and also the outlet’s arrangement on the atrium’s thermal environmental performance in relation to occupants’ thermal comfort. The simulation results have revealed that sufficiently higher inlet to outlet opening area ratio (i.e. n>1 can improve the thermal performance on the occupied levels; while with an equal inlet to outlet opening area ratio (i.e. n=1, changing the outlet’s arrangement (i.e. location and configuration has not significantly affected the atrium’s thermal performance.

  4. CFD analysis and flow model reduction for surfactant production in helix reactor

    Directory of Open Access Journals (Sweden)

    Nikačević N.M.

    2015-01-01

    Full Text Available Flow pattern analysis in a spiral Helix reactor is conducted, for the application in the commercial surfactant production. Step change response curves (SCR were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD simulations. Non-reactive flow is simulated, though viscosity is treated as variable in the direction of flow, as it increases during the reaction. The design and operating parameters (reactor diameter, number of coils and inlet velocity are varied in CFD simulations, in order to examine the effects on the flow pattern. Given that 3D simulations are not practical for fast computations needed for optimization, scale-up and control, CFD flow model is reduced to one-dimensional axial dispersion (AD model with spatially variable dispersion coefficient. Dimensionless dispersion coefficient (Pe is estimated under different conditions and results are analyzed. Finally, correlation which relates Pe number with Reynolds number and number of coils from the reactor entrance is proposed for the particular reactor application and conditions.

  5. CFD Studies on Biomass Thermochemical Conversion

    Directory of Open Access Journals (Sweden)

    Lifeng Yan

    2008-06-01

    Full Text Available Thermochemical conversion of biomass offers an efficient and economically process to provide gaseous, liquid and solid fuels and prepare chemicals derived from biomass. Computational fluid dynamic (CFD modeling applications on biomass thermochemical processes help to optimize the design and operation of thermochemical reactors. Recent progression in numerical techniques and computing efficacy has advanced CFD as a widely used approach to provide efficient design solutions in industry. This paper introduces the fundamentals involved in developing a CFD solution. Mathematical equations governing the fluid flow, heat and mass transfer and chemical reactions in thermochemical systems are described and sub-models for individual processes are presented. It provides a review of various applications of CFD in the biomass thermochemical process field.

  6. CFD Modeling of Airflow in a Livestock Building

    DEFF Research Database (Denmark)

    Rong, Li; Elhadidi, B.; Khalifa, H. E.;

    2010-01-01

    In this paper, a 2D simulation for a typical livestock building is performed to assess the ammonia emission removal rate to the atmosphere. Two geometry models are used and compared in order to represent the slatted floor. In the first model the floor is modeled as a slatted floor and in the second...... model the traditional porous media is used. The results show that the porous floor modeling over predicts the ammonia emission by a factor of 2 compared to the slatted floor modeling. The results also show different velocity distribution under slatted floor. This suggests that modeling the slatted floor...... the accuracy of the porous jump assumption by comparing the velocity, and ammonia concentration in a 2D simulation, heated solid bodies are added to represent the livestock in the following simulations. The results of simulations with heat source also indicate that modeling the slatted floor with slats...

  7. CFD modelling and wind tunnel validation of airflow through plant canopies using 3D canopy architecture

    International Nuclear Information System (INIS)

    The efficiency of pesticide application to agricultural fields and the resulting environmental contamination highly depend on atmospheric airflow. A computational fluid dynamics (CFD) modelling of airflow within plant canopies using 3D canopy architecture was developed to understand the effect of the canopy to airflow. The model average air velocity was validated using experimental results in a wind tunnel with two artificial model trees of 24 cm height. Mean air velocities and their root mean square (RMS) values were measured on a vertical plane upstream and downstream sides of the trees in the tunnel using 2D hotwire anemometer after imposing a uniform air velocity of 10 m s-1 at the inlet. 3D virtual canopy geometries of the artificial trees were modelled and introduced into a computational fluid domain whereby airflow through the trees was simulated using Reynolds-Averaged Navier-Stokes (RANS) equations and k-ε turbulence model. There was good agreement of the average longitudinal velocity, U between the measurements and the simulation results with relative errors less than 2% for upstream and 8% for downstream sides of the trees. The accuracy of the model prediction for turbulence kinetic energy k and turbulence intensity I was acceptable within the tree height when using a roughness length (y0 = 0.02 mm) for the surface roughness of the tree branches and by applying a source model in a porous sub-domain created around the trees. The approach was applied for full scale orchard trees in the atmospheric boundary layer (ABL) and was compared with previous approaches and works. The simulation in the ABL was made using two groups of full scale orchard trees; short (h = 3 m) with wider branching and long (h = 4 m) with narrow branching. This comparison showed good qualitative agreements on the vertical profiles of U with small local differences as expected due to the spatial disparities in tree architecture. This work was able to show airflow within and above the

  8. Modernization of vertical Pelton turbines with the help of CFD and model testing

    International Nuclear Information System (INIS)

    The modernization of water turbines bears a high potential of increasing the already installed hydropower capacity. In many projects the existing waterways allow a substantial increase of the available flow capacity and with it the energy output. But also the upgrading onto a state of the art hydraulic, mechanical and electrical design will increase the available power considerably after the rehabilitation. The two phase nature of the flow in Pelton turbines requires for the hydraulic refurbishment special care in the application of the available design methods. Where the flow in the high pressure section of the turbine is mainly of one phase nature, CFD has been used as a standard tool for many years. Also the jet quality, and with it the exploration of the source of flow disturbances that cause poor free surface quality can be investigated with CFD. The interaction of the jet with the buckets of the runner is also examined by means of CFD. However, its accuracy with respect to hydraulic efficiency is, because of the two phase flow and the transient flow process, in very few cases good enough for a reliable and accurate prediction of absolute numbers. The optimization of hydraulic bucket profiles is therefore always checked with measurements in homologous scaled model turbines. A similar situation exists for the housing flow after the water is discharged from the runner. Here also CFD techniques are available to explore the general mechanisms. However, due to the two phase flow nature, where only a very small space is filled with moving water, the experimental setup in a model turbine is always the final proof for optimizations of housing inserts and modifications. The hydraulic design of a modernization project for a power station equipped with vertical Pelton turbines of two different designs is described in the proposed paper. It will be shown, how CFD is applied to determine the losses in the high pressure section and how these results are combined with the

  9. Optimization the design of venturi gas mixer for syngas engine using three-dimensional CFD modeling

    International Nuclear Information System (INIS)

    A venturi mixer prototype is developed for mixing air and synthesis gas or 'syngas' as a fuel. Syngas is recognized as a viable energy source worldwide, particularly for stationary power generation. It has a very low energy density, so a mixer with λ (ratio of actual to stoichiometric air-fuel ratio) in the range of 1.1 to 1.7 is expected. In this study, three-dimensional computational fluid dynamics (CFD) modeling is used to investigate and analyze the influence of the throat diameter, gas chamber thickness and gas exits diameter on mixer characteristics and performance. Attention is focused on the effect of venturi mixer geometry on the air-fuel ratio, pressure loss and mixing quality. Based on the numerical results, an optimized design of venturi gas mixer is made. The optimized design has λ in the range of 1.2 to 1.3, and gives very good mixing quality and acceptable pressure loss. The CFD results are validated with experimental data. The CFD results show good agreement with experimental data

  10. Lead pressure loss in the heat exchanger of the ELSY fast lead-cooled reactor by CFD approach

    International Nuclear Information System (INIS)

    In the frame of the ELSY (European lead-cooled system) design proposal for a fast lead-cooled reactor, which should comply with the goals of the 4. generation nuclear power plants, the focus is set on the usage of the possible advantages offered by the lead technology in comparison to lead-bismuth eutectic (LBE). Lead is less expensive, less corrosive and has a smaller radiological emissivity in comparison with LBE. The ELSY project aims at demonstrating the feasibility of a lead fast reactor for energy generation and the identification of solutions for a simple but safe system. In order to properly dimension the reactor and to allow the flow of lead in natural circulation regime, as required by the nuclear accidents scenarios, the knowledge of the lead pressure losses through each component is mandatory. The present paper discusses the pressure loss through the new innovative design proposed for the ELSY spiral heat exchanger (HX). The lack of experimental data for lead flows through heat exchangers, as well as the novelty of the HX design, motivated an approach based on CFD (Computational Fluid Dynamics) analysis. We employed the commercial tool ANSYS CFX and successfully validate the program against theoretical predictions for pressure loss simulations through perforated plates and pipe bundles. The ELSY HX has a cylindrical design and uniformly perforated double inner and double outer walls, as described in [4]. The flow of lead represents the primary circuit, while supercritical water is planned for the secondary circuit of the reactor. The perforations in the walls and in the corresponding companion shells are displaced in a staggered way. About 200 tubes that are arranged vertically in a staggered way are planned for the secondary circuit of one HX. A detailed complete model is not feasible at the actual stage of the design, due to the complex geometry, which has reference elements ranging between 10-3/1 m scales. Therefore, unit slice models consisting of

  11. Modeling HCCI using CFD and Detailed Chemistry with Experimental Validation and a Focus on CO Emissions

    Energy Technology Data Exchange (ETDEWEB)

    Hessel, R; Foster, D; Aceves, S; Flowers, D; Pitz, B; Dec, J; Sjoberg, M; Babajimopoulos, A

    2007-04-23

    Multi-zone CFD simulations with detailed kinetics were used to model engine experiments performed on a diesel engine that was converted for single cylinder, HCCI operation, here using iso-octane as the fuel. The modeling goals were to validate the method (multi-zone combustion modeling) and the reaction mechanism (LLNL 857 species iso-octane), both of which performed very well. The purpose of this paper is to document the validation findings and to set the ground work for further analysis of the results by first looking at CO emissions characteristics with varying equivalence ratio.

  12. CFD Modeling of Non-Neutral Atmospheric Boundary Layer Conditions

    DEFF Research Database (Denmark)

    Koblitz, Tilman

    For wind resource assessment, the wind industry is increasingly relying on Computational Fluid Dynamics models that focus on modeling the airflow in a neutrally stratified surface-layer. Physical processes like the Coriolis force, buoyancy forces and heat transport, that are important to the atmo......For wind resource assessment, the wind industry is increasingly relying on Computational Fluid Dynamics models that focus on modeling the airflow in a neutrally stratified surface-layer. Physical processes like the Coriolis force, buoyancy forces and heat transport, that are important...... to the atmospheric boundary-layer, are mostly ignored so far. In order to decrease the uncertainty of wind resource assessment, the present work focuses on atmospheric flows that include atmospheric stability and the Coriolis effect. Within the present work a RANS model framework is developed and implemented...

  13. A New Integrated Approach for the Prediction of the Load Independent Power Losses of Gears: Development of a Mesh-Handling Algorithm to Reduce the CFD Simulation Time

    Directory of Open Access Journals (Sweden)

    F. Concli

    2016-01-01

    Full Text Available To improve the efficiency of geared transmissions, prediction models are required. Literature provides only simplified models that often do not take into account the influence of many parameters on the power losses. Recently some works based on CFD simulations have been presented. The drawback of this technique is the time demand needed for the computation. In this work a less time-consuming numerical calculation method based on some specific mesh-handling techniques was extensively applied. With this approach the windage phenomena were simulated and compared with experimental data in terms of power loss. The comparison shows the capability of the numerical approach to capture the phenomena that can be observed experimentally. The powerful capabilities of this approach in terms of both prediction accuracy and computational effort efficiency make it a potential tool for an advanced design of gearboxes as well as a powerful tool for further comprehension of the physics behind the gearbox lubrication.

  14. Development and validation of a CFD model predicting the backfill process of a nuclear waste gallery

    Energy Technology Data Exchange (ETDEWEB)

    Gopala, Vinay Ramohalli, E-mail: gopala@nrg.eu [Nuclear Research and consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands); Lycklama a Nijeholt, Jan-Aiso [Nuclear Research and consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands); Bakker, Paul [Van Hattum en Blankevoort, Woerden (Netherlands); Haverkate, Benno [Nuclear Research and consultancy Group (NRG), P.O. Box 25, 1755 ZG Petten (Netherlands)

    2011-07-15

    Research highlights: > This work presents the CFD simulation of the backfill process of Supercontainers with nuclear waste emplaced in a disposal gallery. > The cement-based material used for backfill is grout and the flow of grout is modelled as a Bingham fluid. > The model is verified against an analytical solution and validated against the flowability tests for concrete. > Comparison between backfill plexiglas experiment and simulation shows a distinct difference in the filling pattern. > The numerical model needs to be further developed to include segregation effects and thixotropic behavior of grout. - Abstract: Nuclear waste material may be stored in underground tunnels for long term storage. The example treated in this article is based on the current Belgian disposal concept for High-Level Waste (HLW), in which the nuclear waste material is packed in concrete shielded packages, called Supercontainers, which are inserted into these tunnels. After placement of the packages in the underground tunnels, the remaining voids between the packages and the tunnel lining is filled-up with a cement-based material called grout in order to encase the stored containers into the underground spacing. This encasement of the stored containers inside the tunnels is known as the backfill process. A good backfill process is necessary to stabilize the waste gallery against ground settlements. A numerical model to simulate the backfill process can help to improve and optimize the process by ensuring a homogeneous filling with no air voids and also optimization of the injection positions to achieve a homogeneous filling. The objective of the present work is to develop such a numerical code that can predict the backfill process well and validate the model against the available experiments and analytical solutions. In the present work the rheology of Grout is modelled as a Bingham fluid which is implemented in OpenFOAM - a finite volume-based open source computational fluid dynamics

  15. Development and validation of a CFD model predicting the backfill process of a nuclear waste gallery

    International Nuclear Information System (INIS)

    Research highlights: → This work presents the CFD simulation of the backfill process of Supercontainers with nuclear waste emplaced in a disposal gallery. → The cement-based material used for backfill is grout and the flow of grout is modelled as a Bingham fluid. → The model is verified against an analytical solution and validated against the flowability tests for concrete. → Comparison between backfill plexiglas experiment and simulation shows a distinct difference in the filling pattern. → The numerical model needs to be further developed to include segregation effects and thixotropic behavior of grout. - Abstract: Nuclear waste material may be stored in underground tunnels for long term storage. The example treated in this article is based on the current Belgian disposal concept for High-Level Waste (HLW), in which the nuclear waste material is packed in concrete shielded packages, called Supercontainers, which are inserted into these tunnels. After placement of the packages in the underground tunnels, the remaining voids between the packages and the tunnel lining is filled-up with a cement-based material called grout in order to encase the stored containers into the underground spacing. This encasement of the stored containers inside the tunnels is known as the backfill process. A good backfill process is necessary to stabilize the waste gallery against ground settlements. A numerical model to simulate the backfill process can help to improve and optimize the process by ensuring a homogeneous filling with no air voids and also optimization of the injection positions to achieve a homogeneous filling. The objective of the present work is to develop such a numerical code that can predict the backfill process well and validate the model against the available experiments and analytical solutions. In the present work the rheology of Grout is modelled as a Bingham fluid which is implemented in OpenFOAM - a finite volume-based open source computational fluid

  16. Comparison of Engineering Wake Models with CFD Simulations

    DEFF Research Database (Denmark)

    Andersen, Søren Juhl; Sørensen, Jens Nørkær; Ivanell, S.;

    2014-01-01

    The engineering wake models by Jensen [1] and Frandsen et al. [2] are assessed for different scenarios simulated using Large Eddy Simulation and the Actuator Line method implemented in the Navier-Stokes equations. The scenarios include the far wake behind a single wind turbine, a long row...... of turbines in an atmospheric boundary layer, idealised cases of an infinitely long row of wind turbines and infinite wind farms with three different spacings. Both models include a wake expansion factor, which is calibrated to fit the simulated wake velocities. The analysis highlights physical deficiencies...... in the ability of the models to universally predict the wake velocities, as the expansion factor can be fitted for a given case, but with not apparent transition between the cases....

  17. CFD modeling of pulsatile hemodynamics in the total cavopulmonary connection

    Science.gov (United States)

    Zobaer, S. M. Tareq; Hasan, A. B. M. Toufique

    2016-07-01

    Total cavopulmonary connection is a blood flow pathway which is created surgically by an operation known as Fontan procedure, performed on children with single ventricle heart defects. Recent studies have shown that the hemodynamics in the connection can be strongly influenced by the presence of pulsatile flow. The aim of this paper is model the pulsatile flow patterns, and to calculate the vorticity field and power losses in an idealized 1.5D offset model of Total Cavopulmonary Connection. A three-dimensional polyhedral mesh was constructed for the numerical simulation. The rheological properties of blood were considered as Newtonian, and flow in the connection was assumed to be laminar. The results demonstrated complex flow patterns in the connection. The outcomes of the simulation showed reasonable agreement with the results available in the literature for a similar model.

  18. Comparison of Engineering Wake Models with CFD Simulations

    Science.gov (United States)

    Andersen, S. J.; Sørensen, J. N.; Ivanell, S.; Mikkelsen, R. F.

    2014-06-01

    The engineering wake models by Jensen [1] and Frandsen et al. [2] are assessed for different scenarios simulated using Large Eddy Simulation and the Actuator Line method implemented in the Navier-Stokes equations. The scenarios include the far wake behind a single wind turbine, a long row of turbines in an atmospheric boundary layer, idealised cases of an infinitely long row of wind turbines and infinite wind farms with three different spacings. Both models include a wake expansion factor, which is calibrated to fit the simulated wake velocities. The analysis highlights physical deficiencies in the ability of the models to universally predict the wake velocities, as the expansion factor can be fitted for a given case, but with not apparent transition between the cases.

  19. CFD Modelling of Flow and Solids Distribution in Carbon-in-Leach Tanks

    Directory of Open Access Journals (Sweden)

    Divyamaan Wadnerkar

    2015-10-01

    Full Text Available The Carbon-in-Leach (CIL circuit plays an important role in the economics of a gold refinery. The circuit uses multiphase stirred tanks in series, in which problems such as dead zones, short-circuiting, and presence of unsuspended solids are detrimental to its efficiency. Therefore, the hydrodynamics of such a system is critical for improving the performance. The hydrodynamics of stirred tanks can be resolved using computational fluid dynamics (CFD. While the flow generated by the impellers in the CIL tanks is complex and modelling it in the presence of high solid concentration is challenging, advances in CFD models, such as turbulence and particle-fluid interactions, have made modelling of such flows feasible. In the present study, the hydrodynamics of CIL tanks was investigated by modelling it using CFD. The models used in the simulations were validated using experimental data at high solid loading of 40 wt. % in a lab scale tank. The models were further used for examining the flow generated by pitched blade turbine and HA-715 Mixtec impellers in lab scale CIL tanks with 50 wt. % solids. The effect of design and operating parameters such as off-bottom clearance, impeller separation, impeller speed, scale-up, and multiple-impeller configuration on flow field and solid concentrations profiles was examined. For a given impeller speed, better solids suspension is observed with dual impeller and triple impeller configurations. The results presented in the paper are useful for understanding the hydrodynamics and influence of design and operating parameters on industrial CIL tanks.

  20. Multiphase CFD modeling of nearfield fate of sediment plumes

    DEFF Research Database (Denmark)

    Saremi, Sina; Hjelmager Jensen, Jacob

    2014-01-01

    . The two-phase mixture solution based on the drift-flux method is evaluated for 3D simulation of material disposal and overflow discharge from the hoppers. The model takes into account the hindrance and resistance mechanisms in the mixture and is capable of describing the flow details within the plumes...

  1. CFD-modelling of natural convection in a groundwater-filled borehole heat exchanger

    OpenAIRE

    Gustafsson, A-M.; Westerlund, L.; Hellström, G.

    2009-01-01

    Abstract In design of ground-source energy systems the thermal erformance of the borehole heat exchangers is important. In Scandinavia, boreholes are usually not grouted but left with groundwater to fill the space between heat exchanger pipes and borehole wall. The common U-pipe arrangement in a groundwater-filled BHE has been studied by a three-dimensional, steady-state CFD model. The model consists of a three meter long borehole containing a single U-pipe with surrounding bedrock...

  2. Decompression wave speed in CO2 mixtures: CFD modelling with the GERG-2008 equation of state

    International Nuclear Information System (INIS)

    Highlights: • CFD models for decompression simulation of CO2 mixtures. • Incorporation of GERG-2008 EOS into CFD code for decompression modelling. • Predicted decompression wave speed validated by measurements. • Studies of effects of initial temperature and impurities on decompression wave speed. - Abstract: The development of CO2 pipelines for Carbon Capture and Storage (CCS) raises new questions regarding the control of ductile fracture propagation and fracture arrest toughness criteria. The decompression behaviour in the fluid must be determined accurately in order to estimate the proper pipe toughness. However, anthropogenic CO2 may contain impurities that can modify the fluid decompression characteristics quite significantly. To determine the decompression wave speed in CO2 mixtures, the thermodynamic properties of these mixtures must be determined by using an accurate equation of state. In this paper we present a new decompression model developed using the Computational Fluid Dynamics (CFD) package ANSYS Fluent. The GERG-2008 Equation of State (EOS) was implemented into this model through User Defined Functions (UDF) to predict the thermodynamic properties of CO2 mixtures. The model predictions were in good agreement with the experimental data of two ‘shock tube’ tests. A range of representative CO2 mixtures was examined in terms of the changes in fluid properties from the initial conditions, with time and distance, immediately after a sudden pipeline opening at one end. Phase changes that may occur within the fluid due to condensation of ‘impurities’ in the fluid were also investigated. Simulations were also conducted to examine how the initial temperature and impurities would affect the decompression wave speed

  3. Modeling strategies to compute natural circulation using CFD in a VHTR after a LOFA

    International Nuclear Information System (INIS)

    Highlights: • CFD analysis was performed of natural circulation in a block VHTR after a loss of flow accident. • Multiple strategies were investigated to perform CFD analysis to estimate strength of natural circulation. • Symmetry considerations allowed fine mesh application of CFD to reactor core. • Results extrapolated to whole core to estimate heat loss due to natural circulation. • CFD shows promise for use in nuclear reactor design and analysis. - Abstract: A prismatic gas-cooled very high temperature reactor (VHTR) is being developed under the next generation nuclear plant program (NGNP) of the U.S. Department of Energy, Office of Nuclear Energy. In the design of the prismatic VHTR, hexagonal shaped graphite blocks are drilled to allow insertion of fuel pins, made of compacted tristructural-isotropic (TRISO) fuel particles, and coolant channels for the helium coolant. One of the concerns for the reactor design is the effects of a loss of flow accident (LOFA) where the coolant circulators are lost for some reason, causing a loss of forced coolant flow through the core. In such an event, it is desired to know what happens to the (reduced) heat still being generated in the core and if it represents a problem for the fuel compacts, the graphite core or the reactor vessel (RV) walls. One of the mechanisms for the transport of heat out of the core is by the natural circulation of the coolant, which is still present. It is desired to know how much heat may be transported by natural circulation through the core and upwards to the top of the upper plenum. It is beyond current capability for a computational fluid dynamics (CFD) analysis to perform a calculation on the whole RV with a sufficiently refined mesh to examine the full potential of natural circulation in the vessel. The present paper reports the investigation of several strategies to model the flow and heat transfer in the RV. It is found that it is necessary to employ representative geometries of

  4. Assessment of Nucleation Site Density Models for CFD Simulations of Subcooled Flow Boiling

    International Nuclear Information System (INIS)

    The framework of a CFD simulation of subcooled flow boiling basically includes a block of wall boiling models communicating with governing equations of a two-phase flow via parameters like temperature, rate of phasic change, etc. In the block of wall boiling models, a heat flux partitioning model, which describes how the heat is taken away from a heated surface, is combined with models quantifying boiling parameters, i.e. nucleation site density, and bubble departure diameter and frequency. It is realized that the nucleation site density is an important parameter for predicting the subcooled flow boiling. The number of nucleation sites per unit area decides the influence region of each heat transfer mechanism. The variation of the nucleation site density will mutually change the dynamics of vapor bubbles formed at these sites. In addition, the nucleation site density is needed as one initial and boundary condition to solve the interfacial area transport equation. A lot of effort has been devoted to mathematically formulate the nucleation site density. As a consequence, numerous correlations of the nucleation site density are available in the literature. These correlations are commonly quite different in their mathematical form as well as application range. Some correlations of the nucleation site density have been applied successfully to CFD simulations of several specific subcooled boiling flows, but in combination with different correlations of the bubble departure diameter and frequency. In addition, the values of the nucleation site density, and bubble departure diameter and frequency obtained from simulations for a same problem are relatively different, depending on which models are used, even when global characteristics, e.g., void fraction and mean bubble diameter, agree well with experimental values. It is realized that having a good CFD simulations of the subcooled flow boiling requires a detailed validations of all the models used. Owing to the importance

  5. Calculation and design of tunnel ventilation systems using a two-scale modelling approach

    OpenAIRE

    Colella, Francesco; Rein, Guillermo; Borchiellini, Romano; Carvel, Ricky O; Torero, Jose L; Verda, Vittorio

    2009-01-01

    This paper develops a novel modelling approach for ventilation flow in tunnels at ambient conditions (i.e. cold flow). The complexity of full CFD models of low in tunnels or the inaccuracies of simplistic assumptions are avoided by efficiently combining a simple, mono-dimensional approach to model tunnel regions where the flow is fully developed, with detailed CFD solutions where flow conditions require 3D resolution. This multiscale method has not previously been applied to tunnel flows. ...

  6. QM-400 CFD 自然对流模型研究及验证%Research and Validation on CFD Natural Convection Model of QM-400

    Institute of Scientific and Technical Information of China (English)

    左巧林; 干富军; 朱丽兵

    2016-01-01

    The spent fuel dry storage facility named QM-400 module for Third Qinshan Nuclear Power Co.Ltd.(TQNPC)is the first commercial dry storage facility in opera-tion in China.The heat transfer in QM-400 mainly consists of natural convention,con-duction,conjugate heat transfer and radiation,etc.The decay heat of each fuel basket was calculated accurately at typical surrounding temperature.Mesh sensitivity analysis was performed using commercial computational fluid dynamics (CFD)code FLUENT 14.0. A set of CFD simulation models on natural convection of QM-400 were developed.The results show that the distributions of the pressure and temperature on the cylinder sur-face meet the rules of natural convection.Good agreements are achieved between the simulated temperature and the measured temperature at the measured points and the simulated temperature trend varying with surrounding temperature agree well with the measured trend,which demonstrates the correctness of the calculation method of natural convection in this paper.This work can be the reference of the further CFD simulation on temperature distributions of dry storage facility without thermal insulation panels.%秦山第三核电厂乏燃料干式贮存模块 QM-400是我国第一座投入商业运行的干式贮存设施,模块内的热量交换主要包括自然对流、热传导、耦合传热和辐射换热等。本文精确计算了典型环境温度下每个燃料篮的衰变热,运用商用计算流体动力学(CFD)软件 FLUENT 14.0开展了网格敏感性分析,并建立了 QM-400存储模块的自然对流 CFD 分析模型。结果表明,模块顶面、侧面以及贮存筒表面压力和温度分布符合自然对流规律,计算的测点温度与现场的实测温度符合良好,测点温度随环境温度的变化趋势也与实测趋势符合良好,证明了建立的 CFD 自然对流计算方法的正确性。本文结果为后续采用CFD 方法进行取消绝热板后的温度场计算奠定了基础。

  7. Bonneville Powerhouse 2 Fish Guidance Efficiency Studies: CFD Model of the Forebay

    Energy Technology Data Exchange (ETDEWEB)

    Rakowski, Cynthia L.; Serkowski, John A.; Richmond, Marshall C.

    2012-07-01

    In ongoing work, U.S. Army Corps of Engineers, Portland District (CENWP) is seeking to better understand and improve the conditions within the Bonneville Powerhouse 2 (B2) turbine intakes to improve survival of downstream migrant salmonid smolt. In this study, the existing B2 forebay computational fluid dynamics (CFD) model was modified to include a more detailed representation of all B2 turbine intakes. The modified model was validated to existing field-measured forebay ADCP velocities. The initial CFD model scenarios tested a single project operation and the impact of adding the Behavior Guidance System (BGS) or Corner Collector. These structures had impacts on forebay flows. Most notable was that the addition of the BGS and Corner Collector reduced the lateral extent of the recirculation areas on the Washington shore and Cascade Island and reduced the flow velocity parallel to the powerhouse in front of Units 11 and 12. For these same cases, at the turbine intakes across the powerhouse, there was very little difference in the flow volume into the gatewell for the clean forebay, and the forebay with the BGS in place and/or the Corner Collector operating. The largest differences were at Units 11 to 13. The CFD model cases testing the impact of the gatewell slot fillers showed no impact to the forebay flows, but large differences within the gatewells. With the slot fillers, the flow above the standard traveling screen and into the gatewell increased (about 100 cfs at each turbine intake) and the gap flow decreased across the powerhouse for all cases. The increased flow up the gatewell was further enhanced with only half the units operating. The flow into the gatewell slot was increased about 35 cfs for each bay of each intake across the powerhouse; this change was uniform across the powerhouse. The flows in the gatewell of Unit 12, the most impacted unit for the scenarios, was evaluated. In front of the vertical barrier screen, the CFD model with slot fillers

  8. A two-dimensional CFD model of a refrigerated display case

    Energy Technology Data Exchange (ETDEWEB)

    Stribling, D.; Tassou, S.A. [Brunel Univ., Uxbridge (United Kingdom). Dept. of Mechanical Engineering; Marriott, D. [Safeway Stores plc, Middlesex (United Kingdom)

    1997-12-31

    The discomfort caused by the cold air overspill from vertical refrigerated display cases in supermarkets is widely accepted as being a problem to customers. This, together with the adverse effect on case performance caused by heat and moisture transfer across the air curtain, suggests that there may be room for improvement in the design and fundamental operation of these display fixtures. This paper presents a two-dimensional computational fluid dynamics (CFD) model of a vertical dairy display case that could be used in the design and optimization of such equipment. Comparisons are also made with experimentally obtained values of velocity and temperature measured around the case in order to assess the accuracy and viability of such a model. Parameters of the computer model, such as the size of the calculation grid, the turbulence model, and the discretization scheme, were also varied to determine their effect on the converged solution, and these results are presented. The CFD model showed good qualitative agreement with measured values and requires only fine tuning to make it quantitatively accurate.

  9. CFD simulation of aerosol deposition in an anatomically based human large-medium airway model.

    Science.gov (United States)

    Ma, Baoshun; Lutchen, Kenneth R

    2009-02-01

    Quantitative data on aerosol deposition in the human respiratory tract are useful for understanding the causes of certain lung diseases and for designing efficient drug delivery systems via inhalation. In this study, aerosol deposition in a 3D anatomically based human large-medium airway model was simulated using computational fluid dynamics (CFD). The model extended from mouth to generation 10 and included two-thirds of the airways obtained by multi-detector row computed tomography (MDCT) imaging on normal healthy human subjects. Steady oral inhalation (15, 30, and 60 L/min) and aerosol (1-30 micrometer) deposition were computed by CFD using the realizable k-epsilon turbulence model. Based on the mean turbulence flow field, the computed extrathoracic deposition, ratio of left to right lung deposition, and deposition efficiency at each generation compared favorably with existing in vivo and in vitro experiments. The significant deposition in the large-medium airway model showed that the total tracheobronchial deposition is dominated by the large-medium airways for micrometer-sized aerosol particles. These quantitative data and the methods developed in this study provided valuable means toward subject-specific modeling of aerosol deposition in the human lung based on realistic lung geometry. PMID:19082892

  10. A hydrodynamics-reaction kinetics coupled model for evaluating bioreactors derived from CFD simulation.

    Science.gov (United States)

    Wang, Xu; Ding, Jie; Guo, Wan-Qian; Ren, Nan-Qi

    2010-12-01

    Investigating how a bioreactor functions is a necessary precursor for successful reactor design and operation. Traditional methods used to investigate flow-field cannot meet this challenge accurately and economically. Hydrodynamics model can solve this problem, but to understand a bioreactor in sufficient depth, it is often insufficient. In this paper, a coupled hydrodynamics-reaction kinetics model was formulated from computational fluid dynamics (CFD) code to simulate a gas-liquid-solid three-phase biotreatment system for the first time. The hydrodynamics model is used to formulate prediction of the flow field and the reaction kinetics model then portrays the reaction conversion process. The coupled model is verified and used to simulate the behavior of an expanded granular sludge bed (EGSB) reactor for biohydrogen production. The flow patterns were visualized and analyzed. The coupled model also demonstrates a qualitative relationship between hydrodynamics and biohydrogen production. The advantages and limitations of applying this coupled model are discussed. PMID:20727741

  11. Validation of a CFD model simulating charge and discharge of a small heat storage test module based on a sodium acetate water mixture

    DEFF Research Database (Denmark)

    Dannemand, Mark; Fan, Jianhua; Furbo, Simon;

    2014-01-01

    Computational Fluid Dynamics (CFD) model. The CFD calculated temperatures are compared to measured temperatures internally in the box to validate the CFD model. Four cases are investigated; heating the test module with the sodium acetate water mixture in solid phase from ambient temperature to 52˚C; heating the...... the crystallization, ending at ambient temperature with the sodium acetate water mixture in solid phase. Comparisons have shown reasonable good agreement between experimental measurements and theoretical simulation results for the investigated scenarios....

  12. CFD model simulation of dispersion from chlorine railcar releases in industrial and urban areas

    Science.gov (United States)

    Hanna, Steven R.; Hansen, Olav R.; Ichard, Mathieu; Strimaitis, David

    To assist in emergency response decisions and planning in case of releases of pressurized liquefied chlorine from railroad tank cars in industrial sites and cities, the FLACS Computational Fluid Dynamics (CFD) model has been used to simulate the transport and dispersion of the dense chlorine cloud. Two accident locations are studied: an actual railcar accident at an industrial site in Festus, MO, and a hypothetical railcar accident at a rail junction in the Chicago urban area. The results show that transport of a large dense gas release at ground level in an industrial site or large city could initially extend a hundred meters or more in the upwind and crosswind directions. The dense cloud may follow terrain drainage, such as river channels. Near the source, the obstacles tend to slow down the dense gas cloud and may constrain it and cause increased concentrations. Farther downwind, the obstacles may cause enhanced mixing and dilution once the cloud has grown larger. In some cases, significant amounts of cloud mass may become "trapped" in obstacle wakes for many minutes after the main cloud has passed. Although the CFD model can account for the details of the flow and dispersion much better than standard widely-used simple dense gas models, many similarities are found among the various models in their simulated variations with downwind distance of the maximum cloud centerline concentration.

  13. Wind Loads on Ships and Offshore Structures Determined by Model Tests, CFD and Full-Scale Measurements

    DEFF Research Database (Denmark)

    Aage, Christian

    1998-01-01

    be validated systematically against full-scale measurements, but due to the great practical difficulties involved, this is almost never done. In this investigation, wind loads on a seagoing ferry and on a semisubmersible platform have been determined by model tests and by CFD. On the ferry, full......Wind loads on ships and offshore structures have until recently been determined only by model tests, or by statistical methods based on model tests. By the development of Computational Fluid Dynamics or CFD there is now a realistic computational alternative. In principle, both methods should......-scale measurements have been carried out as well. The CFD method also offers the possibility of a computational estimate of scale effects related to wind tunnel model testing. An example of such an estimate on the ferry is discussed. This work has been published in more details in Proceedings of BOSS'97, Aage et al...

  14. Validating CFD Models of Multiphase Mixing in the Waste Treatment Plant at the Hanford Site

    International Nuclear Information System (INIS)

    The Columbia River in Washington State is threatened by the radioactive legacy of the cold war. Two hundred thousand cubic meters (fifty-three million US gallons) of radioactive waste is stored in 177 underground tanks (60% of the Nation's radioactive waste). A vast complex of waste treatment facilities is being built to convert this waste into stable glass (vitrification). The waste in these underground tanks is a combination of sludge, slurry, and liquid. The waste will be transported to a pre-treatment facility where it will be processed before vitrification. It is necessary to keep the solids in suspension during processing. The mixing devices selected for this task are known as pulse-jet mixers (PJMs). PJMs cyclically empty and refill with the contents of the vessel to keep it mixed. The transient operation of the PJMs has been proven successful in a number of applications, but needs additional evaluation to be proven effective for the slurries and requirements at the Waste Treatment Plant (WTP). Computational fluid dynamic (CFD) models of mixing vessels have been developed to demonstrate the ability of the PJMs to meet mixing criteria. Experimental studies have been performed to validate these models. These tests show good agreement with the transient multiphase CFD models developed for this engineering challenge. (authors)

  15. Propulsion Simulations Using Advanced Turbulence Models with the Unstructured Grid CFD Tool, TetrUSS

    Science.gov (United States)

    Abdol-Hamid, Khaled S.; Frink, Neal T.; Deere, Karen A.; Pandya, Mohangna J.

    2004-01-01

    A computational investigation has been completed to assess the capability of TetrUSS for exhaust nozzle flows. Three configurations were chosen for this study (1) an axisymmetric supersonic jet, (2) a transonic axisymmetric boattail with solid sting operated at different Reynolds number and Mach number, and (3) an isolated non-axisymmetric nacelle with a supersonic cruise nozzle. These configurations were chosen because existing experimental data provided a means for measuring the ability of TetrUSS for simulating complex nozzle flows. The main objective of this paper is to validate the implementation of advanced two-equation turbulence models in the unstructured-grid CFD code USM3D for propulsion flow cases. USM3D is the flow solver of the TetrUSS system. Three different turbulence models, namely, Menter Shear Stress Transport (SST), basic k epsilon, and the Spalart-Allmaras (SA) are used in the present study. The results are generally in agreement with other implementations of these models in structured-grid CFD codes. Results indicate that USM3D provides accurate simulations for complex aerodynamic configurations with propulsion integration.

  16. Evaluation of source model coupled computational fluid dynamics (CFD) simulation of the dispersion of airborne contaminants in a work environment.

    Science.gov (United States)

    Salim, S M; Viswanathan, Shekar; Ray, Madhumita Bhowmick

    2006-12-01

    Dispersion of airborne contaminants in indoor air was evaluated employing physical measurement, empirical models, and computer simulation methods. Field data collected from a tray of evaporating solvent in the laboratory were compared with computational fluid dynamics (CFD) simulations coupled with evaporation models. The results indicated that mathematical models of evaporation can be coupled with CFD simulations to produce reasonable qualitative predictions of airborne contaminant levels. The airflow pattern within a room is primarily determined by the room layout and the position of the air supply diffusers. Variations in ventilation rate did not alter the airflow pattern, thus generating a characteristic concentration profile of the airborne contaminants. PMID:17050350

  17. Validation of a loss of vacuum accident (LOVA) Computational Fluid Dynamics (CFD) model

    Energy Technology Data Exchange (ETDEWEB)

    Bellecci, C.; Gaudio, P. [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy); Lupelli, I., E-mail: ivan.lupelli@uniroma2.it [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy); Malizia, A. [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy); Porfiri, M.T. [ENEA Nuclear Fusion Tecnologies, Via Enrico Fermi, 45 I-00044 Frascati (Italy); Quaranta, R.; Richetta, M. [EURATOM-Faculty of Engineering, University of Rome ' Tor Vergata' Via del Politecnico 1, 00133 Rome (Italy)

    2011-10-15

    Intense thermal loads in fusion devices occur during plasma disruptions, Edge Localized Modes (ELM) and Vertical Displacement Events (VDE). They will result in macroscopic erosion of the plasma facing materials and consequent accumulation of activated dust into the ITER Vacuum Vessel (VV). A recognized safety issue for future fusion reactors fueled with deuterium and tritium is the generation of sizeable quantities of dust. In case of LOVA, air inlet occurs due to the pressure difference between the atmospheric condition and the internal condition. It causes mobilization of the dust that can exit the VV threatening public safety because it may contain tritium, may be radioactive from activation products, and may be chemically reactive and/or toxic (Sharpe et al.; Sharpe and Humrickhouse). Several experiments have been conducted with STARDUST facility in order to reproduce a low pressurization rate (300 Pa/s) LOVA event in ITER due to a small air leakage for two different positions of the leak, at the equatorial port level and at the divertor port level, in order to evaluate the velocity magnitude in case of a LOVA that is strictly connected with dust mobilization phenomena. A two-dimensional (2D) modelling of STARDUST, made with the CFD commercial code FLUENT, has been carried out. The results of these simulations were compared against the experimental data for CFD code validation. For validation purposes, the CFD simulation data were extracted at the same locations as the experimental data were collected. In this paper, the authors present and discuss the computer-simulation data and compare them with data collected during the laboratory studies at the University of Rome 'Tor Vergata' Quantum Electronics and Plasmas lab.

  18. An integral CFD approach for the thermal simulation of the PBMR reactor unit

    OpenAIRE

    Kleingeld, Marius; Janse van Rensburg, Jacobus Johannes

    2011-01-01

    A CFD method was developed to conduct integral thermal reactor analysis for the complete Reactor Unit of the Pebble Bed Modular Reactor (Pty) Ltd (PBMR). The requirement was however also to include very detailed aspects such as leakage and bypass flow paths through the reflector blocks and sleeves. The aim was therefore to investigate the influence of leakage and bypass flow on the thermal performance of the Reactor Unit in an integral fashion. The focus of this paper is to discuss the method...

  19. CFD Modelling of Biomass Combustion in Small-Scale Boilers. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Xue-Song Bai; Griselin, Niklas; Klason, Torbern; Nilsson, Johan [Lund Inst. of Tech. (Sweden). Dept. of Heat and Power Engineering

    2002-10-01

    This project deals with CFD modeling of combustion of wood in fixed bed boilers. A flamelet model for the interaction between turbulence and chemical reactions is developed and applied to study small-scale boiler. The flamelet chemistry employs 43 reactive species and 174 elementary reactions. It gives detailed distributions of important species such as CO and NO{sub x} in the flow field and flue gas. Simulation of a small-scale wood fired boiler measured at SP Boraas (50 KW) shows that the current flamelet model yields results agreeable to the available experimental data. A detailed chemical kinetic model is developed to study the bed combustion process. This model gives boundary conditions for the CFD analysis of gas phase volatile oxidation in the combustion chambers. The model combines a Functional Group submodel with a Depolymerisation, Vaporisation and Crosslinking submodel. The FG submodel simulates how functional groups decompose and form light gas species. The DVC submodell predicts depolymerisation and vaporisation of the macromolecular network and this includes bridge breaking and crosslinking processes, where the wood structure breaks down to fragments. The light fragments form tar and the heavy ones form metaplast. Two boilers firing wood log/chips are studied using the FG-DVC model, one is the SP Boraas small-scale boiler (50 KW) and the other is the Sydkraft Malmoe Vaerme AB's Flintraennan large-scale boiler (55 MW). The fix bed is assumed to be two zones, a partial equilibrium drying/devolatilisation zone and an equilibrium zone. Three typical biomass conversion modes are simulated, a lean fuel combustion mode, a near-stoichiometric combustion and a fuel rich gasification mode. Detailed chemical species and temperatures at different modes are obtained. Physical interpretation is provided. Comparison of the computational results with experimental data shows that the model can reasonably simulate the fixed bed biomass conversion process. CFD

  20. CFD Recombiner Modelling and Validation on the H2-Par and Kali-H2 Experiments

    Directory of Open Access Journals (Sweden)

    Stéphane Mimouni

    2011-01-01

    Full Text Available A large amount of Hydrogen gas is expected to be released within the dry containment of a pressurized water reactor (PWR, shortly after the hypothetical beginning of a severe accident leading to the melting of the core. According to local gas concentrations, the gaseous mixture of hydrogen, air and steam can reach the flammability limit, threatening the containment integrity. In order to prevent mechanical loads resulting from a possible conflagration of the gas mixture, French and German reactor containments are equipped with passive autocatalytic recombiners (PARs which preventively oxidize hydrogen for concentrations lower than that of the flammability limit. The objective of the paper is to present numerical assessments of the recombiner models implemented in CFD solvers NEPTUNE_CFD and Code_Saturne. Under the EDF/EPRI agreement, CEA has been committed to perform 42 tests of PARs. The experimental program named KALI-H2, consists checking the performance and behaviour of PAR. Unrealistic values for the gas temperature are calculated if the conjugate heat transfer and the wall steam condensation are not taken into account. The combined effects of these models give a good agreement between computational results and experimental data.

  1. A 2.5D Single Passage CFD Model for Centrifugal Pumps

    Science.gov (United States)

    Nakamura S.; Ding, W.; Yano, K.

    1998-01-01

    This paper describes the single passage model based on CFD to analyze the flow in blade passages of a centrifugal pump. The model consists of the flow passage between two impeller blades and the spaces in the inlet eye as well as in the volute. The incompressible Navier-Stokes equations in the conservation form are solved by a finite difference method. The code is designed to investigate the velocity and pressure distributions and intended to investigate how the pump design affects fluid flow through the rotor as well as the pump performance. An early part of the paper investigates the behavior of the model as well as validity of the assumptions made in the model. Then, applications to a rotodynamic heart pump are presented.

  2. Coarse Grid CFD for underresolved simulation

    Science.gov (United States)

    Class, Andreas G.; Viellieber, Mathias O.; Himmel, Steffen R.

    2010-11-01

    CFD simulation of the complete reactor core of a nuclear power plant requires exceedingly huge computational resources so that this crude power approach has not been pursued yet. The traditional approach is 1D subchannel analysis employing calibrated transport models. Coarse grid CFD is an attractive alternative technique based on strongly under-resolved CFD and the inviscid Euler equations. Obviously, using inviscid equations and coarse grids does not resolve all the physics requiring additional volumetric source terms modelling viscosity and other sub-grid effects. The source terms are implemented via correlations derived from fully resolved representative simulations which can be tabulated or computed on the fly. The technique is demonstrated for a Carnot diffusor and a wire-wrap fuel assembly [1]. [4pt] [1] Himmel, S.R. phd thesis, Stuttgart University, Germany 2009, http://bibliothek.fzk.de/zb/berichte/FZKA7468.pdf

  3. Design of a decay tank for a pool type research reactor with a CFD model

    International Nuclear Information System (INIS)

    A conceptual primary cooling system (PCS) was designed for adequate cooling of the core of a research reactor. The primary coolant after passing through the reactor core contains many kinds of radio-nuclides. A decay tank provides a delayed transit time to ensure that the N-16 activity decreases enough before the coolant leaves the decay tank's shielding room. The size of the decay tank should be enlarged to provide sufficient transit time. However, there was a limitation: to minimize the tank size, it should be designed with an internal baffle, which affects the pressure loss in the system and net positive suction head (NPSH) of the PCS pump. Therefore, the decay tank should be optimized for size and the internal baffle. A vertical type decay tank was chosen to optimize the geometrical arrangement of PCS and the vertical internal baffle was installed to minimize the number of internal structures. The preliminary geometry of the tank and the internal baffle were determined to satisfy the required delayed transit time by calculating the maximum velocity and the flow path length of the circular and the annular sections of the tank. The commercially available CFD model, FLUENT, which solves the Navier-Stokes and turbulent models, was used to specifically design the decay tank with the preliminarily calculated geometry and the related flow rate. Several turbulence models, standard k-ε model, renormalization group (RNG) model, and realizable k-ε model, were conducted to isolate the root cause of these differences. By comparing the results of the velocity profile and the characteristics of each model, a detailed design study was simulated using the realizable k-ε model. A user-defined scalar equation was solved to estimate the delayed transit time. The size and the internal baffle that satisfy the required transit time were determined based on the CFD results. (author)

  4. Geometry optimization of a fibrous scaffold based on mathematical modelling and CFD simulation of adynamic cell culture

    DEFF Research Database (Denmark)

    Tajsoleiman, Tannaz; J. Abdekhodaie, Mohammad; Gernaey, Krist;

    2016-01-01

    the main bottlenecks in this type of processes. In this regard, mathematical modelling and computational fluid dynamics simulation (CFD) are powerful tools to identify an efficient and optimized design by providing reliable insights of the process. This study presents a mathematical model and CFD...... simulation of cartilage cell culture under a perfusion flow, which allows not only to characterize the supply of nutrients and metabolic products inside a fibrous scaffold, but also to assess the overall culture condition and predict the cell growth rate. Afterwards, the simulation results supported finding...

  5. VERIFICATION OF SMOM AND QMOM POPULATION BALANCE MODELING IN CFD CODE USING ANALYTICAL SOLUTIONS FOR BATCH PARTICULATE PROCESSES

    Institute of Scientific and Technical Information of China (English)

    Bin Wan; Terry A.Ring

    2006-01-01

    For many processes of industrial significance, due to the strong coupling between particle interactions and fluid dynamics, the population balance must be solved as part of a computational fluid dynamics (CFD) simulation. In this work, a CFD based population balance model is tested using a batch crystallization reactor. In this CFD model, the population balance is solved by the standard method of moments (SMOM) and the quadrature method of moments (QMOM). The results of these simulations are compared to analytical solutions for the population balance in a batch tank where 1) nucleation, 2) growth, 3) aggregation, and 4) breakage are taking place separately. The results of these comparisons show that the first 6 moments of the population balance are accurately predicted for nucleation, growth, aggregation and breakage at all times.

  6. Implementation of CFD modeling in the performance assessment and optimization of secondary clarifiers: the PVSC case study.

    Science.gov (United States)

    Xanthos, S; Ramalingam, K; Lipke, S; McKenna, B; Fillos, J

    2013-01-01

    The water industry and especially the wastewater treatment sector has come under steadily increasing pressure to optimize their existing and new facilities to meet their discharge limits and reduce overall cost. Gravity separation of solids, producing clarified overflow and thickened solids underflow has long been one of the principal separation processes used in treating secondary effluent. Final settling tanks (FSTs) are a central link in the treatment process and often times act as the limiting step to the maximum solids handling capacity when high throughput requirements need to be met. The Passaic Valley Sewerage Commission (PVSC) is interested in using a computational fluid dynamics (CFD) modeling approach to explore any further FST retrofit alternatives to sustain significantly higher plant influent flows, especially under wet weather conditions. In detail there is an interest in modifying and/or upgrading/optimizing the existing FSTs to handle flows in the range of 280-720 million gallons per day (MGD) (12.25-31.55 m(3)/s) in compliance with the plant's effluent discharge limits for total suspended solids (TSS). The CFD model development for this specific plant will be discussed, 2D and 3D simulation results will be presented and initial results of a sensitivity study between two FST effluent weir structure designs will be reviewed at a flow of 550 MGD (∼24 m(3)/s) and 1,800 mg/L MLSS (mixed liquor suspended solids). The latter will provide useful information in determining whether the existing retrofit of one of the FSTs would enable compliance under wet weather conditions and warrants further consideration for implementing it in the remaining FSTs.

  7. Development of an unresolved CFD-DEM model for the flow of viscous suspensions and its application to solid-liquid mixing

    Science.gov (United States)

    Blais, Bruno; Lassaigne, Manon; Goniva, Christoph; Fradette, Louis; Bertrand, François

    2016-08-01

    Although viscous solid-liquid mixing plays a key role in the industry, the vast majority of the literature on the mixing of suspensions is centered around the turbulent regime of operation. However, the laminar and transitional regimes face considerable challenges. In particular, it is important to know the minimum impeller speed (Njs) that guarantees the suspension of all particles. In addition, local information on the flow patterns is necessary to evaluate the quality of mixing and identify the presence of dead zones. Multiphase computational fluid dynamics (CFD) is a powerful tool that can be used to gain insight into local and macroscopic properties of mixing processes. Among the variety of numerical models available in the literature, which are reviewed in this work, unresolved CFD-DEM, which combines CFD for the fluid phase with the discrete element method (DEM) for the solid particles, is an interesting approach due to its accurate prediction of the granular dynamics and its capability to simulate large amounts of particles. In this work, the unresolved CFD-DEM method is extended to viscous solid-liquid flows. Different solid-liquid momentum coupling strategies, along with their stability criteria, are investigated and their accuracies are compared. Furthermore, it is shown that an additional sub-grid viscosity model is necessary to ensure the correct rheology of the suspensions. The proposed model is used to study solid-liquid mixing in a stirred tank equipped with a pitched blade turbine. It is validated qualitatively by comparing the particle distribution against experimental observations, and quantitatively by compairing the fraction of suspended solids with results obtained via the pressure gauge technique.

  8. Actuator forces in CFD: RANS and LES modeling in OpenFOAM

    International Nuclear Information System (INIS)

    Wind turbine wakes are a very challenging topic for scientific computations, but modern CFD frameworks and latest HPC centers allow setting up numerical computations on the wake induced by the wind turbine. The main issues is that the correct modeling of the wake is related to the correct modeling of the interaction between the blade and the incoming flow. The aim of the proposed work is to estimate the aerodynamic forces acting on the blades in order to correctly generate the rotor wake applying equivalent aerodynamic force source on the flow. The definition of a blade forces is done developing a model able to correctly estimate this aerodynamic forces as a function of the local flow seen by the blade during its revolution

  9. CFD Model of Dense Gas-solid Systems in Jetting Fl uidized Beds

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A CFD code has been developed based on the conservation principles describing gas and solid flow in fluidized beds. This code is employed to simulate not only the spatiotemporal gas- and solid-phase velocities and voidage profiles in a two-dimensional bed but also fluid dynamics in the jet region. The computational results show that gas flow direction is upward in the entire bed accompanied with random local circulations, whilst solid flow direction is upward at the center and downward near the wall. The radical reason of strong back-mixing of solid particles and good transfer behavior between two phases is that the jet entrains solid particles. Numerical calculation indicates that gas velocity, solid velocity and pressure profile have a significant change when the voidage is 0. 8. The simulated time-averaged voidage profiles agree with the experimental results and simulated data reported by Gidaspow and Ettehadieh(1983). Therefore, CFD model can be regarded as a useful tool to study the jet characteristics in dense gas-solid fluidized beds.

  10. CFD Analysis of a Slug Mixing Experiment Conducted on a VVER-1000 Model

    Directory of Open Access Journals (Sweden)

    F. Moretti

    2009-01-01

    Full Text Available A commercial CFD code was applied, for validation purposes, to the simulation of a slug mixing experiment carried out at OKB “Gidropress” scaled facility in the framework of EC TACIS project R2.02/02: “Development of safety analysis capabilities for VVER-1000 transients involving spatial variations of coolant properties (temperature or boron concentration at core inlet.” Such experimental model reproduces a VVER-1000 nuclear reactor and is aimed at investigating the in-vessel mixing phenomena. The addressed experiment involves the start-up of one of the four reactor coolant pumps (the other three remaining idle, and the presence of a tracer slug on the starting loop, which is thus transported to the reactor pressure vessel where it mixes with the clear water. Such conditions may occur in a boron dilution scenario, hence the relevance of the addressed phenomena for nuclear reactor safety. Both a pretest and a posttest CFD simulations of the mentioned experiment were performed, which differ in the definition of the boundary conditions (based either on nominal quantities or on measured quantities, resp.. The numerical results are qualitatively and quantitatively analyzed and compared against the measured data in terms of space and time tracer distribution at the core inlet. The improvement of the results due to the optimization of the boundary conditions is evidenced, and a quantification of the simulation accuracy is proposed.

  11. Investigation on the Use of a Multiphase Eulerian CFD solver to simulate breaking waves

    DEFF Research Database (Denmark)

    Tomaselli, Pietro D.; Christensen, Erik Damgaard

    2015-01-01

    investigation on a CFD model capable of handling this problem. The model is based on a solver, available in the open-source CFD toolkit OpenFOAM, which combines the Eulerian multi-fluid approach for dispersed flows with a numerical interface sharpening method. The solver, enhanced with additional formulations...

  12. Estimation of Radius Ratio in a Fin Using Inverse CFD Model

    Directory of Open Access Journals (Sweden)

    Ranjan Das

    2011-03-01

    Full Text Available

    This article deals with the retrieval of parameters such as the radius-ratio in a rectangular fin using an inverse CFD model involving a mixed boundary condition. At first, the temperature field is obtained from a forward problem using the finite difference method (FDM in which the inner and outer radii or the radius-ratio is assumed to be known. Next, by an inverse approach using the FDM in conjunction with the genetic algorithm (GA, the inner and outer radii or the radius-ratio is retrieved. To accomplish the task, an objective function represented by the sum of square of the error between the guessed and the exact/measured temperature fields is minimized. Apart from demonstrating the suitability of the FDM

  13. Validation of CFD Simulations of Cerebral Aneurysms With Implication of Geometric Variations

    OpenAIRE

    Hoi, Yiemeng; Woodward, Scott H.; Kim, Minsuok; Taulbee, Dale B.; Meng, Hui

    2006-01-01

    Computational fluid dynamics (CFD) simulations using medical-image-based anatomical vascular geometry are now gaining clinical relevance. This study aimed at validating the CFD methodology for studying cerebral aneurysms by using particle image velocimetry (PIV) measurements, with a focus on the effects of small geometric variations in aneurysm models on the flow dynamics obtained with CFD. Method of Approach. An experimental phantom was fabricated out of silicone elastomer to best mimic a sp...

  14. Validation and analysis of forward osmosis CFD model in complex 3D geometries

    DEFF Research Database (Denmark)

    Gruber, Mathias F.; Johnson, Carl J.; Tang, Chuyang;

    2012-01-01

    , seawater desalination and power generation. To ease optimization and increase understanding of membrane systems, it is desirable to have a comprehensive model that allows for easy investigation of all the major parameters in the separation process. Here we present experimental validation of a computational...... separation process and water permeation through membranes under various flow conditions. It is furthermore demonstrated how the CFD model can be used to optimize membrane geometry in such as way as to promote the mass transfer. © 2012 by the authors; licensee MDPI, Basel, Switzerland.......In forward osmosis (FO), an osmotic pressure gradient generated across a semi-permeable membrane is used to generate water transport from a dilute feed solution into a concentrated draw solution. This principle has shown great promise in the areas of water purification, wastewater treatment...

  15. Temperature Field-Wind Velocity Field Optimum Control of Greenhouse Environment Based on CFD Model

    Directory of Open Access Journals (Sweden)

    Yongbo Li

    2014-01-01

    Full Text Available The computational fluid dynamics technology is applied as the environmental control model, which can include the greenhouse space. Basic environmental factors are set to be the control objects, the field information is achieved via the division of layers by height, and numerical characteristics of each layer are used to describe the field information. Under the natural ventilation condition, real-time requirements, energy consumption, and distribution difference are selected as index functions. The optimization algorithm of adaptive simulated annealing is used to obtain optimal control outputs. A comparison with full-open ventilation shows that the whole index can be reduced at 44.21% and found that a certain mutual exclusiveness exists between the temperature and velocity field in the optimal course. All the results indicate that the application of CFD model has great advantages to improve the control accuracy of greenhouse.

  16. CFD model of thermal and velocity conditions in a particular indoor environment

    Energy Technology Data Exchange (ETDEWEB)

    Mora Perez, Miguel; Lopez Patino, Gonzalo; Lopez Jimenez, P. Amparo [Hydraulic and Environmental Engineering Department, Universitat Politecnica de Valencia (Spain); Guillen Guillamon, Ignacio [Applied Physics Department, Universitat Politecnica de Valencia (Spain)

    2013-07-01

    The demand for maintaining high indoor environmental quality (IEQ) with the minimum energy consumption is rapidly increasing. In the recent years, several studies have been completed to investigate the impact of indoor environment factors on human comfort, health and energy efficiency. Therefore, the design of the thermal environment in any sort of room, specially offices, has huge economic consequences. In this paper, a particular analysis on the air temperature in a multi-task room environment is modeled, in order to represent the velocities and temperatures inside the room by using Computational Fluid Dynamics (CFD) techniques. This model will help to designers to analyze the thermal comfort regions inside the studied air volume and to visualize the whole temperatures inside the room, determining the effect of the fresh external incoming air in the internal air temperature.

  17. Parametric sensitivity of a CFD model concerning the hydrodynamics of trickle-bed reactor (TBR

    Directory of Open Access Journals (Sweden)

    Janecki Daniel

    2016-03-01

    Full Text Available The aim of the present study was to investigate the sensitivity of a multiphase Eulerian CFD model with respect to relations defining drag forces between phases. The mean relative error as well as standard deviation of experimental and computed values of pressure gradient and average liquid holdup were used as validation criteria of the model. Comparative basis for simulations was our own data-base obtained in experiments carried out in a TBR operating at a co-current downward gas and liquid flow. Estimated errors showed that the classical equations of Attou et al. (1999 defining the friction factors Fjk approximate experimental values of hydrodynamic parameters with the best agreement. Taking this into account one can recommend to apply chosen equations in the momentum balances of TBR.

  18. Explosion characteristics of methane for CFD modeling and simulation of turbulent gas flow behavior during explosion

    Science.gov (United States)

    Skřínský, Jan; Vereš, Ján; Peer, Václav; Friedel, Pavel

    2016-06-01

    The effect of initial concentration on the explosion behavior of a stoichiometric CH4/O2/N2 mixture under air-combustion conditions was studied. Two mathematical models were used with the aim at simulating the gas explosion in the middle scale explosion vessel, and the associated effects of the temperature for different gas/air concentrations. Peak pressure, maximum rate of pressure rise and laminar burning velocity were measured from pressure time records of explosions occurring in a 1 m3 closed cylindrical vessel. The results of the models were validated considering a set of data (pressure time histories and root mean square velocity). The obtained results are relevant to the practice of gas explosion testing and the interpretation of test results and, they should be taken as the input data for CFD simulation to improve the conditions for standard tests.

  19. Application of CFD Modeling to Hydrodynamics of CycloBio Fluidized Sand Bed in Recirculating Aquaculture Systems

    Institute of Scientific and Technical Information of China (English)

    LIU Yao; SONG Xiefa; LIANG Zhenlin; PENG Lei

    2014-01-01

    To improve the efficiency of a CycloBio fluidized sand bed (CB FSB) in removal of dissolved wastes in recirculating aquaculture systems, the hydrodynamics of solid-liquid flow was investigated using computational fluid dynamics (CFD) modeling tools. The dynamic characteristics of silica sand within the CB FSB were determined using three-dimensional, unsteady-state simula-tions with the granular Eulerian multiphase approach and the RNG k-ε turbulence model, and the simulation results were validated using available lab-scale measurements. The bed expansion of CB FSB increased with the increase in water inflow rate in numerical simulations. Upon validation, the simulation involving 0.55 mm particles, the Gidaspow correlation for drag coefficient model and the Syamlal-O’Brien correlation for kinetic granular viscosity showed the closest match to the experimental results. The volume frac-tion of numerical simulations peaked as the wall was approached. The hydrodynamics of a pilot-scale CB FSB was simulated in or-der to predict the range of water flow to avoid the silica sand overflowing. The numerical simulations were in agreement with the experimental results qualitatively and quantitatively, and thus can be used to study the hydrodynamics of solid-liquid multiphase flow in CB FSB, which is of importance to the design, optimization, and amplification of CB FSBs.

  20. Use of CFD modeling for estimating spatial representativeness of urban air pollution monitoring sites and suitability of their locations

    International Nuclear Information System (INIS)

    A methodology to estimate the spatial representativeness of air pollution monitoring sites is applied to two urban districts. This methodology is based on high resolution maps of air pollution computed by using Computational Fluid Dynamics (CFD) modelling tools. Traffic-emitted NO2 dispersion is simulated for several meteorological conditions taking into account the effect of the buildings on air flow and pollutant dispersion and using a steady state CFD-RANS approach. From these results, maps of average pollutant concentrations for January -May 2011 are computed as a combination of the simulated scenarios. Two urban districts of Madrid City were simulated. Spatial representativeness areas for 32 different sites within the same district (including the site of the operative air quality stations) have been estimated by computing the portion of the domains with average NO2 concentration differing less than a 20% of the concentration at each candidate monitoring site. New parameters such as the ratio AR between the representativeness area and the whole domain area or the representativeness index (IR) has been proposed to discuss and compare the representativeness areas. Significant differences between the spatial representativeness of the candidate sites of both studied districts have been found. The sites of the Escuelas Aguirre district have generally smaller representativeness areas than those of the Plaza de Castilla. More stations are needed to cover the Escuelas Aguirre district than for the Plaza de Castilla one. The operative air quality station of the Escuelas Aguirre district is less representative than the station of the Plaza de Castilla district. The cause of these differences seems to be the differences in urban structure of both districts prompting different ventilation. (Author)

  1. Application of CFD modelling at a full-scale ozonation plant for the removal of micropollutants from secondary effluent.

    Science.gov (United States)

    Launer, M; Lyko, S; Fahlenkamp, H; Jagemann, P; Ehrhard, P

    2013-01-01

    Since November 2009, Germany's first full-scale ozonation plant for tertiary treatment of secondary effluent is in continuous operation. A kinetic model was developed and combined with the commercial computational fluid dynamics (CFD) software ANSYS(®) CFX(®) to simulate the removal of micropollutants from secondary effluents. Input data like reaction rate constants and initial concentrations of bulk components of the effluent organic matter (EfOM) were derived from experimental batch tests. Additionally, well-known correlations for the mass transfer were implemented into the simulation model. The CFD model was calibrated and validated by full-scale process data and by analytical measurements for micropollutants. The results show a good consistency of simulated values and measured data. Therewith, the validated CFD model described in this study proved to be suited for the application of secondary effluent ozonation. By implementing site-specific ozone exposition and the given reactor geometry the described CFD model can be easily adopted for similar applications. PMID:24056432

  2. Numerical aerodynamic analysis of bluff bodies at a high Reynolds number with three-dimensional CFD modeling

    Science.gov (United States)

    Bai, YuGuang; Yang, Kai; Sun, DongKe; Zhang, YuGuang; Kennedy, David; Williams, Fred; Gao, XiaoWei

    2013-02-01

    This paper focuses on numerical simulations of bluff body aerodynamics with three-dimensional CFD (computational fluid dynamics) modeling, where a computational scheme for fluid-structure interactions is implemented. The choice of an appropriate turbulence model for the computational modeling of bluff body aerodynamics using both two-dimensional and three-dimensional CFD numerical simulations is also considered. An efficient mesh control method which employs the mesh deformation technique is proposed to achieve better simulation results. Several long-span deck sections are chosen as examples which were stationary and pitching at a high Reynolds number. With the proposed CFD method and turbulence models, the force coefficients and flutter derivatives thus obtained are compared with the experimental measurement results and computed values completely from commercial software. Finally, a discussion on the effects of oscillation amplitude on the flutter instability of a bluff body is carried out with extended numerical simulations. These numerical analysis results demonstrate that the proposed three-dimensional CFD method, with proper turbulence modeling, has good accuracy and significant benefits for aerodynamic analysis and computational FSI studies of bluff bodies.

  3. Modelling of massive particulates for breakwater engineering using coupled FEMDEM and CFD

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    The seaward slope of many breakwaters consists of thousands of interlocking units of rock or concrete comprising a massive granular system of large elements each weighing tens of tonnes.The dumped quarry materials in the core are protected by progressively coarser particulates.The outer armour layer of freely placed units is intended to both dissipate wave energy and remain structurally stable as strong flows are drawn in and out of the particulate core.Design guidance on the mass and shape of these units is based on empirical equations derived from sealed physical model tests.The main failure mode for armour layers exposed to severe storms is hydraulic instability where the armour units of concrete or rock are subjected to uplift and drag forces which can in turn lead to rocking,displacement and collisions sufficient to cause breakage of units.Recently invented armour unit designs making up such granular layered system owe much of their success to the desirable emergent properties of interlock and porosity and how these combine with individual unit structural strength and inertial mass. Fundamental understanding of the forces governing such wave-structure interaction remains poor.We use discrete element and combined finite-discrete element methods to model the granular solid skeleton of randomly packed units coupled to a CFD code which resolves the wave dynamics through an interface tracking technique.The CFD code exploits several methods including a compressive advection scheme, node movement, and general mesh optimization.We provide the engineering context and report progress towards the numerical modelling of instability in these massive granular systems.

  4. Issues in the validation of CFD modelling of semi-solid metal forming

    International Nuclear Information System (INIS)

    Modelling of die filling during semi-solid metal processing (thixoforming) places particular demands on the CFD package being used. Not only are the velocities of the metal slurry in the die very high, the viscosity is too. Furthermore, the viscosity changes with shear rate (i.e. with changes in cross sectional area of the region the slurry travels through) and with time, as the injected material is thixotropic. The CFD software therefore requires good free surface tracking, accurate implicit solutions of the flow equations (as the CPU times for explicit solutions at high viscosities are impractical) and a model that adequately describes the slurry thixotropy. Finally, reliable, experimentally determined viscosity data are required. This paper describes the experiments on tin-lead and aluminium alloy slurries using compressive tests and rotating cylinder viscometry, followed by modelling using FLOW-3D. This package is known for its ability to track free surfaces accurately. Compressive tests allow rapid changes in shear rate to be imparted to the slurry, without wall slip, while the simple geometry of the viscometer makes it possible to compare analytical and numerical solutions. It is shown that the implicit viscous solver in its original form can reproduce the general trends found in the compressive and viscometry tests. However, sharp changes in shear rate lead to overestimation of pressure gradients in the slurry, making it difficult to separate these effects from those due to thixotropic breakdown. In order to achieve this separation, it is necessary to implement a more accurate implicit solver, which is currently under development. (author)

  5. A hybrid CFD-DSMC model designed to simulate rapidly rarefying flow fields and its application to physical vapor deposition

    Science.gov (United States)

    Gott, Kevin

    This research endeavors to better understand the physical vapor deposition (PVD) vapor transport process by determining the most appropriate fluidic model to design PVD coating manufacturing. An initial analysis was completed based on the calculation of Knudsen number from titanium vapor properties. The results show a dense Navier-Stokes solver best describes flow near the evaporative source, but the material properties suggest expansion into the chamber may result in a strong drop in density and a rarefied flow close to the substrate. A hybrid CFD-DSMC solver is constructed in OpenFOAM for rapidly rarefying flow fields such as PVD vapor transport. The models are patched together combined using a new patching methodology designed to take advantage of the one-way motion of vapor from the CFD region to the DSMC region. Particles do not return to the dense CFD region, therefore the temperature and velocity can be solved independently in each domain. This novel technique allows a hybrid method to be applied to rapidly rarefying PVD flow fields in a stable manner. Parameter studies are performed on a CFD, Navier-Stokes continuum based compressible solver, a Direct Simulation Monte Carlo (DSMC) rarefied particle solver, a collisionless free molecular solver and the hybrid CFD-DSMC solver. The radial momentum at the inlet and radial diffusion characteristics in the flow field are shown to be the most important to achieve an accurate deposition profile. The hybrid model also shows sensitivity to the shape of the CFD region and rarefied regions shows sensitivity to the Knudsen number. The models are also compared to each other and appropriate experimental data to determine which model is most likely to accurately describe PVD coating deposition processes. The Navier-Stokes solvers are expected to yield backflow across the majority of realistic inlet conditions, making their physics unrealistic for PVD flow fields. A DSMC with improved collision model may yield an accurate

  6. CFD Simulation and Experimental Validation of Fluid Flow and Particle Transport in a Model of Alveolated Airways.

    Science.gov (United States)

    Ma, Baoshun; Ruwet, Vincent; Corieri, Patricia; Theunissen, Raf; Riethmuller, Michel; Darquenne, Chantal

    2009-05-01

    Accurate modeling of air flow and aerosol transport in the alveolated airways is essential for quantitative predictions of pulmonary aerosol deposition. However, experimental validation of such modeling studies has been scarce. The objective of this study is to validate CFD predictions of flow field and particle trajectory with experiments within a scaled-up model of alveolated airways. Steady flow (Re = 0.13) of silicone oil was captured by particle image velocimetry (PIV), and the trajectories of 0.5 mm and 1.2 mm spherical iron beads (representing 0.7 to 14.6 mum aerosol in vivo) were obtained by particle tracking velocimetry (PTV). At twelve selected cross sections, the velocity profiles obtained by CFD matched well with those by PIV (within 1.7% on average). The CFD predicted trajectories also matched well with PTV experiments. These results showed that air flow and aerosol transport in models of human alveolated airways can be simulated by CFD techniques with reasonable accuracy. PMID:20161301

  7. Modeling of sand-water slurry flow through horizontal pipe using CFD

    Directory of Open Access Journals (Sweden)

    Kumar Gopaliya Manoj

    2016-09-01

    Full Text Available The paper presents three-dimensional CFD analysis of two-phase (sand-water slurry flows through 263 mm diameter pipe in horizontal orientation for mixture velocity range of 3.5-4.7 m/s and efflux concentration range of 9.95-34% with three particle sizes viz. 0.165 mm, 0.29 mm and 0.55 mm with density 2650 kg/m3. RNG k-ε turbulence closure equations with Eulerian multi-phase model is used to simulate various slurry flows. The simulated values of local solid concentration are compared with the experimental data and are found to be in good agreement for all particle sizes. Effects of particle size on various slurry flow parameters such as pressure drop, solid phase velocity distribution, friction factor, granular pressure, turbulent viscosity, turbulent kinetic energy and its dissipation have been analyzed.

  8. Evaluating the catching performance of aerodynamic rain gauges through field comparisons and CFD modelling

    Science.gov (United States)

    Pollock, Michael; Colli, Matteo; Stagnaro, Mattia; Lanza, Luca; Quinn, Paul; Dutton, Mark; O'Donnell, Greg; Wilkinson, Mark; Black, Andrew; O'Connell, Enda

    2016-04-01

    Accurate rainfall measurement is a fundamental requirement in a broad range of applications including flood risk and water resource management. The most widely used method of measuring rainfall is the rain gauge, which is often also considered to be the most accurate. In the context of hydrological modelling, measurements from rain gauges are interpolated to produce an areal representation, which forms an important input to drive hydrological models and calibrate rainfall radars. In each stage of this process another layer of uncertainty is introduced. The initial measurement errors are propagated through the chain, compounding the overall uncertainty. This study looks at the fundamental source of error, in the rainfall measurement itself; and specifically addresses the largest of these, the systematic 'wind-induced' error. Snowfall is outside the scope. The shape of a precipitation gauge significantly affects its collection efficiency (CE), with respect to a reference measurement. This is due to the airflow around the gauge, which causes a deflection in the trajectories of the raindrops near the gauge orifice. Computational Fluid-Dynamic (CFD) simulations are used to evaluate the time-averaged airflows realized around the EML ARG100, EML SBS500 and EML Kalyx-RG rain gauges, when impacted by wind. These gauges have a similar aerodynamic profile - a shape comparable to that of a champagne flute - and they are used globally. The funnel diameter of each gauge, respectively, is 252mm, 254mm and 127mm. The SBS500 is used by the UK Met Office and the Scottish Environmental Protection Agency. Terms of comparison are provided by the results obtained for standard rain gauge shapes manufactured by Casella and OTT which, respectively, have a uniform and a tapered cylindrical shape. The simulations were executed for five different wind speeds; 2, 5, 7, 10 and 18 ms-1. Results indicate that aerodynamic gauges have a different impact on the time-averaged airflow patterns

  9. Effects of moisture release and radiation properties in pulverized fuel combustion: A CFD modelling study

    DEFF Research Database (Denmark)

    Yin, Chungen

    2016-01-01

    to improve the plant efficiency and is also expected to affect the combustion process. Thermal radiation is the principal mode of heat transfer in combustion. In PF furnaces, radiation consists of contribution from both participating gases and solid particles, in which gas and particle radiation properties......Pulverized fuels (PF) prepared and fired in utility boilers always contain some moisture. For some fuels with high moisture contents (e.g., brown coals), the share of the evaporation enthalpy is quite significant compared to the heat released during combustion, which often needs to be reclaimed...... and impacts via a computational fluid dynamics (CFD) study of a 609 MWe pulverized coal-fired utility boiler. Overall speaking, it is suggested to add the free moisture in the fuel to the primary air stream while lump the bound moisture with volatiles in PF combustion modelling, although different methods...

  10. Inviscid and viscous flow modelling of complex aircraft configurations using the CFD simulation system sauna

    Science.gov (United States)

    Peace, Andrew J.; May, Nicholas E.; Pocock, Mark F.; Shaw, Jonathon A.

    1994-04-01

    This paper is concerned with the flow modelling capabilities of an advanced CFD simulation system known by the acronym SAUNA. This system is aimed primarily at complex aircraft configurations and possesses a unique grid generation strategy in its use of block-structured, unstructured or hybrid grids, depending on the geometric complexity of the addressed configuration. The main focus of the paper is in demonstrating the recently developed multi-grid, block-structured grid, viscous flow capability of SAUNA, through its evaluation on a number of configurations. Inviscid predictions are also presented, both as a means of interpreting the viscous results and with a view to showing more completely the capabilities of SAUNA. It is shown that accuracy and flexibility are combined in an efficient manner, thus demonstrating the value of SAUNA in aerodynamic design.

  11. Mitigation of turbidity currents in reservoirs with passive retention systems: validation of CFD modeling

    Science.gov (United States)

    Ferreira, E.; Alves, E.; Ferreira, R. M. L.

    2012-04-01

    Sediment deposition by continuous turbidity currents may affect eco-environmental river dynamics in natural reservoirs and hinder the maneuverability of bottom discharge gates in dam reservoirs. In recent years, innovative techniques have been proposed to enforce the deposition of turbidity further upstream in the reservoir (and away from the dam), namely, the use of solid and permeable obstacles such as water jet screens , geotextile screens, etc.. The main objective of this study is to validate a computational fluid dynamics (CFD) code applied to the simulation of the interaction between a turbidity current and a passive retention system, designed to induce sediment deposition. To accomplish the proposed objective, laboratory tests were conducted where a simple obstacle configuration was subjected to the passage of currents with different initial sediment concentrations. The experimental data was used to build benchmark cases to validate the 3D CFD software ANSYS-CFX. Sensitivity tests of mesh design, turbulence models and discretization requirements were performed. The validation consisted in comparing experimental and numerical results, involving instantaneous and time-averaged sediment concentrations and velocities. In general, a good agreement between the numerical and the experimental values is achieved when: i) realistic outlet conditions are specified, ii) channel roughness is properly calibrated, iii) two equation k - ɛ models are employed iv) a fine mesh is employed near the bottom boundary. Acknowledgements This study was funded by the Portuguese Foundation for Science and Technology through the project PTDC/ECM/099485/2008. The first author thanks the assistance of Professor Moitinho de Almeida from ICIST and to all members of the project and of the Fluvial Hydraulics group of CEHIDRO.

  12. CFD simulations in the nuclear containment using the DES turbulence models

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Peng [School of Engineering, Sun Yat-Sen University, Guangzhou (China); Chen, Meilan [China Nuclear Power Technology Research Institute, Shenzhen (China); Li, Wanai, E-mail: liwai@mail.sysu.edu.cn [Sino-French Institute of Nuclear Engineering & Technology, Sun Yat-Sen University, Guangzhou (China); Liu, Yulan [School of Engineering, Sun Yat-Sen University, Guangzhou (China); Wang, Biao [Sino-French Institute of Nuclear Engineering & Technology, Sun Yat-Sen University, Guangzhou (China)

    2015-06-15

    Highlights: • The k-ε based DES model is used in the nuclear containment simulation. • The comparison of results between different turbulent models is obtained. • The superiority of DES models is analyzed. • The computational efficiency with the DES turbulence models is explained. - Abstract: Different species of gases would be released into the containment and cause unpredicted disasters during the nuclear severe accidents. It is important to accurately predict the transportation and stratification phenomena of these gas mixtures. CFD simulations of these thermal hydraulic issues in nuclear containment are investigated in this paper. The main work is to study the influence of turbulence model on the calculation of gas transportation and heat transfer. The k-ε based DES and other frequently used turbulence models are used in the steam and helium release simulation in THAI series experiment. This paper will show the superiority of the DES turbulence model in terms of computational efficiency and accuracy with the experimental results, and analyze the necessities of DES model to simulate the large-scale containment flows with both laminar and turbulence regions.

  13. An inter-comparison exercise on the capabilities of CFD models to predict the short and long term distribution and mixing of hydrogen in a garage

    Energy Technology Data Exchange (ETDEWEB)

    Venetsanos, A.G.; Papanikolaou, E. [Environmental Research Laboratory, National Centre for Scientific Research Demokritos (NCSRD), Aghia Paraskevi, Attikis, 15310 Athens (Greece); Delichatsios, M. [Environmental Research Laboratory, National Centre for Scientific Research Demokritos (NCSRD), Aghia Paraskevi, Attikis, 15310 Athens (Greece); FireSERT Institute, University of Ulster (UU), Newtownabbey BT37 0QB, Northern Ireland (United Kingdom); Garcia, J. [Escuela Tecnica Superior de Ingenieros Industriales, Universidad Politecnica de Madrid (UPM), Jose Gutierrez Abascal, 2, E-28006 Madrid (Spain); Hansen, O.R.; Middha, P. [GEXCON AS (GXC), Fantoftvegen 38, Box 6015 Postterminalen, N-5892 Bergen (Norway); Heitsch, M. [Gesellschaft fuer Anlagen-und Reaktorsicherheit (GRS) mbH, Research Management Division, Schwertnergasse 1, 50667 Koeln (Germany); Huser, A. [Det Norske Veritas (DNV) AS Energy Solutions, Oslo (Norway); Jahn, W. [Forschungszentrum Juelich (FZJ), 52425 Juelich (Germany); Jordan, T. [IKET, Forschungszentrum Karlsruhe (FZK), Postfach 3640, 76021 Karlsruhe (Germany); Lacome, J.-M. [Explosion-Dispersion Unit, Institut National de l' Environnement industriel et des RISques (INERIS), Parc Technologique Alata, BP2, F-60550 Verneuil-en-Halatte (France); Ledin, H.S. [Health and Safety Laboratory (HSL), Harpur Hill, Buxton, Derbyshire SK17 9JN (United Kingdom); Makarov, D.; Verbecke, F. [HySAFER Centre, University of Ulster (UU), Newtownabbey BT37 0QB, Northern Ireland (United Kingdom); Studer, E. [Heat Transfer and Fluid Mechanics Laboratory, Commissariat a l' Energie Atomique (CEA), F-91191 Gif-sur-Yvette Cedex (France); Tchouvelev, A.V. [A.V.Tchouvelev and Associates Inc. (AVT), 6591 Spinnaker Circle, Mississauga, ON L5W 1R2 (Canada); Teodorczyk, A. [Warsaw University of Technology (WUT) (Poland); Van der Voort, M.M. [TNO Defence, Security and Safety, Process Safety and Dangerous Goods, 2280 AA Rijswijk (Netherlands)

    2009-07-15

    The paper presents the results of the CFD inter-comparison exercise SBEP-V3, performed within the activity InsHyde, internal project of the HySafe network of excellence, in the framework of evaluating the capability of various CFD tools and modelling approaches in predicting the short and long term mixing and distribution of hydrogen releases in confined spaces. The experiment simulated was INERIS-TEST-6C, performed within the InsHyde project by INERIS, consisting of a 1 g/s vertical hydrogen release for 240 s from an orifice of 20 mm diameter into a rectangular room (garage) of dimensions 3.78 x 7.2 x 2.88 m in width, length and height respectively. Two small openings at the bottom of the front side of the room assured constant pressure conditions. During the test hydrogen concentration time histories were measured at 12 positions in the room, for a period up to 5160 s after the end of release, covering both the release and the subsequent diffusion phases. The benchmark was organized in two phases. The first phase consisted of blind simulations performed prior to the execution of the tests. The second phase consisted of post-calculations performed after the tests were concluded and the experimental results made available. The participation in the benchmark was high: 12 different organizations (2 non-HySafe partners), 10 different CFD codes and 8 different turbulence models. Large variation in predicted results was found in the first phase of the benchmark, between the various modelling approaches. This was attributed mainly to differences in turbulence models and numerical accuracy options (time/space resolution and discretization schemes). During the second phase of the benchmark the variation between predicted results was reduced. (author)

  14. Wind Power Forecasting techniques in complex terrain: ANN vs. ANN-CFD hybrid approach

    Science.gov (United States)

    Castellani, Francesco; Astolfi, Davide; Mana, Matteo; Burlando, Massimiliano; Meißner, Cathérine; Piccioni, Emanuele

    2016-09-01

    Due to technology developments, renewable energies are becoming competitive against fossil sources and the number of wind farms is growing, which have to be integrated into power grids. Therefore, accurate power forecast is needed and often operators are charged with penalties in case of imbalance. Yet, wind is a stochastic and very local phenomenon, and therefore hard to predict. It has a high variability in space and time and wind power forecast is challenging. Statistical methods, as Artificial Neural Networks (ANN), are often employed for power forecasting, but they have some shortcomings: they require data sets over several years and are not able to capture tails of wind power distributions. In this work a pure ANN power forecast is compared against a hybrid method, based on the combination of ANN and a physical method using computational fluid dynamics (CFD). The validation case is a wind farm sited in southern Italy in a very complex terrain, with a wide spread turbine layout.

  15. Operations based optimisation using simulation and CFD

    OpenAIRE

    Doherty, JJ; Clifton, DP; Gillan, MA; Ciampoli, F

    2007-01-01

    An initial investigation of an optimisation based approach for design across a continuous range of operating conditions is presented. The objective for this 'operations based optimisation' approach is to avoid the need to choose critical design point conditions and associated weighting factors by tackling the overall operational performance instead. The approach integrates numerical optimisation, response surface modelling, CFD and operational simulation. An optimisation test bed involving th...

  16. Assessment of CFD URANS models for buoyancy driven mixing flows based on ROCOM experiments

    International Nuclear Information System (INIS)

    An assessment of STAR-CCM+ Computational Fluid Dynamics (CFD) models of a KONVOI type Reactor Pressure Vessel (RPV) has been performed based on experimental data collected at the ROssendorf COolant Mixing (ROCOM) test facility as part of the OECD-NEA PKL 2 Project. Three different experimental configurations typical of Main Steam Line Break (MSLB) with Loss-Of-Offsite-Power (LOOP) scenarios are investigated (i.e. Test 1.1, 2.1 and 2.2). The transport of the mixing scalar is based on an equivalent thermal model of the isothermal experimental system. The focus of the study is on the modeling of the physical properties and the turbulent heat flux (closure term) needed by the Unsteady Reynolds Averaged Navier-Stokes (URANS) equations. Results show that a standard Constant Turbulent Prandtl number (CTP) and the chosen Variable Turbulent Prandtl number (VTP) models are capable of describing qualitatively and quantitatively well the time-evolution of the temperature field in the core inlet zone (Test 1.1). When large density differences of the coolant are present in the system, the VTP model outperforms the CTP model in predicting the elevation of the thermal stratification line that builds up in the downcomer due to incomplete mixing. Nevertheless, the CTP model performs very well when the density difference is very low (Test 2.1). No significant changes have been observed for Test 2.2 when idealized boundary conditions are used instead of the experimental ones. (author)

  17. Fuel assembly simulations using LRGR-CFD and CGCFD

    International Nuclear Information System (INIS)

    In addition to the traditional fuel assembly simulation approaches using system codes, subchannel codes or porous medium approaches, as well as detailed CFD simulations to analyze single sub channels, a Low Resolution Geometry Resolving (LRGR) CFD approach and a Coarse-Grid-CFD (CGCFD) approach is taken. Both methods are based on a low resolution mesh that allows the capture of large and medium scale flow features such as recirculation zones, which cannot be reproduced by the system codes, subchannel codes and porous media approaches. The LRGR approach allows for instance fine-tuning the porous parameters which are important input for a porous medium approach. However, it should be noted that the prediction of detailed flow features such as secondary flows is not feasible. Using this approach, the consequences of flow blockages for detection possibilities and cladding temperatures can be discussed. Within the Coarse-Grid CFD approach a subgrid model (SGM) accounts for sub grid volumetric forces which are derived from validated CFD simulations. The volumetric forces take account of the non resolved physics due to the coarse mesh. The CGCFD approach with SGM can be applied to simulate complete fuel assemblies or even complete cores capturing the unique features of the complex flow induced by the fuel assembly geometry and its spacers. In such a case, grids with a very low grid resolution are employed. The current paper discusses and presents both, the CGCFD and the LRGR approaches. (author)

  18. Evaluation of a combustion model for the simulation of hydrogen spark-ignition engines using a CFD code

    Energy Technology Data Exchange (ETDEWEB)

    Rakopoulos, C.D.; Kosmadakis, G.M. [Internal Combustion Engines Laboratory, Thermal Engineering Department, School of Mechanical Engineering, National Technical University of Athens, 9 Heroon Polytechniou St., Zografou Campus, 15780 Athens (Greece); Pariotis, E.G. [Laboratory of Naval Propulsion Systems, Section of Naval Architecture and Marine Engineering, Department of Naval Sciences, Hellenic Naval Academy, End of Hatzikyriakou Ave., Hatzikyriakio, 18539 Piraeus (Greece)

    2010-11-15

    The present work deals with the evaluation of a combustion model that has been developed, in order to simulate the power cycle of hydrogen spark-ignition engines. The motivation for the development of such a model is to obtain a simple combustion model with few calibration constants, applicable to a wide range of engine configurations, incorporated in an in-house CFD code using the RNG k-{epsilon} turbulence model. The calculated cylinder pressure traces, gross heat release rate diagrams and exhaust nitric oxide (NO) emissions are compared with the corresponding measured ones at various engine loads. The engine used is a Cooperative Fuel Research (CFR) engine fueled with hydrogen, operating at a constant engine speed of 600 rpm. This model is composed of various sub-models used for the simulation of combustion of conventional fuels in SI engines; it has been adjusted in the current study specifically for hydrogen combustion. The basic sub-model incorporated for the calculation of the reaction rates is the characteristic conversion time-scale method, meaning that a time-scale is used depending on the laminar conversion time and the turbulent mixing time, which dictates to what extent the combustible gas has reached its chemical equilibrium during a predefined time step. Also, the laminar and turbulent combustion velocity is used to track the flame development within the combustion chamber, using two correlations for the laminar flame speed and the Zimont/Lipatnikov approach for the modeling of the turbulent flame speed, whereas the (NO) emissions are calculated according to the Zeldovich mechanism. From the evaluation conducted, it is revealed that by using the developed hydrogen combustion model and after adjustment of the unique model calibration constant, there is an adequate agreement with measured data (regarding performance and emissions) for the investigated conditions. However, there are a few more issues to be resolved dealing mainly with the ignition

  19. Predicting self-pollution inside school buses using a CFD and multi-zone coupled model

    Science.gov (United States)

    Li, Fei; Lee, Eon S.; Liu, Junjie; Zhu, Yifang

    2015-04-01

    The in-cabin environment of a school bus is important for children's health. The pollutants from a bus's own exhaust contribute to children's overall exposure to air pollutants inside the school bus cabin. In this study, we adapted a coupled model originally developed for indoor environment to determine the relative contribution of the bus own exhaust to the in-cabin pollutant concentrations. The coupled model uses CFD (computational fluent dynamics) model to simulate outside concentration and CONTAM (a multi-zone model) for inside the school bus. The model was validated with experimental data in the literature. Using the validated model, we analyzed the effects of vehicle speed and tailpipe location on self-pollution inside the bus cabin. We confirmed that the pollution released from the tailpipe can penetrate into the bus cabin through gaps in the back emergency door. We found the pollution concentration inside school buses was the highest when buses were driven at a medium speed. In addition, locating the tailpipe on the side, behind the rear axle resulted in less self-pollution since there is less time for the suction effect to take place. The developed theoretical framework can be generalized to study other types of buses. These findings can be used in developing policy recommendations for reducing human exposure to air pollution inside buses.

  20. Development of a CFD Model for Secondary Final Settling Tanks in Water Pollution Control Plants

    Science.gov (United States)

    Gong, Minwei; Xanthos, Savvas; Ramalingam, Krish; Fillos, John

    2007-11-01

    To assess performance and evaluate alternatives to improve efficiency of the New York City the Wards Island Water Pollution Control Plant (WPCP) FSTs at peak loads, a 3D CFD model has been developed. Fluent was utilized as the base platform, where sub-models of the Suspended Solids (SS), settling characteristics, density currents and SS flocculation were incorporated. This was supplemented by field and bench scale experiments to quantify the coefficients integral to the sub-models. Model calibration and validation have been carried out by using the extensive set of data collected. The model can be used to evaluate different modes of operation, alternate hydraulic and solids loading rates, as well as addition of auxiliary components such as baffles to improve process performance. The model is being used to compare potential benefits for different alternatives of design and operation of the existing FSTs. After comparing series of inlet baffles, a baffle with 4 horizontal and 7 vertical slots has been recommended for installation in the FSTs. Additional baffle type, configurations and locations within the tank are also being evaluated to improve the performance of the FSTs especially during periods of poor settling and peak flow conditions.

  1. Knowledge Transfer from Detailed 3-D CFD Codes to System Simulation Tools – CCV Modeling in SI Engine

    Directory of Open Access Journals (Sweden)

    Vítek Oldřich

    2016-06-01

    Full Text Available The paper deals with CCV knowledge transfer from reference data (either experiments or 3-D CFD data into system simulation SW tools (based on 0-D/1-D CFD. It was verified that CCV phenomenon can be modeled by means of combustion model perturbations. The proposed methodology consists of two major steps. First, individual cycle data have to be matched with the 0-D/1-D model, i.e., combustion model parameters are varied to achieve the best possible match of in-cylinder pressure traces. Second, the combustion model parameters (obtained in previous step are statistically evaluated to obtain PDFs and cross-correlations. Then such information is imposed to the 0-D/1-D tool to mimic pressure traces CCV. Good correspondence with the reference data is achieved only if both PDFs and cross-correlations are imposed simultaneously.

  2. Implementation into a CFD code of neutron kinetics and fuel pin models for nuclear reactor transient analyses

    International Nuclear Information System (INIS)

    Safety analysis is an important tool for justifying the safety of nuclear reactors. The traditional method for nuclear reactor safety analysis is performed by means of system codes, which use one-dimensional lumped-parameter method to model real reactor systems. However, there are many multi-dimensional thermal-hydraulic phenomena cannot be predicated using traditional one-dimensional system codes. This problem is extremely important for pool-type nuclear systems. Computational fluid dynamics (CFD) codes are powerful numerical simulation tools to solve multi-dimensional thermal-hydraulics problems, which are widely used in industrial applications for single phase flows. In order to use general CFD codes to solve nuclear reactor transient problems, some additional models beyond general ones are required. Neutron kinetics model for power calculation and fuel pin model for fuel pin temperature calculation are two important models of these additional models. The motivation of this work is to develop an advance numerical simulation method for nuclear reactor safety analysis by implementing neutron kinetics model and fuel pin model into general CFD codes. In this paper, the Point Kinetics Model (PKM) and Fuel Pin Model (FPM) are implemented into a general CFD code FLUENT. The improved FLUENT was called as FLUENT/PK. The mathematical models and implementary method of FLUENT/PK are descripted and two demonstration application cases, e.g. the unprotected transient overpower (UTOP) accident of a Liquid Metal cooled Fast Reactor (LMFR) and the unprotected beam overpower (UBOP) accident of an Accelerator Driven System (ADS), are presented. (author)

  3. Simulation of multi-deck medium temperature display cabinets with the integration of CFD and cooling coil models

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Y.T.; Tassou, S.A.; Hadawey, A. [Mechanical Engineering, School of Engineering and Design, Brunel University, Uxbridge, Middlesex, UB8 3PH (United Kingdom)

    2010-10-15

    In this paper, the model for the multi-deck medium temperature display cabinets is developed with the integration of CFD and cooling coil sub-models. The distributed method is used to develop the cooling coil model with the airside inputs from the outputs of the CFD model. Inversely, the airside outputs from the cooling coil model are used to update the boundary conditions of the CFD model. To validate this cabinet model, a multi-deck medium temperature display cabinet refrigerated with a secondary refrigerant cooling coil was selected as a prototype and mounted in an air conditioned chamber. Extensive tests were conducted at constant space air temperature and varied relative humilities. The cabinet model has been validated by comparing with the test results for the parameters of air at different locations of the flow path, and temperatures of refrigerant and food product, etc. The validated model is therefore used to explore and analyse the cabinet performance and control strategies at various operating and design conditions. (author)

  4. CFD simulation of an industrial hydrocyclone with Eulerian-Eulerian approach:A case study

    Institute of Scientific and Technical Information of China (English)

    Safa Raziyeh; Soltani Goharrizi Ataallah⇑

    2014-01-01

    In the present study, a three-dimensional computational fluid dynamics simulation together with exper-imental field measurements was applied to optimize the performance of an industrial hydrocyclone at Sarcheshmeh copper complex. In the simulation, the Eulerian-Eulerian approach was used for solid and liquid phases, the latter being water. In this approach, nine continuous phases were considered for the solid particles with different sizes and one continuous phase for water. The continuity and momen-tum equations with inclusion of buoyancy and drag forces were solved by the finite volume method. The k-e RNG turbulence model was used for modeling of turbulency. There was a good agreement between the simulation results and the experimental data. After validation of the model accuracy, the effect of inlet solid percentage, pulp inlet velocity, rod inserting in the middle of the hydrocyclone and apex diam-eter on hydrocyclone performance was investigated. The results showed that by decreasing the inlet solid percentage and increasing the pulp inlet velocity, the efficiency of hydrocyclone increased. Decreasing the apex diameter caused an increase in the hydrocyclone efficiency.

  5. Accumulation and transport of microbial-size particles in a pressure protected model burn unit: CFD simulations and experimental evidence

    Directory of Open Access Journals (Sweden)

    Mimoun Maurice

    2011-03-01

    Full Text Available Abstract Background Controlling airborne contamination is of major importance in burn units because of the high susceptibility of burned patients to infections and the unique environmental conditions that can accentuate the infection risk. In particular the required elevated temperatures in the patient room can create thermal convection flows which can transport airborne contaminates throughout the unit. In order to estimate this risk and optimize the design of an intensive care room intended to host severely burned patients, we have relied on a computational fluid dynamic methodology (CFD. Methods The study was carried out in 4 steps: i patient room design, ii CFD simulations of patient room design to model air flows throughout the patient room, adjacent anterooms and the corridor, iii construction of a prototype room and subsequent experimental studies to characterize its performance iv qualitative comparison of the tendencies between CFD prediction and experimental results. The Electricité De France (EDF open-source software Code_Saturne® (http://www.code-saturne.org was used and CFD simulations were conducted with an hexahedral mesh containing about 300 000 computational cells. The computational domain included the treatment room and two anterooms including equipment, staff and patient. Experiments with inert aerosol particles followed by time-resolved particle counting were conducted in the prototype room for comparison with the CFD observations. Results We found that thermal convection can create contaminated zones near the ceiling of the room, which can subsequently lead to contaminate transfer in adjacent rooms. Experimental confirmation of these phenomena agreed well with CFD predictions and showed that particles greater than one micron (i.e. bacterial or fungal spore sizes can be influenced by these thermally induced flows. When the temperature difference between rooms was 7°C, a significant contamination transfer was observed to

  6. CFD modeling of liquid-solid fluidization: Effect of drag correlation and added mass force

    Institute of Scientific and Technical Information of China (English)

    Xiao yan Huang

    2011-01-01

    Computational fluid dynamics (CFD) has been widely used to study the hydrodynamics of gas-solid fluidization; however,its applications in liquid-solid fluidization are relatively rare.In this study,CFD simulations of a liquid-solid fluidized bed are carried out,focusing on the effect of drag correlation and added mass force on the hydrodynamics of liquid-solid fluidization.It is shown that drag correlation has a significant effect on the simulation results and the correlation proposed by Beetstra et al.(2007) gives the best agreement with experimental data.We further show that the added mass force does play an important role in CFD simulation of liquid-solid fluidization,and therefore should not be ignored in CFD simulations.

  7. DEVELOPMENT OF CFD SIMULATION APPLICATIONS FOR LOCAL-SCALE AREAS AND POTENTIAL INTERFACE WITH MESOSCALE MODELS

    Science.gov (United States)

    The presentation summarizes developments of ongoing applications of fine-scale (geometry specific) CFD simulations to urban areas within atmospheric boundary layers. Enabling technology today and challenges for the future are discussed. There is a challenging need to develop a ...

  8. Numerical estimation of wall friction ratio near the pseudo-critical point with CFD-models

    International Nuclear Information System (INIS)

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region across the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models are adopted, making use of refined near-wall discretisation as required by the constraint y+ < 1 at the wall. In particular, the Lien k–ε and the SST k–ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy–Weisbach friction factors, based on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way

  9. Coupled simulation of chemical lasers based on intracavity partially coherent light model and 3D CFD model.

    Science.gov (United States)

    Wu, Kenan; Huai, Ying; Jia, Shuqin; Jin, Yuqi

    2011-12-19

    Coupled simulation based on intracavity partially coherent light model and 3D CFD model is firstly achieved in this paper. The dynamic equation of partially coherent intracavity field is derived based on partially coherent light theory. A numerical scheme for the coupled simulation as well as a method for computing the intracavity partially coherent field is given. The presented model explains the formation of the sugar scooping phenomenon, and enables studies on the dependence of the spatial mode spectrum on physical parameters of laser cavity and gain medium. Computational results show that as the flow rate of iodine increases, higher order mode components dominate in the partially coherent field. Results obtained by the proposed model are in good agreement with experimental results. PMID:22274214

  10. Statistical Analysis of Detailed 3-D CFD LES Simulations with Regard to CCV Modeling

    Directory of Open Access Journals (Sweden)

    Vítek Oldřich

    2016-06-01

    Full Text Available The paper deals with statistical analysis of large amount of detailed 3-D CFD data in terms of cycle-to-cycle variations (CCVs. These data were obtained by means of LES calculations of many consecutive cycles. Due to non-linear nature of Navier-Stokes equation set, there is a relatively significant CCV. Hence, every cycle is slightly different – this leads to requirement to perform statistical analysis based on ensemble averaging procedure which enables better understanding of CCV in ICE including its quantification. The data obtained from the averaging procedure provides results on different space resolution levels. The procedure is applied locally, i.e., in every cell of the mesh. Hence there is detailed CCV information on local level – such information can be compared with RANS simulations. Next, volume/mass averaging provides information at specific locations – e.g., gap between electrodes of a spark plug. Finally, volume/mass averaging of the whole combustion chamber leads to global information which can be compared with experimental data or results of system simulation tools (which are based on 0-D/1-D approach.

  11. CFD Simulation on Ethylene Furnace Reactor Tubes

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different mathematical models for ethylene furnace reactor tubes were reviewed. On the basis of these models a new mathematical simulation approach for reactor tubes based on computational fluid dynamics (CFD) technique was presented. This approach took the flow, heat transfer, mass transfer and thermal cracking reactions in the reactor tubes into consideration. The coupled reactor model was solved with the SIMPLE algorithm. Some detailed information about the flow field, temperature field and concentration distribution in the reactor tubes was obtained, revealing the basic characteristics of the hydrodynamic phenomena and reaction behavior in the reactor tubes. The CFD approach provides the necessary information for conclusive decisions regarding the production optimization, the design and improvement of reactor tubes, and the new techniques implementation.

  12. Experimental Study and CFD modeling of high speed water jets in air

    Science.gov (United States)

    Guha, Anirban; Barron, R. M.; Balachandar, R.

    2007-11-01

    High speed turbulent water jets are extensively used in industrial cleaning applications. They interact vigorously with the surrounding air and loose mass in the form of water droplets which moves along with the entrained air stream. The transfer of momentum to the surroundings reduces the jet velocity and thus the pressure at the impinging surface is significantly lower than the supply pressure. Laser Doppler Anemometer (LDA) measurements of velocity field and pressure measurements at different axial and radial locations were performed. The potential core of the jet was found to extend to around 100 nozzle diameters. The dynamic pressure along the centerline was found to decay linearly, which can be used to estimate the decay of water volume fraction along the centerline. An empirical formulation of mass transfer (in the form of droplets) from water phase to the surroundings has been developed and incorporated into the commercial CFD code FLUENT. The flow was simulated using the RNG k-ɛ turbulence model and Eulerian-Eulerian multiphase model. The predicted pressure distribution at the impinging surface was found to match closely with the experimental findings.

  13. Modeling and simulation of PEM fuel cell's flow channels using CFD techniques

    Energy Technology Data Exchange (ETDEWEB)

    Cunha, Edgar F.; Andrade, Alexandre B.; Robalinho, Eric; Bejarano, Martha L.M.; Linardi, Marcelo [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mails: efcunha@ipen.br; abodart@ipen.br; eric@ipen.br; mmora@ipen.br; mlinardi@ipen.br; Cekinski, Efraim [Instituto de Pesquisas Tecnologicas (IPT-SP), Sao Paulo, SP (Brazil)]. E-mail: cekinski@ipt.br

    2007-07-01

    Fuel cells are one of the most important devices to obtain electrical energy from hydrogen. The Proton Exchange Membrane Fuel Cell (PEMFC) consists of two important parts: the Membrane Electrode Assembly (MEA), where the reactions occur, and the flow field plates. The plates have many functions in a fuel cell: distribute reactant gases (hydrogen and air or oxygen), conduct electrical current, remove heat and water from the electrodes and make the cell robust. The cost of the bipolar plates corresponds up to 45% of the total stack costs. The Computational Fluid Dynamic (CFD) is a very useful tool to simulate hydrogen and oxygen gases flow channels, to reduce the costs of bipolar plates production and to optimize mass transport. Two types of flow channels were studied. The first type was a commercial plate by ELECTROCELL and the other was entirely projected at Programa de Celula a Combustivel (IPEN/CNEN-SP) and the experimental data were compared with modelling results. Optimum values for each set of variables were obtained and the models verification was carried out in order to show the feasibility of this technique to improve fuel cell efficiency. (author)

  14. CFD analysis of municipal solid waste combustion using detailed chemical kinetic modelling.

    Science.gov (United States)

    Frank, Alex; Castaldi, Marco J

    2014-08-01

    Nitrogen oxides (NO x ) emissions from the combustion of municipal solid waste (MSW) in waste-to-energy (WtE) facilities are receiving renewed attention to reduce their output further. While NO x emissions are currently 60% below allowed limits, further reductions will decrease the air pollution control (APC) system burden and reduce consumption of NH3. This work combines the incorporation of the GRI 3.0 mechanism as a detailed chemical kinetic model (DCKM) into a custom three-dimensional (3D) computational fluid dynamics (CFD) model fully to understand the NO x chemistry in the above-bed burnout zones. Specifically, thermal, prompt and fuel NO formation mechanisms were evaluated for the system and a parametric study was utilized to determine the effect of varying fuel nitrogen conversion intermediates between HCN, NH3 and NO directly. Simulation results indicate that the fuel nitrogen mechanism accounts for 92% of the total NO produced in the system with thermal and prompt mechanisms accounting for the remaining 8%. Results also show a 5% variation in final NO concentration between HCN and NH3 inlet conditions, demonstrating that the fuel nitrogen intermediate assumed is not significant. Furthermore, the conversion ratio of fuel nitrogen to NO was 0.33, revealing that the majority of fuel nitrogen forms N2. PMID:25005043

  15. Comparative Study for Modeling Reactor Internal Geometry in CFD Simulation of PHWR Internal Flow

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Gong Hee; Woo, Sweng Woong; Cheong, Ae Ju [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2013-10-15

    The main objective of the present study is to compare the results predicted by using either the real geometry of tubes or porous medium assumption and to assess the prediction performance of both methods. Estimating the local subcooling of the moderator in a CANDU calandria under transient conditions is one of the major concerns in the CANDU safety analysis. Therefore extensive CFD analyses have been performed for predicting the moderator temperature in a CANDU calandria or its similar shape. However most of previous studies used a porous medium assumption instead of considering the real geometry of calandria tube. A porous medium assumption has some possible weaknesses; The increased production of turbulence due to vortex shedding in the wake of the individual tubes is not considered in the turbulence model. It is difficult to identify the true effects of the outer ring of calandria tubes on the generation of the highly non-uniform flows in the reflector region. It is not clear how well the pressure loss models quantitatively represent the three-dimensional effects of the turbulent flows through the calandria tubes.

  16. Development of a flocculation sub-model for a 3-D CFD model based on rectangular settling tanks.

    Science.gov (United States)

    Gong, M; Xanthos, S; Ramalingam, K; Fillos, J; Beckmann, K; Deur, A; McCorquodale, J A

    2011-01-01

    To assess performance and evaluate alternatives to improve the efficiency of rectangular Gould II type final settling tanks (FSTs), New York City Department of Environmental Protection and City College of NY developed a 3D computer model depicting the actual structural configuration of the tanks and the current and proposed hydraulic and solids loading rates. Fluent 6.3.26™ was the base platform for the computational fluid dynamics (CFD) model, for which sub-models of the SS settling characteristics, turbulence, flocculation and rheology were incorporated. This was supplemented by field and bench scale experiments to quantify the coefficients integral to the sub-models. The 3D model developed can be used to consider different baffle arrangements, sludge withdrawal mechanisms and loading alternatives to the FSTs. Flocculation in the front half of the rectangular tank especially in the region before and after the inlet baffle is one of the vital parameters that influences the capture efficiency of SS. Flocculation could be further improved by capturing medium and small size particles by creating an additional zone with an in-tank baffle. This was one of the methods that was adopted in optimizing the performance of the tank where the CCNY 3D CFD model was used to locate the in-tank baffle position. This paper describes the development of the flocculation sub-model and the relationship of the flocculation coefficients in the known Parker equation to the initial mixed liquor suspended solids (MLSS) concentration X0. A new modified equation is proposed removing the dependency of the breakup coefficient to the initial value of X0 based on preliminary data using normal and low concentration mixed liquor suspended solids values in flocculation experiments performed.

  17. Sensitivity study on a CFD model for the analysis of moderator fluid flow and heat transfer inside CANDU calandria

    International Nuclear Information System (INIS)

    In this paper, sensitivity study on a CFD model for the accurate analysis of moderator fluid flow and heat transfer inside calandria is conducted. Two main items, i.e. porous medium assumption and turbulence model, are considered for in-line tube bank and Sheridan Park Engineering Laboratory (SPEL) experiment. Using the commercial flow solver, FLUENT, the prediction to consider the real geometry of fuel channels is compared to previous results conducted with the porous medium assumption using the isotropic pressure loss model. Also, the prediction performance of various turbulence models (e.g. k-ε model, Reynolds stress model, etc.) is assessed. (author)

  18. Integration of Engine, Plume, and CFD Analyses in Conceptual Design of Low-Boom Supersonic Aircraft

    Science.gov (United States)

    Li, Wu; Campbell, Richard; Geiselhart, Karl; Shields, Elwood; Nayani, Sudheer; Shenoy, Rajiv

    2009-01-01

    This paper documents an integration of engine, plume, and computational fluid dynamics (CFD) analyses in the conceptual design of low-boom supersonic aircraft, using a variable fidelity approach. In particular, the Numerical Propulsion Simulation System (NPSS) is used for propulsion system cycle analysis and nacelle outer mold line definition, and a low-fidelity plume model is developed for plume shape prediction based on NPSS engine data and nacelle geometry. This model provides a capability for the conceptual design of low-boom supersonic aircraft that accounts for plume effects. Then a newly developed process for automated CFD analysis is presented for CFD-based plume and boom analyses of the conceptual geometry. Five test cases are used to demonstrate the integrated engine, plume, and CFD analysis process based on a variable fidelity approach, as well as the feasibility of the automated CFD plume and boom analysis capability.

  19. A study on the dependency between turbulent models and mesh configurations of CFD codes

    Energy Technology Data Exchange (ETDEWEB)

    Bang, Jungjin; Heo, Yujin; Jerng, Dong-Wook [CAU, Seoul (Korea, Republic of)

    2015-10-15

    This paper focuses on the analysis of the behavior of hydrogen mixing and hydrogen stratification, using the GOTHIC code and the CFD code. Specifically, we examined the mesh sensitivity and how the turbulence model affects hydrogen stratification or hydrogen mixing, depending on the mesh configuration. In this work, sensitivity analyses for the meshes and the turbulence models were conducted for missing and stratification phenomena. During severe accidents in a nuclear power plants, the generation of hydrogen may occur and this will complicate the atmospheric condition of the containment by causing stratification of air, steam, and hydrogen. This could significantly impact containment integrity analyses, as hydrogen could be accumulated in local region. From this need arises the importance of research about stratification of gases in the containment. Two computation fluid dynamics code, i.e. GOTHIC and STAR-CCM+ were adopted and the computational results were benchmarked against the experimental data from PANDA facility. The main findings observed through the present work can be summarized as follows: 1) In the case of the GOTHIC code, it was observed that the aspect ratio of the mesh was found more important than the mesh size. Also, if the number of the mesh is over 3,000, the effects of the turbulence models were marginal. 2) For STAR-CCM+, the tendency is quite different from the GOTHIC code. That is, the effects of the turbulence models were small for fewer number of the mesh, however, as the number of mesh increases, the effects of the turbulence models becomes significant. Another observation is that away from the injection orifice, the role of the turbulence models tended to be important due to the nature of mixing process and inducted jet stream.

  20. Combining CFD simulations with blockoriented heatflow-network model for prediction of photovoltaic energy-production

    Science.gov (United States)

    Haber, I. E.; Farkas, I.

    2011-01-01

    The exterior factors which influencing the working circumstances of photovoltaic modules are the irradiation, the optical air layer (Air Mass - AM), the irradiation angle, the environmental temperature and the cooling effect of the wind. The efficiency of photovoltaic (PV) devices is inversely proportional to the cell temperature and therefore the mounting of the PV modules can have a big affect on the cooling, due to wind flow-around and naturally convection. The construction of the modules could be described by a heatflow-network model, and that can define the equation which determines the cells temperature. An equation like this can be solved as a block oriented model with hybrid-analogue simulator such as Matlab-Simulink. In view of the flow field and the heat transfer, witch was calculated numerically, the heat transfer coefficients can be determined. Five inflow rates were set up for both pitched and flat roof cases, to let the trend of the heat transfer coefficient know, while these functions can be used for the Matlab/Simulink model. To model the free convection flows, the Boussinesq-approximation were used, integrated into the Navier-Stokes equations and the energy equation. It has been found that under a constant solar heat gain, the air velocity around the modules and behind the pitched-roof mounted module is increasing, proportionately to the wind velocities, and as result the heat transfer coefficient increases linearly, and can be described by a function in both cases. To the block based model the meteorological parameters and the results of the CFD simulations as single functions were attached. The final aim was to make a model that could be used for planning photovoltaic systems, and define their accurate performance for better sizing of an array of modules.

  1. Methodology for experimental validation of a CFD model for predicting noise generation in centrifugal compressors

    International Nuclear Information System (INIS)

    Highlights: • A DES of a turbocharger compressor working at peak pressure point is performed. • In-duct pressure signals are measured in a steady flow rig with 3-sensor arrays. • Pressure spectra comparison is performed as a validation for the numerical model. • A suitable comparison methodology is developed, relying on pressure decomposition. • Whoosh noise at outlet duct is detected in experimental and numerical spectra. - Abstract: Centrifugal compressors working in the surge side of the map generate a broadband noise in the range of 1–3 kHz, named as whoosh noise. This noise is perceived at strongly downsized engines operating at particular conditions (full load, tip-in and tip-out maneuvers). A 3-dimensional CFD model of a centrifugal compressor is built to analyze fluid phenomena related to whoosh noise. A detached eddy simulation is performed with the compressor operating at the peak pressure point of 160 krpm. A steady flow rig mounted on an anechoic chamber is used to obtain experimental measurements as a means of validation for the numerical model. In-duct pressure signals are obtained in addition to standard averaged global variables. The numerical simulation provides global variables showing excellent agreement with experimental measurements. Pressure spectra comparison is performed to assess noise prediction capability of numerical model. The influence of the type and position of the virtual pressure probes is evaluated. Pressure decomposition is required by the simulations to obtain meaningful spectra. Different techniques for obtaining pressure components are analyzed. At the simulated conditions, a broadband noise in 1–3 kHz frequency band is detected in the experimental measurements. This whoosh noise is also captured by the numerical model

  2. Simulation of hydrogen mitigation in catalytic recombiner. Part-II: Formulation of a CFD model

    Energy Technology Data Exchange (ETDEWEB)

    Prabhudharwadkar, Deoras M. [Department of Mechanical Engineering, Indian Institute of Technology-Bombay, Powai, Mumbai 400076 (India); Iyer, Kannan N., E-mail: kiyer@me.iitb.ac.i [Department of Mechanical Engineering, Indian Institute of Technology-Bombay, Powai, Mumbai 400076 (India)

    2011-05-15

    Research highlights: Hydrogen transport in containment with recombiners is a multi-scale problem. A novel methodology worked out to lump the recombiner characteristics. Results obtained using commercial code FLUENT are cast in the form of correlations. Hence, coarse grids can obtain accurate distribution of H{sub 2} in containment. Satisfactory working of the methodology is clearly demonstrated. - Abstract: This paper aims at formulation of a model compatible with CFD code to simulate hydrogen distribution and mitigation using a Passive Catalytic Recombiner in the Nuclear power plant containments. The catalytic recombiner is much smaller in size compared to the containment compartments. In order to fully resolve the recombination processes during the containment simulations, it requires the geometric details of the recombiner to be modelled and a very fine mesh size inside the recombiner channels. This component when integrated with containment mixing calculations would result in a large number of mesh elements which may take large computational times to solve the problem. This paper describes a method to resolve this simulation difficulty. In this exercise, the catalytic recombiner alone was first modelled in detail using the best suited option to describe the reaction rate. A detailed parametric study was conducted, from which correlations for the heat of reaction (hence the rate of reaction) and the heat transfer coefficient were obtained. These correlations were then used to model the recombiner channels as single computational cells providing necessary volumetric sources/sinks to the energy and species transport equations. This avoids full resolution of these channels, thereby allowing larger mesh size in the recombiners. The above mentioned method was successfully validated using both steady state and transient test problems and the results indicate very satisfactory modelling of the component.

  3. Modern multicore and manycore architectures: Modelling, optimisation and benchmarking a multiblock CFD code

    Science.gov (United States)

    Hadade, Ioan; di Mare, Luca

    2016-08-01

    Modern multicore and manycore processors exhibit multiple levels of parallelism through a wide range of architectural features such as SIMD for data parallel execution or threads for core parallelism. The exploitation of multi-level parallelism is therefore crucial for achieving superior performance on current and future processors. This paper presents the performance tuning of a multiblock CFD solver on Intel SandyBridge and Haswell multicore CPUs and the Intel Xeon Phi Knights Corner coprocessor. Code optimisations have been applied on two computational kernels exhibiting different computational patterns: the update of flow variables and the evaluation of the Roe numerical fluxes. We discuss at great length the code transformations required for achieving efficient SIMD computations for both kernels across the selected devices including SIMD shuffles and transpositions for flux stencil computations and global memory transformations. Core parallelism is expressed through threading based on a number of domain decomposition techniques together with optimisations pertaining to alleviating NUMA effects found in multi-socket compute nodes. Results are correlated with the Roofline performance model in order to assert their efficiency for each distinct architecture. We report significant speedups for single thread execution across both kernels: 2-5X on the multicore CPUs and 14-23X on the Xeon Phi coprocessor. Computations at full node and chip concurrency deliver a factor of three speedup on the multicore processors and up to 24X on the Xeon Phi manycore coprocessor.

  4. CFD Modeling of Sodium-Oxide Deposition in Sodium-Cooled Fast Reactor Compact Heat Exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Tatli, Emre; Ferroni, Paolo; Mazzoccoli, Jason

    2015-09-02

    The possible use of compact heat exchangers (HXs) in sodium-cooled fast reactors (SFR) employing a Brayton cycle is promising due to their high power density and resulting small volume in comparison with conventional shell-and-tube HXs. However, the small diameter of their channels makes them more susceptible to plugging due to Na2O deposition during accident conditions. Although cold traps are designed to reduce oxygen impurity levels in the sodium coolant, their failure, in conjunction with accidental air ingress into the sodium boundary, could result in coolant oxygen levels that are above the saturation limit in the cooler parts of the HX channels. This can result in Na2O crystallization and the formation of solid deposits on cooled channel surfaces, limiting or even blocking coolant flow. The development of analysis tools capable of modeling the formation of these deposits in the presence of sodium flow will allow designers of SFRs to properly size the HX channels so that, in the scenario mentioned above, the reactor operator has sufficient time to detect and react to the affected HX. Until now, analytical methodologies to predict the formation of these deposits have been developed, but never implemented in a high-fidelity computational tool suited to modern reactor design techniques. This paper summarizes the challenges and the current status in the development of a Computational Fluid Dynamics (CFD) methodology to predict deposit formation, with particular emphasis on sensitivity studies on some parameters affecting deposition.

  5. Film Cooled Recession of SiC/SiC Ceramic Matrix Composites: Test Development, CFD Modeling and Experimental Observations

    Science.gov (United States)

    Zhu, Dongming; Sakowski, Barbara A.; Fisher, Caleb

    2014-01-01

    SiCSiC ceramic matrix composites (CMCs) systems will play a crucial role in next generation turbine engines for hot-section component applications because of their ability to significantly increase engine operating temperatures, reduce engine weight and cooling requirements. However, the environmental stability of Si-based ceramics in high pressure, high velocity turbine engine combustion environment is of major concern. The water vapor containing combustion gas leads to accelerated oxidation and corrosion of the SiC based ceramics due to the water vapor reactions with silica (SiO2) scales forming non-protective volatile hydroxide species, resulting in recession of the ceramic components. Although environmental barrier coatings are being developed to help protect the CMC components, there is a need to better understand the fundamental recession behavior of in more realistic cooled engine component environments.In this paper, we describe a comprehensive film cooled high pressure burner rig based testing approach, by using standardized film cooled SiCSiC disc test specimen configurations. The SiCSiC specimens were designed for implementing the burner rig testing in turbine engine relevant combustion environments, obtaining generic film cooled recession rate data under the combustion water vapor conditions, and helping developing the Computational Fluid Dynamics (CFD) film cooled models and performing model validation. Factors affecting the film cooled recession such as temperature, water vapor concentration, combustion gas velocity, and pressure are particularly investigated and modeled, and compared with impingement cooling only recession data in similar combustion flow environments. The experimental and modeling work will help predict the SiCSiC CMC recession behavior, and developing durable CMC systems in complex turbine engine operating conditions.

  6. Effect of longwall face advance rate on spontaneous heating process in the gob area - CFD modelling

    Energy Technology Data Exchange (ETDEWEB)

    Boleslav Taraba; Zdenek Michalec [University of Ostrava, Ostrava (Czech Republic). Dept. of Chemistry

    2011-08-15

    A commercial CFD software programme, FLUENT, was used to study the oxidation process of coal in the mined-out longwall (gob) area. A three-dimensional, single-phase model with a continuously advancing longwall face has been developed. For the model, the gob longwall area was designed on the basis of the actual longwall panel operating in the Ostrava-Karvina Coal Mines (OKD, Czech Republic). The behaviour of the coal to oxygen was modelled using the results arising mainly from the former laboratory-scale experiments with Czech bituminous coals. Basically, the technique of pulse flow calorimetry and measurements at a continuous airflow reactor were applied during the laboratory investigations. In the contribution, the main focus was to understand the effect of the longwall face advancing speed on the oxidation heat production as well as evolution of the gases in the gob area. Simultaneously, the effect of coal crushing in the mined-out area on the spontaneous heating process was examined. Numerical simulations confirmed the existence of a 'favourable' zone for the onset and development of the spontaneous heating process in the gob area. The location and the maximal temperature reached in the 'favourable' zone were found to be significantly affected by the advancing rate of the coalface. The slower the advancing rate is, the higher the maximal temperature and smaller the depth of the 'favourable' zone in the gob area are. When the rate drops to a certain 'critical' value, spontaneous heating turns to flammable combustion of the coal. The value of the 'critical' advancing rate was confirmed to increase if the grain size of the coal left in the gob decreases. Numerical examinations of carbon monoxide concentrations then proved that small incidents of spontaneous heating could occur in the gob area that need not be detected in the airflow of the longwall tail gate. 46 refs., 8 figs., 2 tabs.

  7. Numerical estimation of wall friction ratio near the pseudo-critical point with CFD-models

    Energy Technology Data Exchange (ETDEWEB)

    Angelucci, M. [University of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy); Ambrosini, W., E-mail: w.ambrosini@ing.unipi.it [University of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy); Forgione, N. [University of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy)

    2013-11-15

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region across the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models are adopted, making use of refined near-wall discretisation as required by the constraint y{sup +} < 1 at the wall. In particular, the Lien k–ε and the SST k–ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy–Weisbach friction factors, based on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way.

  8. Prediction of wall friction for fluids at supercritical pressure with CFD models

    Energy Technology Data Exchange (ETDEWEB)

    Angelucci, M.; Ambrosini, W.; Forgione, N., E-mail: w.ambrosini@ing.unipi.it, E-mail: n.forgione@ing.unipi.it [Univ. of Pisa, Dipartimento di Ingegneria Meccanica Nucleare e della Produzione (Italy)

    2011-07-01

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region around the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models is adopted, making use of refined near-wall discretisations as required by the constraint y{sup +} < 1 at the wall. In particular, the Lien k-ε and the SST k-ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy-Weisbach friction factors, basing on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way. (author)

  9. Prediction of wall friction for fluids at supercritical pressure with CFD models

    International Nuclear Information System (INIS)

    In this paper, the STAR-CCM+ CFD code is used in the attempt to reproduce the values of friction factor observed in experimental data at supercritical pressures at various operating conditions. A short survey of available data and correlations for smooth pipe friction in circular pipes puts the basis for the discussion, reporting observed trends of friction factor in the liquid-like and the gas-like regions and within the transitional region around the pseudo-critical temperature. For smooth pipes, a general decrease of the friction factor in the transitional region is reported, constituting one of the relevant effects to be predicted by the computational fluid-dynamic models. A limited number of low-Reynolds number models is adopted, making use of refined near-wall discretisations as required by the constraint y+ < 1 at the wall. In particular, the Lien k-ε and the SST k-ω models are considered. The values of the wall shear stress calculated by the code are then post-processed on the basis of bulk fluid properties to obtain the Fanning and then the Darcy-Weisbach friction factors, basing on their classical definitions. The obtained values are compared with those provided by experimental tests and correlations, finding a reasonable qualitative agreement. Expectedly, the agreement is better in the gas-like and liquid-like regions, where fluid property changes are moderate, than in the transitional region, where the trends provided by available correlations are reproduced only in a qualitative way. (author)

  10. Computational Fluid Dynamics (CFD) applications in rocket propulsion analysis and design

    Science.gov (United States)

    McConnaughey, P. K.; Garcia, R.; Griffin, L. W.; Ruf, J. H.

    1993-11-01

    Computational Fluid Dynamics (CFD) has been used in recent applications to affect subcomponent designs in liquid propulsion rocket engines. This paper elucidates three such applications for turbine stage, pump stage, and combustor chamber geometries. Details of these applications include the development of a high turning airfoil for a gas generator (GG) powered, liquid oxygen (LOX) turbopump, single-stage turbine using CFD as an integral part of the design process. CFD application to pump stage design has emphasized analysis of inducers, impellers, and diffuser/volute sections. Improvements in pump stage impeller discharge flow uniformity have been seen through CFD optimization on coarse grid models. In the area of combustor design, recent CFD analysis of a film cooled ablating combustion chamber has been used to quantify the interaction between film cooling rate, chamber wall contraction angle, and geometry and their effects of these quantities on local wall temperature. The results are currently guiding combustion chamber design and coolant flow rate for an upcoming subcomponent test. Critical aspects of successful integration of CFD into the design cycle includes a close-coupling of CFD and design organizations, quick turnaround of parametric analyses once a baseline CFD benchmark has been established, and the use of CFD methodology and approaches that address pertinent design issues. In this latter area, some problem details can be simplified while retaining key physical aspects to maintain analytical integrity.

  11. Multi-scale Model Coupling for CFD Simulations of Discharge Dispersion in the Sea

    Science.gov (United States)

    Robinson, D.; Wood, M.; Piggott, M. D.; Gorman, G.

    2014-12-01

    The processes that influence the dispersion of effluent discharges in the sea occur over a wide range of length and time scales. The distance that effluent can travel before it is considered mixed can be several kilometres, whereas the turbulent eddies that affect the near-field mixing of a discharge can be as small as a few centimetres. The range of scales that are involved mean that it is not generally practical to include all influencing physical phenomena within one model. Typically, the modelling of effluent dispersion is performed using two separate numerical models: a local model of the outlet(s), including the near-field effects of momentum, buoyancy and turbulence; and a larger scale model that can include the far-field effects of tidal-, wind- and wave-driven-currents, water depth variations, atmospheric fluxes, and Coriolis forces. The boundary between the two models is often not strictly defined, but is usually placed at the transition from where the behaviour of the effluent is dominated by the ambient environment, rather than the discharge characteristics and outfall configuration. In most real applications, this transition line varies considerably in time and space. This paper presents the findings of collaborative research between the Applied Modelling and Computation Group (AMCG) at Imperial College London, UK, and HR Wallingford Ltd. Results are presented using a range of coupling methods to link the near- and far-field mixing regions. An idealised domain and tidal conditions are used, with the outfall and ambient conditions typical of those found at small coastal desalination plants. Open-source CFD code Fluidity is used for both the near-field and far-field modelling. Fluidity scales well when run in parallel on large numbers of cores. It also has an anisotropic adaptive mesh capability which allows local control over solution accuracy throughout the domain. This combination means that accuracy can be achieved without excessive time costs, with

  12. CFD model of air movement in ventilated façade: comparison between natural and forced air flow

    Directory of Open Access Journals (Sweden)

    Miguel Mora Pérez, Gonzalo López Patiño, P. Amparo López Jiménez

    2013-01-01

    Full Text Available This study describes computational fluid dynamics (CFD modeling of ventilated façade. Ventilated façades are normal façade but it has an extra channel between the concrete wall and the (double skin façade. Several studies found in the literature are carried out with CFD simulations about the behavior of the thermodynamic phenomena of the double skin façades systems. These studies conclude that the presence of the air gap in the ventilated façade affects the temperature in the building skin, causing a cooling effect, at least in low-rise buildings. One of the most important factors affecting the thermal effects of ventilated façades is the wind velocity. In this contribution, a CFD analysis applied on two different velocity assumptions for air movement in the air gap of a ventilated façade is presented. A comparison is proposed considering natural wind induced velocity with forced fan induced velocity in the gap. Finally, comparing temperatures in the building skin, the differences between both solutions are described determining that, related to the considered boundary conditions, there is a maximum height in which the thermal effect of the induced flow is significantly observed.

  13. CFD analysis and flow model reduction for surfactant production in helix reactor = CFD analiza i redukcija modela strujanja za proizvodnju surfaktanta u helix reaktoru

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2015-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simulated

  14. A CFD Model for Wave Transformation and Breaking in the Surf Zone

    Science.gov (United States)

    Chopakatla, S. C.; Lippmann, T. C.; Richardson, J. E.; Thornton, E. B.; Holman, R. A.

    2002-12-01

    Wind-generated surface gravity waves are the major driving force for nearshore circulation and sediment transport. As waves shoal in shallow coastal waters, spectra evolve strongly owing to refraction, nonlinear energy transfers, and dissipation caused by wave breaking and bottom friction. Although considerable progress has been made in modeling wave propagation over complex bottom topography, the dissipation mechanisms are still poorly understood. As a consequence, wave transformation models for the surf zone use crude descriptions of the wave breaking process based on simple saturation criteria or empirical probability distributions that do not always work well for the range of bathymetric and wave conditions commonly observed in nature. In this report, we will discuss the results of studies made with the commercially available Computational Fluid Dynamics (CFD) software system known as FLOW-3D (Flow Science, Inc., Sante Fe, NM). FLOW-3D is designed to solve transient, free surface flow problems based on the solution of the Navier-Stokes equations in three-dimensions. As part of FLOW-3D's formulation, the dissipation of energy is determined by use of coupled turbulence closure schemes (e.g., closure schemes based on the solution of turbulent kinetic energy transport equations). In this study, fine scale pressures and velocities are computed over a two-dimensional beach profile measured during the 1990 Delilah experiment. The model is driven by observed wave spectra obtained in 8 meter water depths, and results compared with a cross-shore array of pressure sensors and current meters spanning the width of the surf zone. In the calculations, wave breaking is a natural consequence of the fluid dynamics and does not require the use of empirical formulations, or breaking criteria. The spatial and temporal variability in the wave breaking locations will be compared with video observations obtained during the experiment. Good comparison between modeled and observed wave

  15. A Transient 3D-CFD Model Incorporating Biological Processes for Use in Tissue Engineering

    DEFF Research Database (Denmark)

    Krühne, Ulrich; Wendt, D.; Martin, I.;

    2010-01-01

    after 2, 8 and 13 days. The development of the cells is compared to the simulated growth of cells and it is attempted to draw a conclusion about the impact of the shear stress on the cell growth. Keyword: Computational fluid dynamics (CFD),Micro pores,Scaffold,Bioreactor,Fluid structure interaction,Tissue...... engineering...

  16. CFD analysis and flow model reduction for surfactant production in helix reactor

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2014-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in the commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simul

  17. Physical characterization of biomass fuels prepared for suspension firing in utility boilers for CFD modelling

    DEFF Research Database (Denmark)

    Rosendahl, Lasse; Yin, Chungen; Kær, Søren Knudsen;

    2007-01-01

    shapes. The sample is subdivided by straw type, and coherent size, type and mass distribution parameters are reported for the entire sample. This type of data is necessary in order to use CFD reliably as a design and retrofit tool for co-firing biomass with fossil fuels, as the combustion processes...

  18. Development of a %22solar patch%22 calculator to evaluate heliostat-field irradiance as a boundary condition in CFD models.

    Energy Technology Data Exchange (ETDEWEB)

    Khalsa, Siri Sahib; Ho, Clifford Kuofei

    2010-04-01

    A rigorous computational fluid dynamics (CFD) approach to calculating temperature distributions, radiative and convective losses, and flow fields in a cavity receiver irradiated by a heliostat field is typically limited to the receiver domain alone for computational reasons. A CFD simulation cannot realistically yield a precise solution that includes the details within the vast domain of an entire heliostat field in addition to the detailed processes and features within a cavity receiver. Instead, the incoming field irradiance can be represented as a boundary condition on the receiver domain. This paper describes a program, the Solar Patch Calculator, written in Microsoft Excel VBA to characterize multiple beams emanating from a 'solar patch' located at the aperture of a cavity receiver, in order to represent the incoming irradiance from any field of heliostats as a boundary condition on the receiver domain. This program accounts for cosine losses; receiver location; heliostat reflectivity, areas and locations; field location; time of day and day of year. This paper also describes the implementation of the boundary conditions calculated by this program into a Discrete Ordinates radiation model using Ansys{reg_sign} FLUENT (www.fluent.com), and compares the results to experimental data and to results generated by the code DELSOL.

  19. Development of a %22Solar Patch%22 calculator to evaluate heliostat-field irradiance as a boundary condition in CFD models.

    Energy Technology Data Exchange (ETDEWEB)

    Khalsa, Siri Sahib S. (Sandia Staffing Alliance); Ho, Clifford Kuofei

    2010-05-01

    A rigorous computational fluid dynamics (CFD) approach to calculating temperature distributions, radiative and convective losses, and flow fields in a cavity receiver irradiated by a heliostat field is typically limited to the receiver domain alone for computational reasons. A CFD simulation cannot realistically yield a precise solution that includes the details within the vast domain of an entire heliostat field in addition to the detailed processes and features within a cavity receiver. Instead, the incoming field irradiance can be represented as a boundary condition on the receiver domain. This paper describes a program, the Solar Patch Calculator, written in Microsoft Excel VBA to characterize multiple beams emanating from a 'solar patch' located at the aperture of a cavity receiver, in order to represent the incoming irradiance from any field of heliostats as a boundary condition on the receiver domain. This program accounts for cosine losses; receiver location; heliostat reflectivity, areas and locations; field location; time of day and day of year. This paper also describes the implementation of the boundary conditions calculated by this program into a Discrete Ordinates radiation model using Ansys{reg_sign} FLUENT (www.fluent.com), and compares the results to experimental data and to results generated by the code DELSOL.

  20. CFD studies on the phenomena around counter-current flow limitations of gas/liquid two-phase flow in a model of a PWR hot leg

    Energy Technology Data Exchange (ETDEWEB)

    Deendarlianto, E-mail: deendarlianto@ugm.ac.id [Helmholtz-Zentrum Dresden-Rossendorf e.V., Institute of Safety Research, P.O. Box 510 119, D-01314 Dresden (Germany); Department of Mechanical and Industrial Engineering, Faculty of Engineering, Gadjah Mada University, Jalan Grafika No. 2, Yogyakarta 55281 (Indonesia); Hoehne, Thomas; Lucas, Dirk; Vallee, Christophe [Helmholtz-Zentrum Dresden-Rossendorf e.V., Institute of Safety Research, P.O. Box 510 119, D-01314 Dresden (Germany); Zabala, Gustavo Adolfo Montoya [Department of Chemical Engineering, Simon Bolivar University, Valle of Sartenejas, Caracas 1080 (Venezuela, Bolivarian Republic of)

    2011-12-15

    Highlights: Black-Right-Pointing-Pointer We modelled CCFL in a PWR hot leg using Algebraic Interfacial Area Density model. Black-Right-Pointing-Pointer The model is able to distinguish the local flow morphologies. Black-Right-Pointing-Pointer Test fluids are air-water and steam-water. Black-Right-Pointing-Pointer Calculated CCFL and water level are in good agreement with experimental data. - Abstract: In order to improve the understanding of counter-current two-phase flow and to validate new physical models, CFD simulations of a 1/3rd scale model of the hot leg of a German Konvoi pressurized water reactor (PWR) with rectangular cross section were performed. Selected counter-current flow limitation (CCFL) experiments conducted at Helmholtz-Zentrum Dresden-Rossendorf (HZDR) were calculated with ANSYS CFX using the multi-fluid Euler-Euler modelling approach. The transient calculations were carried out using a gas/liquid inhomogeneous multiphase flow model coupled with a shear stress transport (SST) turbulence model. In the simulation, the drag law was approached by a newly developed correlation of the drag coefficient in the Algebraic Interfacial Area Density (AIAD) model. The model can distinguish the bubbles, droplets and the free surface using the local liquid phase volume fraction value. A comparison with the high-speed video observations shows a good qualitative agreement. The results indicate also a quantitative agreement between calculations and experimental data for the CCFL characteristics and the water level inside the hot leg channel.

  1. A CFD model for analysis of performance, water and thermal distribution, and mechanical related failure in PEM fuel cells

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi

    2016-07-01

    Full Text Available This paper presents a comprehensive three–dimensional, multi–phase, non-isothermal model of a Proton Exchange Membrane (PEM fuel cell that incorporates significant physical processes and key parameters affecting the fuel cell performance. The model construction involves equations derivation, boundary conditions setting, and solution algorithm flow chart. Equations in gas flow channels, gas diffusion layers (GDLs, catalyst layers (CLs, and membrane as well as equations governing cell potential and hygro-thermal stresses are described. The algorithm flow chart starts from input of the desired cell current density, initialization, iteration of the equations solution, and finalizations by calculating the cell potential. In order to analyze performance, water and thermal distribution, and mechanical related failure in the cell, the equations are solved using a computational fluid dynamic (CFD code. Performance analysis includes a performance curve which plots the cell potential (Volt against nominal current density (A/cm2 as well as losses. Velocity vectors of gas and liquid water, liquid water saturation, and water content profile are calculated. Thermal distribution is then calculated together with hygro-thermal stresses and deformation. The CFD model was executed under boundary conditions of 20°C room temperature, 35% relative humidity, and 1 MPA pressure on the lower surface. Parameters values of membrane electrode assembly (MEA and other base conditions are selected. A cell with dimension of 1 mm x 1 mm x 50 mm is used as the object of analysis. The nominal current density of 1.4 A/cm2 is given as the input of the CFD calculation. The results show that the model represents well the performance curve obtained through experiment. Moreover, it can be concluded that the model can help in understanding complex process in the cell which is hard to be studied experimentally, and also provides computer aided tool for design and optimization of PEM

  2. Simulation of unprotected LOFA in MTR reactors using a mix CFD and one-d computation tool

    International Nuclear Information System (INIS)

    Highlights: • No CFD study of LOFA without SCRAM in MTR reactor has been found in the literature. • A chart that provides safety limits during the unprotected LOFA sequences is provided. • The CFD model developed can be adapted for simulating reactivity insertion accident. - Abstract: CFD is expected to feature more frequently in reactor thermal hydraulics. The reason for the increased use of multidimensional CFD methods is not only the increased availability of capable computer systems but also the ongoing drive to improve and reduce uncertainty in our predictions of important phenomena. In this work, a CFD model coupled with the reactor point kinetics equations is developed using the CFD code, Fluent to simulate loss of flow accident (LOFA) without SCRAM in a typical material testing reactor (MTR). The CFD model is used to simulate the core behavior during transient up to the onset of nucleate boiling (ONB) point. PARET code is used not only to validate the CFD model but also to complete simulation during the sub-cooled boiling regime. The focus is on establishing a new CFD approach in the reactor safety analysis and determining the two-phase flow stability boundaries as function of initial reactor conditions. Both ONB and onset of flow instability (OFI) is predicted. Besides a useful chart is provided, which describes the stability region in terms of initial reactor power, core inlet temperature, and power peaking factor

  3. CFD modeling of reaction and mass transfer through a single pellet:Catalytic oxidative coupling of methane

    Institute of Scientific and Technical Information of China (English)

    Siavash Seyednej adian; Nakisa Yaghobi; Ramin Maghrebi; Leila Vafajoo

    2011-01-01

    In this study a mathematical model of a small scale single pellet for the oxidative coupling of methane (OCM) over titanite pervoskité isdeveloped.The method is based on a computational fluid dynamics (CFD) code which known as Fluent may be adopted to model the reactions that take place inside the porous catalyst pellet.The steady state single pellet model is coupled with a kinetic model and the intra-pellet concentration profiles of species are provided.Subsequent to achieving this goal,a nonlinear reaction network consisting of nine catalytic reactions and one gas phase reaction as an external program is successfully implemented to CFD-code as a reaction term in solving the equations.This study is based on the experimental design which is conducted in a differential reactor with a Sn/BaTiO3 catalyst (7-8 mesh) at atmospheric pressure,GHSV of 12000 h-1,ratio of methane to oxygen of 2,and three different temperatures of 1023,1048 and 1073 K.The modeling results such as selectivity and conversion at the pellet exit are in good agreement with the experimental data.Therefore,it is suggested that to achieve high yield in OCM process the modeling of the single pellet should be considered as the heart of catalytic fixed bed reactor.

  4. An approach to improve the separation of solid-liquid suspensions in inclined plate settlers: CFD simulation and experimental validation.

    Science.gov (United States)

    Salem, A I; Okoth, G; Thöming, J

    2011-05-01

    The most important requirements for achieving effective separation conditions in inclined plate settler (IPS) are its hydraulic performance and the equal distribution of suspensions between settler channels, both of which depend on the inlet configuration. In this study, three different inlet structures were used to explore the effect of feeding a bench scale IPS via a nozzle distributor on its hydraulic performance and separation efficiency. Experimental and Computational Fluid Dynamic (CFD) analyses were carried out to evaluate the hydraulic characteristics of the IPS. Comparing the experimental results with the predicted results by CFD simulation implies that the CFD software can play a useful role in studying the hydraulic performance of the IPS by employing residence time distribution (RTD) curves. The results also show that the use of a nozzle distributor can significantly enhance the hydraulic performance of the IPS, which contributes to the improvement of its separation efficiency. PMID:21546049

  5. Modeling industrial thickener using computational fluid dynamics (CFD), a case study:Tailing thickener in the Sarcheshmeh copper mine

    Institute of Scientific and Technical Information of China (English)

    Majid Ebrahimzadeh Gheshlaghi; Ataallah Soltani Goharrizi; Alireza Aghajani Shahrivar; Hadi Abdollahi

    2013-01-01

    Separation of particles from liquid in the large gravitational tanks is widely used in mining and industrial wastewater treatment process. Thickener is key unit in the operational processes of hydrometallurgy and is used to separate solid from liquid. In this study, population balance models were combined with com-putational fluid dynamics (CFD) for modeling the tailing thickener. Parameters such as feed flow rate, flocculant dosage, inlet solid percent and feedwell were investigated. CFD was used to simulate the industrial tailing thickener with settled bed of 120 m diameter which is located in the Sarcheshmeh cop-per mine. Important factor of drag force that defines the rake torque of rotating paddles on the bed was also determined. Two phases turbulence model of Eulerian/Eulerian in accordance with turbulence model of k-e was used in the steady-state. Also population balance model consists of 15 groups of particle sizes with Luo and Lehr kernel was used for aggregation/breakage kernel. The simulation results showed good agreement with the operational data.

  6. Analysis of the Hydrogen Reduction Rate of Magnetite Concentrate Particles in a Drop Tube Reactor Through CFD Modeling

    Science.gov (United States)

    Fan, Deqiu; Mohassab, Yousef; Elzohiery, Mohamed; Sohn, H. Y.

    2016-06-01

    A computational fluid dynamics (CFD) approach, coupled with experimental results, was developed to accurately evaluate the kinetic parameters of iron oxide particle reduction. Hydrogen reduction of magnetite concentrate particles was used as a sample case. A detailed evaluation of the particle residence time and temperature profile inside the reactor is presented. This approach eliminates the errors associated with assumptions like constant particle temperature and velocity while the particles travel down a drop tube reactor. The gas phase was treated as a continuum in the Eulerian frame of reference, and the particles are tracked using a Lagrangian approach in which the trajectory and velocity are determined by integrating the equation of particle motion. In addition, a heat balance on the particle that relates the particle temperature to convection and radiation was also applied. An iterative algorithm that numerically solves the governing coupled ordinary differential equations was developed to determine the pre-exponential factor and activation energy that best fit the experimental data.

  7. Insights in hydrodynamics of bubbling fluidized beds at elevated pressure by DEM-CFD approach

    Institute of Scientific and Technical Information of China (English)

    Zahra Mansourpour; Sedighe Karimi; Reza Zarghami; Navid Mostoufi; Rahmat Sotudeh-Gharebagh

    2010-01-01

    A numerical simulation was conducted to study the effect of pressure on bubble dynamics in a gas-solid fluidized bed. The gas flow was modeled using the continuum theory and the solid phase, by the dis-crete element method (DEM). To validate the simulation results, calculated local pressure fluctuations were compared with corresponding experimental data of 1-mm polyethylene particles. It was shown that the model successfully predicts the hydrodynamic features of the fluidized bed as observed in the experiments. Influence of pressure on bubble rise characteristics such as bubble rise path, bubble sta-bility, average bubbles diameter and bubble velocity through the bed was investigated. The simulation results are in conformity with current hydrodynamic theories and concepts for fluidized beds at high pressures. The results show further that elevated pressure reduces bubble growth, velocity and stability and enhances bubble gyration through the bed, leading to change in bed flow structure.

  8. A CFD Approach for Prediction of Unintended Porosities in Aluminum Syntactic Foam: A Preliminary Study

    DEFF Research Database (Denmark)

    Li, Shizhao; Spangenberg, Jon; Hattel, Jesper Henri

    2013-01-01

    Aluminum Syntactic Foam (ASF) is a material with great potential in applications related to lightweight structures and structural damping. However, experimental investigations in literature report that the infiltration process to fabricate ASF often results in incomplete infiltration. Published...... calculates the pressure, velocity and free surface of the aluminum. The results of the numerical model illustrate that this method has great potential of predicting unintended porosities in ASF and thereby optimizing the parameters involved in the infiltration process....

  9. CFD Application and OpenFOAM on the 2-D Model for the Moderator System of Heavy-Water Reactors

    International Nuclear Information System (INIS)

    The flow in the complex pipeline system in a calandria tank of CANDU reactor is transported through the distribution of heat sources, which also exerts the pressure drop to the coolant flow. So the phenomena should be considered as multi-physics both in the viewpoints of heat transfer and fluid dynamics. In this study, we have modeled the calandria tank system as two-dimensional simplified one preliminarily that is yet far from the real objects, but to see the essential physics and to test the possibility of the present CFD(computational fluid dynamics) methods for the thermo-hydraulic problem in the moderator system of heavy-water reactors

  10. A semi-parabolic wake model for large offshore wind farms based on the open source CFD solver OpenFOAM

    Directory of Open Access Journals (Sweden)

    Cabezón D.

    2014-01-01

    Full Text Available Wake effect represents one of the main sources of energy loss and uncertainty when designing offshore wind farms. Traditionally analytical models have been used to optimize and estimate power deficits. However these models have shown to underestimate wake effect and consequently overestimate output power [1, 2]. This means that analytical models can be very helpful at optimizing preliminary layouts but not as accurate as needed for an ultimate fine design. Different techniques can be found in the literature to study wind turbine wakes that include simplified kinematic models and more advanced field models, that solve flow equations with different turbulence closure schemes. See the review papers of Crespo et al. [3], Vermeer et al. [4], and Sanderse et al. [5]. Purely elliptic Computational Fluid Dynamics (CFD models based on the actuator disk technique have been developed during the last years [6–8]. They consider wind turbine rotor as a disk where a distribution of axial forces act over the incoming air. It is a fair approach but it can still be computationally expensive for big wind farms in an operative mode. With this technique still active, an alternative approach inspired on the parabolic wake models [9, 10] is proposed. Wind turbine rotors continue to be represented as actuator disks but now the domain is split into subdomains containing one or more wind turbines. The output of each subdomain is mapped onto the input boundary of the next one until the end of the domain is reached, getting a considerable decrease on computational time, by a factor of order 10. As the model is based on the open source CFD solver OpenFOAM, it can be parallelized to speed-up convergence. The near wake is calculated so no initial wind speed deficit profiles have to be supposed as in totally parabolic models and alternative turbulence models, such as the anisotropic Reynolds Stress Model (RSM can be used. Traditional problems of elliptic models related to

  11. CFD modelling of flow mal-distribution in an industrial ammonia oxidation reactor: A case study

    International Nuclear Information System (INIS)

    Ammonia oxidation reactor is widely used in nitric acid plant to cause the catalytic reaction between air and ammonia to produce nitrous gases. In this work, the flow distribution inside the ammonia oxidation reactor at Shiraz Petrochemical Complex (SPC) has been simulated using Computational Fluid Dynamics (CFD) code. The CFD results showed that the flow is non-uniformly distributed inside the reactor due to improper header design of the reactor. Measuring of the temperature distribution around the skin of the reactor has been carried out using thermograph. The thermograph experiment showed a considerable temperature difference between the left and right side of the reactor. It was found that the mal-distribution of the gas flow inside the reactor can directly affect the performance of the reactor. - Highlights: •A failure has been observed in an industrial ammonia oxidation reactor. •CFD code helps to simulate the flow inside the reactor. •The flow becomes non-uniformly distributed due to the reactor header mal-design. •The flow mal-distribution results in some drawbacks

  12. Examining the Impact of Greenspace Patterns on Land Surface Temperature by Coupling LiDAR Data with a CFD Model

    Directory of Open Access Journals (Sweden)

    Weizhong Su

    2014-09-01

    Full Text Available Understanding the link between greenspace patterns and land surface temperature is very important for mitigating the urban heat island (UHI effect and is also useful for planners and decision-makers for providing a sustainable design for urban greenspace. Although coupling remote sensing data with a computational fluid dynamics (CFD model has widely been used to examine interactions between UHI and greenspace patterns, the paper aims to examine the impact of five theoretical models of greenspace patterns on land surface temperature based on the improvement of the accuracy of CFD modeling by the combination of LiDAR data with remote sensing images to build a 3D urban model. The simulated results demonstrated that the zonal pattern always had the obvious cooling effects when there are no large buildings or terrain obstacles. For ambient environments, the building or terrain obstacles and the type of greenspace have the hugest influence on mitigating the UHI, but the greenspace area behaves as having the least cooling effect. A dotted greenspace pattern shows the best cooling effect in the central area or residential district within a city, while a radial and a wedge pattern may result in a “cold source” for the urban thermal environment.

  13. 3D CFD modeling of subsonic and transonic flowing-gas DPALs with different pumping geometries

    Science.gov (United States)

    Yacoby, Eyal; Sadot, Oren; Barmashenko, Boris D.; Rosenwaks, Salman

    2015-10-01

    Three-dimensional computational fluid dynamics (3D CFD) modeling of subsonic (Mach number M ~ 0.2) and transonic (M ~ 0.9) diode pumped alkali lasers (DPALs), taking into account fluid dynamics and kinetic processes in the lasing medium is reported. The performance of these lasers is compared with that of supersonic (M ~ 2.7 for Cs and M ~ 2.4 for K) DPALs. The motivation for this study stems from the fact that subsonic and transonic DPALs require much simpler hardware than supersonic ones where supersonic nozzle, diffuser and high power mechanical pump (due to a drop in the gas total pressure in the nozzle) are required for continuous closed cycle operation. For Cs DPALs with 5 x 5 cm2 flow cross section pumped by large cross section (5 x 2 cm2) beam the maximum achievable power of supersonic devices is higher than that of the transonic and subsonic devices by only ~ 3% and ~ 10%, respectively. Thus in this case the supersonic operation mode has no substantial advantage over the transonic one. The main processes limiting the power of Cs supersonic DPALs are saturation of the D2 transition and large ~ 60% losses of alkali atoms due to ionization, whereas the influence of gas heating is negligible. For K transonic DPALs both the gas heating and ionization effects are shown to be unimportant. The maximum values of the power are higher than those in Cs transonic laser by ~ 11%. The power achieved in the supersonic and transonic K DPAL is higher than for the subsonic version, with the same resonator and K density at the inlet, by ~ 84% and ~ 27%, respectively, showing a considerable advantaged of the supersonic device over the transonic one. For pumping by rectangular beams of the same (5 x 2 cm2) cross section, comparison between end-pumping - where the laser beam and pump beam both propagate at along the same axis, and transverse-pumping - where they propagate perpendicularly to each other, shows that the output power and optical-to-optical efficiency are not

  14. A comparison of actuator disc and BEM models in CFD simulations for the prediction of offshore wake losses

    International Nuclear Information System (INIS)

    In this paper computational fluid dynamics (CFD) simulations are performed using ANSYS CFX to compare wake interaction results obtained from two rotor modelling methodologies: the standard actuator disc and the blade element momentum model (BEM). The unsteady simulations embed Coriolis forces and neutral stability conditions in the surface layer and stable conditions in the free stream. The BEM method is implemented in the CFD code through a pre-processing set of files that employs look-up tables. The control system for the wind turbines is considered through look-up tables that are constructed based on operational wind farm data. Simulations using the actuator disc and BEM methodologies have been performed using a number of different turbulence models in order to compare the wind turbine wake structure results. The use of URANS and LES numerical methods, coupled with the two different methodologies of representing the turbine, enables an assessment to be made of the details required for varying degrees of accuracy in computing the wake structures. The findings stress the importance of including the rotation of the wake and the non-uniform load on the rotor in LES simulations to account for more accurate turbulence intensity levels in the near wake

  15. A comparison of actuator disc and BEM models in CFD simulations for the prediction of offshore wake losses

    Science.gov (United States)

    Lavaroni, Luca; Watson, Simon J.; Cook, Malcolm J.; Dubal, Mark R.

    2014-06-01

    In this paper computational fluid dynamics (CFD) simulations are performed using ANSYS CFX to compare wake interaction results obtained from two rotor modelling methodologies: the standard actuator disc and the blade element momentum model (BEM). The unsteady simulations embed Coriolis forces and neutral stability conditions in the surface layer and stable conditions in the free stream. The BEM method is implemented in the CFD code through a pre-processing set of files that employs look-up tables. The control system for the wind turbines is considered through look-up tables that are constructed based on operational wind farm data. Simulations using the actuator disc and BEM methodologies have been performed using a number of different turbulence models in order to compare the wind turbine wake structure results. The use of URANS and LES numerical methods, coupled with the two different methodologies of representing the turbine, enables an assessment to be made of the details required for varying degrees of accuracy in computing the wake structures. The findings stress the importance of including the rotation of the wake and the non-uniform load on the rotor in LES simulations to account for more accurate turbulence intensity levels in the near wake.

  16. New Evaluation Technique for WTG Design Wind Speed Using a CFD-Model-Based Unsteady Flow Simulation with Wind Direction Changes

    Directory of Open Access Journals (Sweden)

    Takanori Uchida

    2011-01-01

    Full Text Available Because a significant portion of the topography in Japan is characterized by steep, complex terrain, which results in a complex spatial distribution of wind speed, great care is necessary for selecting a site for the construction of wind turbine generators (WTG. We have developed a CFD model for unsteady flow called RIAM-COMPACT (Research Institute for Applied Mechanics, Kyushu University, computational prediction of airflow over complex terrain. The RIAM-COMPACT CFD model is based on large eddy simulation (LES. The computational domain of RIAM-COMPACT can extend from several meters to several kilometers, and RIAM-COMPACT can predict airflow and gas diffusion over complex terrain with high accuracy. The present paper proposes a technique for evaluating the deployment location of a WTG. The proposed technique employs the RIAM-COMPACT CFD model and simulates a continuous wind direction change over 360 degrees.

  17. Simulating Flow and Dispersion by Using WRF-CFD Coupled Model in a Built-Up Area of Shenyang, China

    Directory of Open Access Journals (Sweden)

    Yijia Zheng

    2015-01-01

    Full Text Available Results are presented from a series of numerical studies designed to investigate the atmospheric boundary layer structure, ambient wind, and pollutant source location and their impacts on the wind field and pollutant distribution within the built-up areas of Shenyang, China. Two models, namely, Open Source Field Operation and Manipulation (OpenFOAM software package and Weather Research and Forecasting (WRF model, are used in the present study. Then the high resolution computational fluid dynamics (CFD numerical experiments were performed under the typical simulated atmospheric boundary conditions. It was found that the atmospheric boundary structure played a crucial role in the pollution within the building cluster, which determined the potential turbulent diffusion ability of the atmospheric surface layer; the change of the ambient wind direction can significantly affect the dispersion pattern of pollutants, which was a more sensitive factor than the ambient wind speed; under a given atmospheric state, the location of the pollution sources would dramatically determine the pollution patterns within built-up areas. The WRF-CFD numerical evaluation is a reliable method to understand the complicated flow and dispersion within built-up areas.

  18. Higher Order Chemistry Models in the CFD Simulation of Laser-Ablated Carbon Plumes

    Science.gov (United States)

    Scott, C. D.; Greendyke, R. B.; Creel, J. R.; Payne, B. T.

    2005-01-01

    Production of single-walled carbon nanotubes (SWNT) has taken place for a number of years and by a variety of methods such-as laser ablation, chemical vapor deposition, and arc-jet ablation. Yet, little is actually understood about the exact chemical kinetics and processes that occur in SWNT formation. In recent time, NASA Johnson Space Center has devoted a considerable effort to the experimental evaluation of the laser ablation production process for SWNT originally developed at Rice University. To fully understand the nature of the laser ablation process it is necessary to understand the development of the carbon plume dynamics within the laser ablation oven. The present work is a continuation of previous studies into the efforts to model plume dynamics using computational fluid dynamics (CFD). The ultimate goal of the work is to improve understanding of the laser ablation process, and through that improved understanding, refine the laser ablation production of SWNT. Fig. 1 shows a basic schematic of the laser-ablation oven at NASA-JSC. Construction of the facility is simple in concept. Two concentric quartz tubes of 1.5 mm thickness form the inner and outer tubes with inside diameters of 2.2 and 5.08 cm respectively. At one end of the inner tube are located two 60 Hz pulsed lasers operating at 1064 nm and 532 nm wavelength with beam diameters of 5 mm aligned coaxially with the longitudinal axis of the inner quartz tube. For standard nanotube production runs, a 10 ns 532 nm pulse is followed 50 ns later by a 10 ns 1064 nm pulse. Each pulse is of 300 mJ energy. A target of carbon graphite with approximately 1% nickel and cobalt catalysts is located at the other end of the inner quartz tube. In the ordinary processing of SWNT, a base flow of 100 sccm of argon is maintained from the laser location and exits past the carbon target at a pressure of 66.7 kPa. These conditions yield a baseline mass flow through the chamber of 2.723x10(exp -6)kg/s of argon. The whole

  19. Modelling of Underground Coal Gasification Process Using CFD Methods / Modelowanie Procesu Podziemnego Zgazowania Węgla Kamiennego Z Zastosowaniem Metod CFD

    Science.gov (United States)

    Wachowicz, Jan; Łączny, Jacek Marian; Iwaszenko, Sebastian; Janoszek, Tomasz; Cempa-Balewicz, Magdalena

    2015-09-01

    The results of model studies involving numerical simulation of underground coal gasification process are presented. For the purpose of the study, the software of computational fluid dynamics (CFD) was selected for simulation of underground coal gasification. Based on the review of the literature, it was decided that ANSYS-Fluent will be used as software for the performance of model studies. The ANSYS- -Fluent software was used for numerical calculations in order to identify the distribution of changes in the concentration of syngas components as a function of duration of coal gasification process. The nature of the calculations was predictive. A geometric model has been developed based on construction data of the georeactor used during the researches in Experimental Mine "Barbara" and Coal Mine "Wieczorek" and it was prepared by generating a numerical grid. Data concerning the georeactor power supply method and the parameters maintained during the process used to define the numerical model. Some part of data was supplemented based on the literature sources. The main assumption was to base the simulation of the georeactor operation on a mathematical models describing reactive fluid flow. Components of the process gas and the gasification agent move along the gasification channel and simulate physicochemical phenomena associated with the transfer of mass and energy as well as chemical reactions (together with the energy effect). Chemical reactions of the gasification process are based on a kinetic equation which determines the course of a particular type of equation of chemical coal gasification. The interaction of gas with the surrounding coal layer has also been described as a part of the model. The description concerned the transport of thermal energy. The coal seam and the mass rock are treated as a homogeneous body. Modelling studies assumed the coal gasification process is carried out with the participation of separately oxygen and air as a gasification agent

  20. An advanced CFD model to study the effect of non-condensable gas on cavitation in positive displacement pumps

    Science.gov (United States)

    Iannetti, Aldo; Stickland, Matthew T.; Dempster, William M.

    2015-09-01

    An advanced transient CFD model of a positive displacement reciprocating pump was created to study its behavior and performance in cavitating condition during the inlet stroke. The "full" cavitation model developed by Singhal et al. was utilized, and a sensitivity analysis test on two air mass fraction amounts (1.5 and 15 parts per million) was carried out to study the influence of the dissolved air content in water on the cavitation phenomenon. The model was equipped with user defined functions to introduce the liquid compressibility, which stabilizes the simulation, and to handle the two-way coupling between the pressure field and the inlet valve lift history. Estimation of the performance is also presented in both cases.

  1. An advanced CFD model to study the effect of non-condensable gas on cavitation in positive displacement pumps

    Directory of Open Access Journals (Sweden)

    Iannetti Aldo

    2015-09-01

    Full Text Available An advanced transient CFD model of a positive displacement reciprocating pump was created to study its behavior and performance in cavitating condition during the inlet stroke. The “full” cavitation model developed by Singhal et al. was utilized, and a sensitivity analysis test on two air mass fraction amounts (1.5 and 15 parts per million was carried out to study the influence of the dissolved air content in water on the cavitation phenomenon. The model was equipped with user defined functions to introduce the liquid compressibility, which stabilizes the simulation, and to handle the two-way coupling between the pressure field and the inlet valve lift history. Estimation of the performance is also presented in both cases.

  2. An automatic generation of non-uniform mesh for CFD analyses of image-based multiscale human airway models

    Science.gov (United States)

    Miyawaki, Shinjiro; Tawhai, Merryn H.; Hoffman, Eric A.; Lin, Ching-Long

    2014-11-01

    The authors have developed a method to automatically generate non-uniform CFD mesh for image-based human airway models. The sizes of generated tetrahedral elements vary in both radial and longitudinal directions to account for boundary layer and multiscale nature of pulmonary airflow. The proposed method takes advantage of our previously developed centerline-based geometry reconstruction method. In order to generate the mesh branch by branch in parallel, we used the open-source programs Gmsh and TetGen for surface and volume meshes, respectively. Both programs can specify element sizes by means of background mesh. The size of an arbitrary element in the domain is a function of wall distance, element size on the wall, and element size at the center of airway lumen. The element sizes on the wall are computed based on local flow rate and airway diameter. The total number of elements in the non-uniform mesh (10 M) was about half of that in the uniform mesh, although the computational time for the non-uniform mesh was about twice longer (170 min). The proposed method generates CFD meshes with fine elements near the wall and smooth variation of element size in longitudinal direction, which are required, e.g., for simulations with high flow rate. NIH Grants R01-HL094315, U01-HL114494, and S10-RR022421. Computer time provided by XSEDE.

  3. 3D CFD Electrochemical and Heat Transfer Model of an Integrated-Planar Solid Oxide Electrolysis Cells

    Energy Technology Data Exchange (ETDEWEB)

    Grant Hawkes; James E. O' Brien

    2008-10-01

    A three-dimensional computational fluid dynamics (CFD) electrochemical model has been created to model high-temperature electrolysis cell performance and steam electrolysis in a new novel integrated planar porous-tube supported solid oxide electrolysis cell (SOEC). The model is of several integrated planar cells attached to a ceramic support tube. This design is being evaluated with modeling at the Idaho National Laboratory. Mass, momentum, energy, and species conservation and transport are provided via the core features of the commercial CFD code FLUENT. A solid-oxide fuel cell (SOFC) model adds the electrochemical reactions and loss mechanisms and computation of the electric field throughout the cell. The FLUENT SOFC user-defined subroutine was modified for this work to allow for operation in the SOEC mode. Model results provide detailed profiles of temperature, Nernst potential, operating potential, activation over-potential, anode-side gas composition, cathode-side gas composition, current density and hydrogen production over a range of stack operating conditions. Mean per-cell area-specific-resistance (ASR) values decrease with increasing current density. Predicted mean outlet hydrogen and steam concentrations vary linearly with current density, as expected. Effects of variations in operating temperature, gas flow rate, cathode and anode exchange current density, and contact resistance from the base case are presented. Contour plots of local electrolyte temperature, current density, and Nernst potential indicated the effects of heat transfer, reaction cooling/heating, and change in local gas composition. Results are discussed for using this design in the electrolysis mode. Discussion of thermal neutral voltage, enthalpy of reaction, hydrogen production, cell thermal efficiency, cell electrical efficiency, and Gibbs free energy are discussed and reported herein.

  4. Numerical simulation and validation of helicopter blade-vortex interaction using coupled CFD/CSD and three levels of aerodynamic modeling

    Science.gov (United States)

    Amiraux, Mathieu

    Rotorcraft Blade-Vortex Interaction (BVI) remains one of the most challenging flow phenomenon to simulate numerically. Over the past decade, the HART-II rotor test and its extensive experimental dataset has been a major database for validation of CFD codes. Its strong BVI signature, with high levels of intrusive noise and vibrations, makes it a difficult test for computational methods. The main challenge is to accurately capture and preserve the vortices which interact with the rotor, while predicting correct blade deformations and loading. This doctoral dissertation presents the application of a coupled CFD/CSD methodology to the problem of helicopter BVI and compares three levels of fidelity for aerodynamic modeling: a hybrid lifting-line/free-wake (wake coupling) method, with modified compressible unsteady model; a hybrid URANS/free-wake method; and a URANS-based wake capturing method, using multiple overset meshes to capture the entire flow field. To further increase numerical correlation, three helicopter fuselage models are implemented in the framework. The first is a high resolution 3D GPU panel code; the second is an immersed boundary based method, with 3D elliptic grid adaption; the last one uses a body-fitted, curvilinear fuselage mesh. The main contribution of this work is the implementation and systematic comparison of multiple numerical methods to perform BVI modeling. The trade-offs between solution accuracy and computational cost are highlighted for the different approaches. Various improvements have been made to each code to enhance physical fidelity, while advanced technologies, such as GPU computing, have been employed to increase efficiency. The resulting numerical setup covers all aspects of the simulation creating a truly multi-fidelity and multi-physics framework. Overall, the wake capturing approach showed the best BVI phasing correlation and good blade deflection predictions, with slightly under-predicted aerodynamic loading magnitudes

  5. Numerical Modeling and Analysis of Small Gas Turbine Engine : Part I: Analytical Model and Compressor CFD

    OpenAIRE

    Nawaz AHMAD

    2009-01-01

    The thesis work aims at devising analytical thermodynamic model and numerical modeling of the compressor of a small gas turbine to be operated on producer gas with lower heating contents. The turbine will serve as a component of “EXPLORE-Biomass Based Polygeneration” project to meet the internal electrical power requirements of 2-5 KW. The gas turbine engine is of radial type (one stage radial compressor, one stage radial turbine). Small gas turbines give less electrical efficiencies especial...

  6. Application of an empirical model in CFD simulations to predict the local high temperature corrosion potential in biomass fired boilers

    International Nuclear Information System (INIS)

    To gain reliable data for the development of an empirical model for the prediction of the local high temperature corrosion potential in biomass fired boilers, online corrosion probe measurements have been carried out. The measurements have been performed in a specially designed fixed bed/drop tube reactor in order to simulate a superheater boiler tube under well-controlled conditions. The investigated boiler steel 13CrMo4-5 is commonly used as steel for superheater tube bundles in biomass fired boilers. Within the test runs the flue gas temperature at the corrosion probe has been varied between 625 °C and 880 °C, while the steel temperature has been varied between 450 °C and 550 °C to simulate typical current and future live steam temperatures of biomass fired steam boilers. To investigate the dependence on the flue gas velocity, variations from 2 m·s−1 to 8 m·s−1 have been considered. The empirical model developed fits the measured data sufficiently well. Therefore, the model has been applied within a Computational Fluid Dynamics (CFD) simulation of flue gas flow and heat transfer to estimate the local corrosion potential of a wood chips fired 38 MW steam boiler. Additionally to the actual state analysis two further simulations have been carried out to investigate the influence of enhanced steam temperatures and a change of the flow direction of the final superheater tube bundle from parallel to counter-flow on the local corrosion potential. - Highlights: • Online corrosion probe measurements in a fixed bed/drop tube reactor. • Development of an empirical corrosion model. • Application of the model in a CFD simulation of flow and heat transfer. • Variation of boundary conditions and their effects on the corrosion potential

  7. 3D CFD computations of transitional flows using DES and a correlation based transition model

    DEFF Research Database (Denmark)

    Sørensen, Niels N.

    process can be important for the aerodynamic performance. Today, the most widespread approach is to use fully turbulent computations, where the transitional process is ignored and the entire boundary layer on the wings or airfoils is handled by the turbulence model. The correlation based transition model......The report describes the application of the correlation based transition model of of Menter et. al. [1, 2] to the cylinder drag crisis and the stalled flow over an DU-96-W-351 airfoil using the DES methodology. When predicting the flow over airfoils and rotors, the laminar-turbulent transition...... has lately shown promising results, and the present paper describes the application of the model to predict the drag and shedding frequency for flow around a cylinder from sub to super-critical Reynolds numbers. Additionally, the model is applied to the flow around the DU-96 airfoil, at high angles...

  8. CFD Modeling of Helium Pressurant Effects on Cryogenic Tank Pressure Rise Rates in Normal Gravity

    Science.gov (United States)

    Grayson, Gary; Lopez, Alfredo; Chandler, Frank; Hastings, Leon; Hedayat, Ali; Brethour, James

    2007-01-01

    A recently developed computational fluid dynamics modeling capability for cryogenic tanks is used to simulate both self-pressurization from external heating and also depressurization from thermodynamic vent operation. Axisymmetric models using a modified version of the commercially available FLOW-3D software are used to simulate actual physical tests. The models assume an incompressible liquid phase with density that is a function of temperature only. A fully compressible formulation is used for the ullage gas mixture that contains both condensable vapor and a noncondensable gas component. The tests, conducted at the NASA Marshall Space Flight Center, include both liquid hydrogen and nitrogen in tanks with ullage gas mixtures of each liquid's vapor and helium. Pressure and temperature predictions from the model are compared to sensor measurements from the tests and a good agreement is achieved. This further establishes the accuracy of the developed FLOW-3D based modeling approach for cryogenic systems.

  9. Experimental Analysis and Simultaneous Heat and Moisture Transfer with Coupled CFD Model for Convective Drying of Moist Object

    Science.gov (United States)

    Chandramohan, V. P.

    2016-01-01

    Convective drying of rectangular-shaped moist object has been analyzed both experimentally and numerically. Transient mass of the potato sample is measured experimentally. Moisture content, diffusivity, and density of the object are calculated at different drying air temperatures from 40°C to 70°C with an air velocity of 2 m/s. A three-dimensional (3D) finite volume method (FVM) based numerical model is developed to predict the temperature and moisture distribution. A computational fluid dynamics (CFD) code is used for predicting heat and mass transfer coefficients required in the boundary conditions of the heat and mass transfer model. The experimental and numerical data are compared and good agreement is observed.

  10. V&V Of CFD Modeling Of The Argonne Bubble Experiment: FY15 Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Hoyt, Nathaniel C. [Argonne National Lab. (ANL), Argonne, IL (United States); Wardle, Kent E. [Argonne National Lab. (ANL), Argonne, IL (United States); Bailey, James L. [Argonne National Lab. (ANL), Argonne, IL (United States); Basavarajappa, Manjunath [Univ. of Utah, Salt Lake City, UT (United States)

    2015-09-30

    In support of the development of accelerator-driven production of the fission product Mo 99, computational fluid dynamics (CFD) simulations of an electron-beam irradiated, experimental-scale bubble chamber have been conducted in order to aid in interpretation of existing experimental results, provide additional insights into the physical phenomena, and develop predictive thermal hydraulic capabilities that can be applied to full-scale target solution vessels. Toward that end, a custom hybrid Eulerian-Eulerian-Lagrangian multiphase solver was developed, and simulations have been performed on high-resolution meshes. Good agreement between experiments and simulations has been achieved, especially with respect to the prediction of the maximum temperature of the uranyl sulfate solution in the experimental vessel. These positive results suggest that the simulation methodology that has been developed will prove to be suitable to assist in the development of full-scale production hardware.

  11. Time analysis of aneurysm wall shear stress for both Newtonian and Casson flows from image-based CFD models

    Science.gov (United States)

    Castro, Marcelo A.; Ahumada Olivares, María. C.; Putman, Christopher M.; Cebral, Juan R.

    2014-03-01

    The optimal management of unruptured aneurysms is controversial, and current decision making is mainly based on aneurysm size and location. Incidentally detected unruptured aneurysms less than 5mm in diameter should be treated conservatively. However, small unruptured aneurysms also bleed. Risk factors based on the hemodynamic forces exerted over the arterial wall have been investigated using image-based computational fluid dynamic (CFD) methodologies during the last decade. Accurate estimation of wall shear stress (WSS) is required to properly study associations between flow features and aneurysm processes. Previous works showed that Newtonian and non-Newtonian (Casson) models produce similar WSS distributions and characterization, with no significant differences. Other authors showed that the WSS distribution computed from time-averaged velocity fields is significantly higher for the Newtonian model where WSS is low. In this work we reconstructed ten patient-specific CFD models from angiography images to investigate the time evolution of WSS at selected locations such as aneurysm blebs (low WSS), and the parent artery close to the aneurysm neck (high WSS). When averaging all cases it is seen that the estimation of the time-averaged WSS, the peak WSS and the minimum WSS value before the systolic peak were all higher when the Casson rheology was considered. However, none of them showed statistically significant differences. At the afferent artery Casson rheology systematically predicted higher WSS values. On the other hand, at the selected blebs either Newtonian or Casson WSS estimations are higher in some phases of the cardiac cycle. Those observations differ among individual cases.

  12. CFD lends the government a hand

    Science.gov (United States)

    Lekoudis, Spiro; Singleton, Robert E.; Mehta, Unmeel B.

    1992-02-01

    The present survey of important and novel CFD applications being developed and implemented by U.S. Government contractors gives attention to naval vessel flow-modeling, Army ballistic and rotary wing aerodynamics, and NASA hypersonic vehicle related applications of CFD. CFD-generated knowledge of numerical algorithms, fluid motion, and supercomputer use is being incorporated into such additional areas as computational electromagnetics and acoustics. Attention is presently given to CFD methods' development status in such fields as submarine boundary layers, hypersonic kinetic energy projectile shock structures, helicopter main rotor tip flows, and National Aerospace Plane aerothermodynamics.

  13. Overview 2004 of NASA Stirling-Convertor CFD-Model Development and Regenerator R&D Efforts

    Science.gov (United States)

    Tew, Roy C.; Dyson, Rodger W.; Wilson, Scott D.; Demko, Rikako

    2005-01-01

    This paper reports on accomplishments in 2004 in development of Stirling-convertor CFD model at NASA GRC and via a NASA grant, a Stirling regenerator-research effort being conducted via a NASA grant (a follow-on effort to an earlier DOE contract), and a regenerator-microfabrication contract for development of a "next-generation Stirling regenerator." Cleveland State University is the lead organization for all three grant/contractual efforts, with the University of Minnesota and Gedeor Associates as subcontractors. Also, the Stirling Technology Co. and Sunpower, Inc. are both involved in all three efforts, either as funded or unfunded participants. International Mezzo Technologies of Baton Rouge, LA is the regenerator fabricator for the regenerator-microfabrication contract. Results of the efforts in these three areas are summarized.

  14. Suppression pool swell analysis using CFD code

    International Nuclear Information System (INIS)

    A two-dimensional axi-symmetric model of suppression pool of Containment Studies Facility (CSF) along with single vent pipe was modeled to estimate the jet and hydrodynamic loads due to flow of steam air mixture during simulated loss of coolant accident (LOCA). The analysis was carried out using CFD ACE+ software with Volume of Fluid (VOF) approach. The flow velocity variation through vent pipe was estimated using in-house containment thermal hydraulic code CONTRAN, was given as input at inlet boundary condition. The transient calculations were performed for 20 seconds and suppression pool level variation, pressure loads over the floor, walls and vent pipes etc were evaluated. (author)

  15. Improving design factors of air diffuser systems based on field conditions of dam reservoirs: CFD simulation approach.

    Science.gov (United States)

    Shin, Sangmin; Lee, Seungjae; Lee, Sangeun; Yum, Kyungtaek; Park, Heekyung

    2012-01-01

    This study aims to improve the design factors of air diffuser systems that have been analyzed in laboratory experiments, with consideration of the field conditions of dam reservoirs. In this study, the destratification number (D(N)), destratification radius, and efficiency are considered as design factors. The computational fluid dynamics (CFD) simulation experiment is performed in diverse field conditions in order to analyze these factors. The results illustrate the wider range of D(N) values in field conditions and the relationship of the destratification radius and efficiency to D(N). The results can lead to better performance of air diffuser systems and water quality management in dam reservoir sites. PMID:22678200

  16. Numerical predictions of flow boiling characteristics: Current status, model setup and CFD modeling for different non-uniform heating profiles

    International Nuclear Information System (INIS)

    A detailed analysis of two-phase flow boiling characteristics inside high pressure systems is presented focusing on non-uniform axial heating profiles. For this purpose, a detailed numerical model has been developed after presenting the current status of the use of CFD techniques in flow boiling predictions. User defined functions written in C++ were compiled and hooked to the software in order to account for mass interaction between phases using the Eulerian multiphase flow model. The modeled domain is a 2 m long stainless steel pipe with inside and outside diameters of 15.4 mm, 25.4 mm, respectively. The base imposed uniform heat flux was 345.6 kW/m2, for mass flow rate of water of 0.161 kg/s and at a temperature of 200 °C. The model was validated against range of experimental data and the results are very promising for the use of CFD in flow boiling characterization. Effects of increasing uniform heat flux were considered for different increments of 30, 50 and 75% as reference to the basic applied heat flux. The influences of heat flux profile in the axial direction were investigated while maintaining the same total power. Different heat flux profiles of linearly increasing, linearly decreasing, sine, and cosine shapes were considered. - Highlights: • Current status of CHF predictions using CFD modeling technique. • State of the art, flow boiling 2D-model for the applications of high pressure systems. • Validation of the model using the available experimental data in the literature. • Investigation of flow boiling in real systems for non-uniform heating profile. • Analysis of keeping the system away from the CHF conditions for non-uniform heating

  17. CFD for wastewater treatment: an overview.

    Science.gov (United States)

    Samstag, R W; Ducoste, J J; Griborio, A; Nopens, I; Batstone, D J; Wicks, J D; Saunders, S; Wicklein, E A; Kenny, G; Laurent, J

    2016-01-01

    Computational fluid dynamics (CFD) is a rapidly emerging field in wastewater treatment (WWT), with application to almost all unit processes. This paper provides an overview of CFD applied to a wide range of unit processes in water and WWT from hydraulic elements like flow splitting to physical, chemical and biological processes like suspended growth nutrient removal and anaerobic digestion. The paper's focus is on articulating the state of practice and research and development needs. The level of CFD's capability varies between different process units, with a high frequency of application in the areas of final sedimentation, activated sludge basin modelling and disinfection, and greater needs in primary sedimentation and anaerobic digestion. While approaches are comprehensive, generally capable of incorporating non-Newtonian fluids, multiphase systems and biokinetics, they are not broad, and further work should be done to address the diversity of process designs. Many units have not been addressed to date. Further needs are identified throughout, but common requirements include improved particle aggregation and breakup (flocculation), and improved coupling of biology and hydraulics. PMID:27508360

  18. 2D and 3D CFD modelling of a reactive turbulent flow in a double shell supercritical water oxidation reactor

    International Nuclear Information System (INIS)

    In order to design and define appropriate dimensions for a supercritical oxidation reactor, a comparative 2D and 3D simulation of the fluid dynamics and heat transfer during an oxidation process has been performed. The solver used is a commercial code, Fluent 6.2 (R). The turbulent flow field in the reactor, created by the stirrer, is taken into account with a k-omega model and a swirl imposed to the fluid. In the 3D case the rotation of the stirrer can be modelled using the sliding mesh model and the moving reference frame model. This work allows comparing 2D and 3D velocity and heat transfer calculations. The predicted values (mainly species concentrations and temperature profiles) are of the same order in both cases. The reactivity of the system is taken into account with a classical Eddy Dissipation Concept combustion model. Comparisons with experimental temperature measurements validate the ability of the CFD modelling to simulate the supercritical water oxidation reactive medium. Results indicate that the flow can be considered as plug flow-like and that heat transfer is strongly enhanced by the stirring. (authors)

  19. Development of an integrated methodology for the design and optimization of charging and EGR circuits in modern diesel engines based on 1D-CFD engine modelling

    Energy Technology Data Exchange (ETDEWEB)

    Arrigoni, Stefano; Avolio, Giovanni; Loudjertli, Lydia; Renella, Alfonso; Vassallo, Alberto [General Motors Powertrain Europe, Turin (Italy)

    2011-07-01

    In modern diesel engines, the requirements on the combustion system are very tightening, due to an aggressive combination of pollutant emission, fuel economy, NVH and fun-to-drive targets. In particular, the charging and EGR circuits, with their impact on combustion system performance, deserve a special attention, both in terms of architecture selection, as well as component design and specifications. Since most of these choices occur very early in the engine design phase, it is of high importance to have a reliable analytical tool capable to predict the performance of such components, prior than the actual hardware is available for testing. The present paper describes the development and application to a new diesel engine of an integrated approach for charging and EGR circuit design optimization, based on a set of high-level targets for emissions, fuel economy and performance. In order to achieve this goal, a 1D-CFD approach based on GT-Power suite has been employed: specific sub-routines and semi-empirical models for accurate heat-release and emission prediction have been developed and validated, and finally applied to a light-duty passenger car diesel engine under development. The results show that the tool is capable to predict engine indicated cycle as well as NOx, PM emissions depending on the characteristics of charging and EGR circuits, and can be used to cascade high-level engine target to component specifications (turbocharger, EGR cooler, intercooler) in an effective way. (orig.)

  20. HEDR modeling approach

    International Nuclear Information System (INIS)

    This report details the conceptual approaches to be used in calculating radiation doses to individuals throughout the various periods of operations at the Hanford Site. The report considers the major environmental transport pathways--atmospheric, surface water, and ground water--and projects and appropriate modeling technique for each. The modeling sequence chosen for each pathway depends on the available data on doses, the degree of confidence justified by such existing data, and the level of sophistication deemed appropriate for the particular pathway and time period being considered

  1. Integrating CFD and building simulation

    DEFF Research Database (Denmark)

    Bartak, M.; Beausoleil-Morrison, I.; Clarke, J.A.;

    2002-01-01

    To provide practitioners with the means to tackle problems related to poor indoor environments, building simulation and computational 3uid dynamics can usefully be integrated within a single computational framework. This paper describes the outcomes from a research project sponsored by the European...... Commission, which furthered the CFD modelling aspects of the ESP-r system. The paper summarises the form of the CFD model, describes the method used to integrate the thermal and 3ow domains and reports the outcome from an empirical validation exercise. © 2002 Published by Elsevier Science Ltd....

  2. Formulation, Implementation and Validation of a Two-Fluid model in a Fuel Cell CFD Code

    Energy Technology Data Exchange (ETDEWEB)

    Kunal Jain, Vernon Cole, Sanjiv Kumar and N. Vaidya

    2008-11-01

    more complications. A general approach would be to form a mixture continuity equation by linearly combining the phasic continuity equations using appropriate weighting factors. Analogous to mixture equation for pressure correction, a difference equation is used for the volume/phase fraction by taking the difference between the phasic continuity equations. The relative advantages of the above mentioned algorithmic variants for computing pressure correction and volume fractions are discussed and quantitatively assessed. Preliminary model validation is done for each component of the fuel cell. The two-phase transport in the channel is validated using empirical correlations. Transport in the GDL is validated against results obtained from LBM and VOF simulation techniques. The Channel-GDL interface transport will be validated against experiment and empirical correlation of droplet detachment at the interface. References [1] Y. Wang S. Basu and C.Y. Wang. Modeling two-phase flow in pem fuel cell channels. J. Power Sources, 179:603{617, 2008. [2] P. K. Sinha and C. Y. Wang. Liquid water transport in a mixed-wet gas diffusion layer of a polymer electrolyte fuel cell. Chem. Eng. Sci., 63:1081-1091, 2008. [3] Guangyu Lin and Trung Van Nguyen. A two-dimensional two-phase model of a pem fuel cell. J. Electrochem. Soc., 153(2):A372{A382, 2006. [4] T. Berning and N. Djilali. A 3d, multiphase, multicomponent model of the cathode and anode of a pem fuel cell. J. Electrochem. Soc., 150(12):A1589{A1598, 2003.

  3. CFD [computational fluid dynamics] And Safety Factors. Computer modeling of complex processes needs old-fashioned experiments to stay in touch with reality.

    Energy Technology Data Exchange (ETDEWEB)

    Leishear, Robert A.; Lee, Si Y.; Poirier, Michael R.; Steeper, Timothy J.; Ervin, Robert C.; Giddings, Billy J.; Stefanko, David B.; Harp, Keith D.; Fowley, Mark D.; Van Pelt, William B.

    2012-10-07

    Computational fluid dynamics (CFD) is recognized as a powerful engineering tool. That is, CFD has advanced over the years to the point where it can now give us deep insight into the analysis of very complex processes. There is a danger, though, that an engineer can place too much confidence in a simulation. If a user is not careful, it is easy to believe that if you plug in the numbers, the answer comes out, and you are done. This assumption can lead to significant errors. As we discovered in the course of a study on behalf of the Department of Energy's Savannah River Site in South Carolina, CFD models fail to capture some of the large variations inherent in complex processes. These variations, or scatter, in experimental data emerge from physical tests and are inadequately captured or expressed by calculated mean values for a process. This anomaly between experiment and theory can lead to serious errors in engineering analysis and design unless a correction factor, or safety factor, is experimentally validated. For this study, blending times for the mixing of salt solutions in large storage tanks were the process of concern under investigation. This study focused on the blending processes needed to mix salt solutions to ensure homogeneity within waste tanks, where homogeneity is required to control radioactivity levels during subsequent processing. Two of the requirements for this task were to determine the minimum number of submerged, centrifugal pumps required to blend the salt mixtures in a full-scale tank in half a day or less, and to recommend reasonable blending times to achieve nearly homogeneous salt mixtures. A full-scale, low-flow pump with a total discharge flow rate of 500 to 800 gpm was recommended with two opposing 2.27-inch diameter nozzles. To make this recommendation, both experimental and CFD modeling were performed. Lab researchers found that, although CFD provided good estimates of an average blending time, experimental blending times varied

  4. Reducing numerical costs for core wide nuclear reactor CFD simulations by the Coarse-Grid-CFD

    Science.gov (United States)

    Viellieber, Mathias; Class, Andreas G.

    2013-11-01

    Traditionally complete nuclear reactor core simulations are performed with subchannel analysis codes, that rely on experimental and empirical input. The Coarse-Grid-CFD (CGCFD) intends to replace the experimental or empirical input with CFD data. The reactor core consists of repetitive flow patterns, allowing the general approach of creating a parametrized model for one segment and composing many of those to obtain the entire reactor simulation. The method is based on a detailed and well-resolved CFD simulation of one representative segment. From this simulation we extract so-called parametrized volumetric forces which close, an otherwise strongly under resolved, coarsely-meshed model of a complete reactor setup. While the formulation so far accounts for forces created internally in the fluid others e.g. obstruction and flow deviation through spacers and wire wraps, still need to be accounted for if the geometric details are not represented in the coarse mesh. These are modelled with an Anisotropic Porosity Formulation (APF). This work focuses on the application of the CGCFD to a complete reactor core setup and the accomplishment of the parametrization of the volumetric forces.

  5. DEM/CFD modelling of the deposition of dilute granular systems in a vertical container

    Institute of Scientific and Technical Information of China (English)

    YU Shen; GUO Yu; WU ChuanYu

    2009-01-01

    Deposition of granular materials into a container is a general industrial packing process. In this study, the deposition behaviour of dilute granular mixtures consisting of two types of particles that were of the same particle size but different particle densities in the presence of air was numerically analyzed using a coupled discrete element method (DEM) and computational fluid dynamics (CFD). Bilayer gra-nular mixtures with light particles at bottom and heavy particles at top were first simulated. It was found that the presence of air significantly affected the flow behaviour of the bilayer mixtures. For the system with a relatively low initial void fraction, the air entrapped inside the container escaped through the dilated zones induced due to the friction between the powder bed and wall surfaces. The escaping air streams entrained light particles that were originally located at the bottom of the granular system. Consequently, these light particles were migrated to the top of the granular bed at the end of deposition process. More light particles were migrated when the deposition distance was increased. For the sys-tem with a high initial void fraction, some light particles penetrated into the top layer of heavy particles and created a mixing zone. Deposition of random mixtures with different initial void fractions was also investigated and the influence of initial void fraction on the segregation behaviour was explored as well. It was found that the increase of void fraction promoted segregation during the deposition in air. It was demonstrated that, for granular mixtures consisting of particles of different air sensitivities, the pres-ence of air had a significant impact on the mixing and segregation behaviour during the deposition.

  6. Considering value of information when using CFD in design

    Energy Technology Data Exchange (ETDEWEB)

    Misra, John Satprim [Iowa State Univ., Ames, IA (United States)

    2009-01-01

    This thesis presents an approach to find lower resolution CFD models that can accurately lead a designer to a correct decision at a lower computational cost. High-fidelity CFD models often contain too much information and come at a higher computational cost, limiting the designs a designer can test and how much optimization can be performed on the design. Lower model resolution is commonly used to reduce computational time. However there are no clear guidelines on how much model accuracy is required. Instead experience and intuition are used to select an appropriate lower resolution model. This thesis presents an alternative to this ad hoc method by considering the added value of the addition information provided by increasing accurate and more computationally expensive models.

  7. Viscous flow simulation in a stenosis model using discrete particle dynamics: a comparison between DPD and CFD.

    Science.gov (United States)

    Feng, Rui; Xenos, Michalis; Girdhar, Gaurav; Kang, Wei; Davenport, James W; Deng, Yuefan; Bluestein, Danny

    2012-01-01

    Flow and stresses induced by blood flow acting on the blood cellular constituents can be represented to a certain extent by a continuum mechanics approach down to the order of the μm level. However, the molecular effects of, e.g., adhesion/aggregation bonds of blood clotting can be on the order of nm. The coupling of the disparate length and timescales between such molecular levels and macroscopic transport represents a major computational challenge. To address this challenge, a multiscale numerical approach based on discrete particle dynamics (DPD) methodology derived from molecular dynamics (MD) principles is proposed. The feasibility of the approach was firstly tested for its ability to simulate viscous flow conditions. Simulations were conducted in low Reynolds numbers flows (Re = 25-33) through constricted tubes representing blood vessels with various degrees of stenosis. Multiple discrete particles interacting with each other were simulated, with 1.24-1.36 million particles representing the flow domain and 0.4 million particles representing the vessel wall. The computation was carried out on the massive parallel supercomputer NY BlueGene/L employing NAMD-a parallel MD package for high performance computing (HPC). Typical recirculation zones were formed distal to the stenoses. The velocity profiles and recirculation zones were in excellent agreement with computational fluid dynamics (CFD) 3D Navier-Stokes viscous fluid flow simulations and with classic numerical and experimental results by YC Fung in constricted tubes. This feasibility analysis demonstrates the potential of a methodology that widely departs from a continuum approach to simulate multiscale phenomena such as flow induced blood clotting. PMID:21369918

  8. CFD SIMULATION OF THE HEAT TRANSFER PROCESS IN A CHEVRON PLATE HEAT EXCHANGER USING THE SST TURBULENCE MODEL

    Directory of Open Access Journals (Sweden)

    Jan Skočilas

    2015-08-01

    Full Text Available This paper deals with a computational fluid dynamics (CFD simulation of the heat transfer process during turbulent hot water flow between two chevron plates in a plate heat exchanger. A three-dimensional model with the simplified geometry of two cross-corrugated channels provided by chevron plates, taking into account the inlet and outlet ports, has been designed for the numerical study. The numerical model was based on the shear-stress transport (SST k-! model. The basic characteristics of the heat exchanger, as values of heat transfer coefficient and pressure drop, have been investigated. A comparative analysis of analytical calculation results, based on experimental data obtained from literature, and of the results obtained by numerical simulation, has been carried out. The coefficients and the exponents in the design equations for the considered plates have been arranged by using simulation results. The influence on the main flow parameters of the corrugation inclination angle relative to the flow direction has been taken into account. An analysis of the temperature distribution across the plates has been carried out, and it has shown the presence of zones with higher heat losses and low fluid flow intensity.

  9. CFD Analysis of an Aerofoil

    Directory of Open Access Journals (Sweden)

    Karna S. Patel

    2014-03-01

    Full Text Available In this report we have obtained the drag and lift forces using CFD which can also be determined through experiments using wind tunnel testing. In experimental setup, the design model has to be placed in the test section. This process is quite laborious & (surely cost more than CFD techniques cost for the same. Thus we have gone through analytical method then it can be validated by experimental testing. The analysis of the two dimensional subsonic flow over a NACA 0012 airfoil at various angles of attack and operating at a Reynolds number of 3×E+06 is presented. The CFD simulation results show close agreement with those of the experiments, thus suggesting a reliable alternative to experimental method in determining drag and lift.

  10. Three-Dimensional CFD Modeling of Transport Phenomena in a Cross-Flow Anode-Supported Planar SOFC

    Directory of Open Access Journals (Sweden)

    Zhonggang Zhang

    2013-12-01

    Full Text Available In this study, a three-dimensional computational fluid dynamics (CFD model is developed for an anode-supported planar SOFC from the Chinese Academy of Science Ningbo Institute of Material Technology and Engineering (NIMTE. The simulation results of the developed model are in good agreement with the experimental data obtained under the same conditions. With the simulation results, the distribution of temperature, flow velocity and the gas concentrations through the cell components and gas channels is presented and discussed. Potential and current density distributions in the cell and overall fuel utilization are also presented. It is also found that the temperature gradients exist along the length of the cell, and the maximum value of the temperature for the cross-flow is at the outlet region of the cell. The distribution of the current density is uneven, and the maximum current density is located at the interfaces between the channels, ribs and the electrodes, the maximum current density result in a large over-potential and heat source in the electrodes, which is harmful to the overall performance and working lifespan of the fuel cells. A new type of flow structure should be developed to make the current flow be more evenly distributed and promote most of the TPB areas to take part in the electrochemical reactions.

  11. CFD simulation of direct contact condensation with ANSYS CFX using surface renewal theory based heat transfer coefficients

    Energy Technology Data Exchange (ETDEWEB)

    Wanninger, Andreas; Ceuca, Sabin Cristian; Macian-Juan, Rafael [Technische Univ. Muenchen, Garching (Germany). Dept. of Nuclear Engineering

    2013-07-01

    Different approaches for the calculation of Direct Contact Condensation (DCC) using Heat Transfer Coefficients (HTC) based on the Surface Renewal Theory (SRT) are tested using the CFD simulation tool ANSYS CFX. The present work constitutes a preliminary study of the flow patterns and conditions observed using different HTC models. A complex 3D flow pattern will be observed in the CFD simulations as well as a strong coupling between the condensation rate and the two-phase flow dynamics. (orig.)

  12. Evaluation of a Heating System in Poultry Houses Using a CFD Model / Evaluación de un Sistema de Calefacción en Galpones Avicolas Usando un Modelo en CFD

    Directory of Open Access Journals (Sweden)

    Flávio Alves Damasceno

    2014-06-01

    Full Text Available Abstract.. The objective of this study was to adapt and validate a computer model using the Computational Fluid Dinamics (CFD, in the prediction of temperature and air speed in a duct distribution system coupled to a heating furnace that is used in typical poultry houses in tropical and subtropical countries. The validation of the model with experimental data was satisfactory, presentingnormalized mean square error NMSE values of 0.25 and 0.02 for air temperature and air speed, respectively. The results evidenced that the proposed model is adequate for predicting the air speed and temperature for this type of system, and could be used to improve the efficiency of the distribution of heat inside and around air ducts using different air speeds, types of materials and dimensions. / Resumen. El objetivo de este estudio fue adaptar y validar un modelo computacional haciendo uso de la dinámica de fluidos computacional (CFD para predecir la temperatura y la velocidad del aire en un sistema de distribución de ductos acoplado a un sitema de calefacción que es utilizado en las instalaciones avícola en los países tropicales y subtropicales. La validación del modelo con los datos experimentales fue satisfactoria, presentando valores medios normalizados del error cuadrado NMSE de 0,25 y 0,02 para la temperatura y velocidad del aire respectivamente. Los resultados muestran que el modelo propuesto es adecuado para predecir la velocidad del aire y la temperatura alrededor de este tipo de sistema, y podría ser utilizado para mejorar la eficiencia la distribución de calor en el interior y alrededor de los conductos, usando diferentes velocidades, tipos de materiales y dimensiones. 

  13. Assessment of computational fluid dynamics (CFD) for nuclear reactor safety problems

    International Nuclear Information System (INIS)

    The basic objective of the present work was to provide documented evidence of the need to perform CFD simulations in Nuclear Reactor Safety (NRS), concentrating on single-phase applications, and to assess the competence of the present generation of CFD codes to perform these simulations reliably. The fulfilling of this objective involves multiple tasks, summarized as: to provide a classification of NRS problems requiring CFD analysis, to identify and catalogue existing CFD assessment bases, to identify shortcomings in CFD approaches, to put into place a means for extending the CFD assessment database, with an emphasis on NRS applications. The resulting document is presented here. After some introductory remarks, chapter 3 lists twenty-two NRS issues for which it is considered that the application of CFD would bring real benefits in terms of better predictive capability. This classification is followed by a short description of the safety issue, a state-of-the-art summary of what has been attempted, and what is still needed to be done to improve reliability. Chapter 4 details the assessment bases that have already been established in both the nuclear and non-nuclear domains, and discusses the usefulness and relevance of the work to NRS applications, where appropriate. This information is augmented in Chapter 5 by descriptions of the existing CFD assessment bases that have been established around specific, NRS problems. Typical examples are experiments devoted to the boron dilution issue, pressurised thermal shock, and thermal fatigue in pipes. Chapter 6 is devoted to identifying the technology gaps which need to be closed to make CFD a more trustworthy analytical tool. Some deficiencies identified are lack of a Phenomenon Identification and Ranking Table (PIRT), limitations in the range of application of turbulence models, coupling of CFD with neutronics and system codes, and computer power limitations. Most CFD codes currently being used have their own, custom

  14. Modelling approaches for angiogenesis.

    Science.gov (United States)

    Taraboletti, G; Giavazzi, R

    2004-04-01

    The development of a functional vasculature within a tumour is a requisite for its growth and progression. This fact has led to the design of therapies directed toward the tumour vasculature, aiming either to prevent the formation of new vessels (anti-angiogenic) or to damage existing vessels (vascular targeting). The development of agents with different mechanisms of action requires powerful preclinical models for the analysis and optimization of these therapies. This review concerns 'classical' assays of angiogenesis in vitro and in vivo, recent approaches to target identification (analysis of gene and protein expression), and the study of morphological and functional changes in the vasculature in vivo (imaging techniques). It mainly describes assays designed for anti-angiogenic compounds, indicating, where possible, their application to the study of vascular-targeting agents. PMID:15120043

  15. CFD simulation of coaxial injectors

    Science.gov (United States)

    Landrum, D. Brian

    1993-01-01

    The development of improved performance models for the Space Shuttle Main Engine (SSME) is an important, ongoing program at NASA MSFC. These models allow prediction of overall system performance, as well as analysis of run-time anomalies which might adversely affect engine performance or safety. Due to the complexity of the flow fields associated with the SSME, NASA has increasingly turned to Computational Fluid Dynamics (CFD) techniques as modeling tools. An important component of the SSME system is the fuel preburner, which consists of a cylindrical chamber with a plate containing 264 coaxial injector elements at one end. A fuel rich mixture of gaseous hydrogen and liquid oxygen is injected and combusted in the chamber. This process preheats the hydrogen fuel before it enters the main combustion chamber, powers the hydrogen turbo-pump, and provides a heat dump for nozzle cooling. Issues of interest include the temperature and pressure fields at the turbine inlet and the thermal compatibility between the preburner chamber and injector plate. Performance anomalies can occur due to incomplete combustion, blocked injector ports, etc. The performance model should include the capability to simulate the effects of these anomalies. The current approach to the numerical simulation of the SSME fuel preburner flow field is to use a global model based on the MSFC sponsored FNDS code. This code does not have the capabilities of modeling several aspects of the problem such as detailed modeling of the coaxial injectors. Therefore, an effort has been initiated to develop a detailed simulation of the preburner coaxial injectors and provide gas phase boundary conditions just downstream of the injector face as input to the FDNS code. This simulation should include three-dimensional geometric effects such as proximity of injectors to baffles and chamber walls and interaction between injectors. This report describes an investigation into the numerical simulation of GH2/LOX coaxial

  16. Assessment of the aerodynamic characteristics of thick airfoils in high Reynolds and moderate Ma numbers using CFD modeling

    Science.gov (United States)

    Prospathopoulos, John M.; Papadakis, Giorgos; Sieros, Giorgos; Voutsinas, Spyros G.; Chaviaropoulos, Takis K.; Diakakis, Kostas

    2014-06-01

    The aerodynamic characteristics of thick airfoils in high Reynolds number is assessed using two different CFD RANS solvers: the compressible MaPFlow and the incompressible CRES-flowNS-2D both equipped with the k-ω SST turbulence model. Validation is carried out by comparing simulations against existing high Reynolds experimental data for the NACA 63-018 airfoil in the range of -10° to 20°. The use of two different solvers aims on one hand at increasing the credibility in the results and on the other at quantifying the compressibility effects. Convergence of steady simulations is achieved within a mean range of -10° to 14° which refers to attached or light stall conditions. Over this range the simulations from the two codes are in good agreement. As stall gets deeper, steady convergence ceases and the simulations must switch to unsteady. Lift and drag oscillations are produced which increase in amplitude as the angle of attack increases. Finally in post stall, the average CL is found to decrease up to ~24° or 32° for the FFA or the NACA 63-018 airfoils respectively, and then recover to higher values indicating a change in the unsteady features of the flow.

  17. Phase-contrast MRI and CFD modeling of apparent 3He gas flow in rat pulmonary airways

    Science.gov (United States)

    Minard, Kevin R.; Kuprat, Andrew P.; Kabilan, Senthil; Jacob, Richard E.; Einstein, Daniel R.; Carson, James P.; Corley, Richard A.

    2012-08-01

    Phase-contrast (PC) magnetic resonance imaging (MRI) with hyperpolarized 3He is potentially useful for developing and testing patient-specific models of pulmonary airflow. One challenge, however, is that PC-MRI provides apparent values of local 3He velocity that not only depend on actual airflow but also on gas diffusion. This not only blurs laminar flow patterns in narrow airways but also introduces anomalous airflow structure that reflects gas-wall interactions. Here, both effects are predicted in a live rat using computational fluid dynamics (CFD), and for the first time, simulated patterns of apparent 3He gas velocity are compared with in vivo PC-MRI. Results show (1) that correlations (R2) between measured and simulated airflow patterns increase from 0.23 to 0.79 simply by accounting for apparent 3He transport, and (2) that remaining differences are mainly due to uncertain airway segmentation and partial volume effects stemming from relatively coarse MRI resolution. Higher-fidelity testing of pulmonary airflow predictions should therefore be possible with future imaging improvements.

  18. Phase-Contrast MRI and CFD Modeling of Apparent 3He Gas Flow in Rat Pulmonary Airways

    International Nuclear Information System (INIS)

    Phase-contrast (PC) magnetic resonance imaging (MRI) with hyperpolarized 3He is potentially useful for developing and testing patient-specific models of pulmonary airflow. One challenge, however, is that PC-MRI provides apparent values of local 3He velocity that not only depend on actual airflow but also on gas diffusion. This not only blurs laminar flow patterns in narrow airways but also introduces anomalous airflow structure that reflects gas-wall interactions. Here, both effects are predicted in a live rat using computational fluid dynamics (CFD), and for the first time, simulated patterns of apparent 3He gas velocity are compared with in-vivo PC-MRI. Results show (1) that correlations (R2) between measured and simulated airflow patterns increase from 0.23 to 0.79 simply by accounting for apparent 3He transport, and that (2) remaining differences are mainly due to uncertain airway segmentation and partial volume effects stemming from relatively coarse MRI resolution. Higher-fidelity testing of pulmonary airflow predictions should therefore be possible with future imaging improvements.

  19. Phase-Contrast MRI and CFD Modeling of Apparent 3He Gas Flow in Rat Pulmonary Airways

    Energy Technology Data Exchange (ETDEWEB)

    Minard, Kevin R.; Kuprat, Andrew P.; Kabilan, Senthil; Jacob, Rick E.; Einstein, Daniel R.; Carson, James P.; Corley, Richard A.

    2012-08-01

    Phase-contrast (PC) magnetic resonance imaging (MRI) with hyperpolarized 3He is potentially useful for developing and testing patient-specific models of pulmonary airflow. One challenge, however, is that PC-MRI provides apparent values of local 3He velocity that not only depend on actual airflow but also on gas diffusion. This not only blurs laminar flow patterns in narrow airways but also introduces anomalous airflow structure that reflects gas-wall interactions. Here, both effects are predicted in a live rat using computational fluid dynamics (CFD), and for the first time, simulated patterns of apparent 3He gas velocity are compared with in-vivo PC-MRI. Results show (1) that correlations (R2) between measured and simulated airflow patterns increase from 0.23 to 0.79 simply by accounting for apparent 3He transport, and that (2) remaining differences are mainly due to uncertain airway segmentation and partial volume effects stemming from relatively coarse MRI resolution. Higher-fidelity testing of pulmonary airflow predictions should therefore be possible with future imaging improvements.

  20. CFD modelling of laminar-turbulent transition for airfoils and rotors using the gamma-(Re)over-tilde (theta) model

    DEFF Research Database (Denmark)

    Sørensen, Niels N.

    2009-01-01

    When predicting the flow over airfoils and rotors, the laminar-turbulent transition process can be important for the aerodynamic performance. Today, the most widespread approach is to use fully turbulent computations, where the transitional process is ignored and the entire boundary layer...... on the wings or airfoils is handled by the turbulence model. The correlation based transition model has lately shown promising results, and the present paper describes the effort of deriving the two non-public empirical correlations of the model to make the model complete. To verify the model it is applied...... to flow over a flat plate, flow over the S809 and the NACA63-415 airfoils, flow over a prolate spheroid at zero and thirty degrees angle of attack, and finally to the NREL Phase VI wind turbine rotor for the zero yaw upwind cases from the NREL/NASA Ames wind tunnel test. Copyright © 2009 John Wiley & Sons...

  1. CFD simulation of the discharge flow from standard Rushton impeller

    OpenAIRE

    Bohuš Kysela; Jiří Konfršt; Ivan Fořt; Zdeněk Chára

    2014-01-01

    The radial discharge jet from the standard Rushton turbine was investigated by the CFD calculations and compared with results from the Laser Doppler Anemometry (LDA) measurements. The Large Eddy Simulation (LES) approach was employed with Sliding Mesh (SM) model of the impeller motion. The obtained velocity profiles of the mean ensemble-averaged velocity and r.m.s. values of the fluctuating velocity were compared in several distances from the impeller blades. The calculated values of mean ens...

  2. 3D-CFD simulation and neural network model for the j and f factors of the wavy fin-and-flat tube heat exchangers

    Directory of Open Access Journals (Sweden)

    M Khoshvaght Aliabadi

    2011-09-01

    Full Text Available A three dimensional (3D computational fluid dynamics (CFD simulation and a neural network model are presented to estimate the behaviors of the Colburn factor (j and the Fanning friction factor (f for wavy fin - and - flat tube (WFFT heat exchangers. Effects of the five geometrical factors of fin pitch, fin height, fin length, fin thickness, and wavy amplitude are investigated over a wide range of Reynolds number (600CFD simulation results express that the geometrical parameters of wavy fins have significant effects on the j and f factors as a function of Reynolds number. The computational results have an adequate accuracy when compared to experimental data. The accuracy of the calculations of the j and f factors are evaluated by the values of the absolute average relative deviation (AARD, being respectively 3.8% and 8.2% for the CFD simulation and 1.3% and 1% for the neural network model. Finally, new correlations are proposed to estimate the values of the j and f factors with 3.22% and 3.68% AARD respectively.

  3. CFD Modeling of the Multipurpose Hydrogen Test Bed (MHTB) Self-Pressurization and Spray Bar Mixing Experiments in Normal Gravity: Effect of the Accommodation Coefficient on the Tank Pressure

    Science.gov (United States)

    Kartuzova, Olga; Kassemi, Mohammad

    2015-01-01

    A CFD model for simulating the self-pressurization of a large scale liquid hydrogen storage tank is utilized in this paper to model the MHTB self-pressurization experiment. The kinetics-based Schrage equation is used to account for the evaporative and condensi ng interfacial mass flows in this model. The effect of the accommodation coefficient for calculating the interfacial mass transfer rate on the tank pressure during tank selfpressurization is studied. The values of the accommodation coefficient which were considered in this study vary from 1.0e-3 to 1.0e-1 for the explicit VOF model and from 1.0e-4 to 1.0e-3 for the implicit VOF model. The ullage pressure evolutions are compared against experimental data. A CFD model for controlling pressure in cryogenic storage tanks by spraying cold liquid into the ullage is also presented. The Euler-Lagrange approach is utilized for tracking the spray droplets and for modeling the interaction between the droplets and the continuous phase (ullage). The spray model is coupled with the VOF model by performing particle tracking in the ullage, removing particles from the ullage when they reach the interface, and then adding their contributions to the liquid. Droplet-ullage heat and mass transfer are modeled. The flow, temperature, and interfacial mass flux, as well as droplets trajectories, size distribution and temperatures predicted by the model are presented. The ul lage pressure and vapor temperature evolutions are compared with experimental data obtained from the MHTB spray bar mixing experiment. The effect of the accommodation coefficient for calculating the interfacial and droplet mass transfer rates on the tank pressure during mixing of the vapor using spray is studied. The values used for the accommodation coefficient at the interface vary from 1.0e-5 to 1.0e-2. The droplet accommodation coefficient values vary from 2.0e-6 to 1.0e-4.

  4. On application of CFD codes to problems of nuclear reactor safety

    International Nuclear Information System (INIS)

    The 'Exploratory Meeting of Experts to Define an Action Plan on the Application of Computational Fluid Dynamics (CFD) Codes to Nuclear Reactor Safety Problems' held in May 2002 at Aix-en-Province, France, recommended formation of writing groups to report the need of guidelines for use and assessment of CFD in single-phase nuclear reactor safety problems, and on recommended extensions to CFD codes to meet the needs of two-phase problems in nuclear reactor safety. This recommendations was supported also by Working Group on the Analysis and Management of Accidents and led to formation oaf three Writing Groups. The first writing Group prepared a summary of existing best practice guidelines for single phase CFD analysis and made a recommendation on the need for nuclear reactor safety specific guidelines. The second Writing Group selected those nuclear reactor safety applications for which understanding requires or is significantly enhanced by single-phase CFD analysis, and proposed a methodology for establishing assesment matrices relevant to nuclear reactor safety applications. The third writing group performed a classification of nuclear reactor safety problems where extension of CFD to two-phase flow may bring real benefit, a classification of different modeling approaches, and specification and analysis of needs in terms of physical and numerical assessments. This presentation provides a review of these activities with the most important conclusions and recommendations (Authors)

  5. CFD modelling of outflow and ductile fracture propagation in pressurised pipelines

    OpenAIRE

    Brown, S. F.

    2011-01-01

    This thesis describes the fundamental extension, development and testing of a mathematical model for predicting the transient outflow following the failure of pressurised pipelines. The above encompasses improvements to the theoretical basis and numerical stability, reduction in the computational runtime and the modelling of fracture propagation with particular reference to CO2 pipelines. The basic model utilises the homogeneous equilibrium model (HEM), where the constituent...

  6. Co-firing biomass and coal-progress in CFD modelling capabilities

    DEFF Research Database (Denmark)

    Kær, Søren Knudsen; Rosendahl, Lasse Aistrup; Yin, Chungen;

    2005-01-01

    This paper discusses the development of user defined FLUENT™ sub models to improve the modelling capabilities in the area of large biomass particle motion and conversion. Focus is put on a model that includes the influence from particle size and shape on the reactivity by resolving intra-particle...

  7. CFD-DP Modeling of Multiphase Flow in Dense Medium Cyclone

    OpenAIRE

    Okan Topcu

    2012-01-01

    A numerical study of the gas-liquid-solid multi-phase flow in a hydrocyclone is summarized in this paper. The turbulent flow of the gas and the liquid is modelled using the realizable k-epsilon turbulence model, the interface between the liquid and the air core is modelled using the Eulerian multi-phase model and the simulation of the particle flow described by the dense discrete phase model in which the data of the multi-phase flow are used. Separation efficiency, particle trajectories, spli...

  8. Mining data from CFD simulation for aneurysm and carotid bifurcation models.

    Science.gov (United States)

    Miloš, Radović; Dejan, Petrović; Nenad, Filipović

    2011-01-01

    Arterial geometry variability is present both within and across individuals. To analyze the influence of geometric parameters, blood density, dynamic viscosity and blood velocity on wall shear stress (WSS) distribution in the human carotid artery bifurcation and aneurysm, the computer simulations were run to generate the data pertaining to this phenomenon. In our work we evaluate two prediction models for modeling these relationships: neural network model and k-nearest neighbor model. The results revealed that both models have high prediction ability for this prediction task. The achieved results represent progress in assessment of stroke risk for a given patient data in real time. PMID:22256273

  9. CFD Analysis of Centrifugal Pump: A Review

    Directory of Open Access Journals (Sweden)

    Narayan P. Jaiswal

    2014-05-01

    Full Text Available The main objective of this work is to understand role of the computational fluid dynamics (CFD technique in analyzing and predicting the performance of centrifugal pump. Computational Fluid Dynamics (CFD is the present day state-of-art technique for fluid flow analysis. The critical review of CFD analysis of CFD analysis of centrifugal pump along with future scope for further improvement is presented in this paper. Different solver like ANSYS-CFX, FLUENT etc can be used for simulations. Shear stress transport model has been found appropriate as turbulence model. Study of pressure contours, velocity contours, flow streamlines etc can be studied by CFD techniques. Unsteady Reynolds Averaged Navier Stokes (URANS equations are solved by solver to get flow simulation results inside centrifugal pump. CFD results has to be validated with testing results or with performance characteristics curves. Performance prediction at design and off-design conditions, parametric study, cavitation analysis, diffuser pump analysis, performance of pump running in turbine mode etc. are possible with CFD simulation techniques.

  10. The role of CFD combustion modeling in hydrogen safety management – III: Validation based on homogeneous hydrogen–air–diluent experiments

    International Nuclear Information System (INIS)

    Highlights: • A CFD based method proposed in the previous article is used for the simulation of the effect of CO2–He dilution on hydrogen deflagration. • A theoretical study is presented to verify whether CO2–He diluent can be used as a replacement for H2O as diluent. • CFD model used for the validation work is described. • TFC combustion model results are in good agreement with large-scale homogeneous hydrogen–air–CO2–He experiments. - Abstract: Large quantities of hydrogen can be generated and released into the containment during a severe accident in a PWR. The generated hydrogen, when mixed with air, can lead to hydrogen combustion. The dynamic pressure loads resulting from hydrogen combustion can be detrimental to the structural integrity of the reactor safety systems and the reactor containment. Therefore, accurate prediction of these pressure loads is an important safety issue. In our previous article, a CFD based method to determine these pressure loads was presented. This CFD method is based on the application of a turbulent flame speed closure combustion model. The method was validated against three uniform hydrogen–air deflagration experiments with different blockage ratio performed in the ENACCEF facility. It was concluded that the maximum pressures were predicted within 13% accuracy, while the rate of pressure rise dp/dt was predicted within about 30%. The eigen frequencies of the residual pressure wave phenomena were predicted within a few %. In the present article, we perform additional validation of the CFD based method against three uniform hydrogen–air–CO2–He deflagration experiments with three different concentrations of the CO2–He diluent. The trends of decrease in the flame velocity, the intermediate peak pressure, the rate of pressure rise dp/dt, and the maximum value of the mean pressure with an increase in the CO2–He dilution are captured well in the simulations. From the presented validation analyses, it can be

  11. Global Combustion Mechanisms for Use in CFD Modeling under Oxy-Fuel Conditions

    DEFF Research Database (Denmark)

    Andersen, Jimmy; Rasmussen, Christian Lund; Giselsson, Trine;

    2009-01-01

    conditions. In the modification approach, the initiating reactions involving hydrocarbon and oxygen were retained, while modifying the H-2-CO-CO2 reactions in order to improve prediction of major species concentrations. The main attention has been to capture the trend and level of CO predicted...

  12. CFD simulation of neutral ABL flows

    OpenAIRE

    Zhang, Xiaodong

    2009-01-01

    This work is to evaluate the CFD prediction of Atmospheric Boundary Layer flow field over different terrains employing Fluent 6.3 software. How accurate the simulation could achieve depend on following aspects: viscous model, wall functions, agreement of CFD model with inlet wind velocity profile and top boundary condition. Fluent employ wall function roughness modifications based on data from experiments with sand grain roughened pipes and channels, describe wall adjacent zone with Roughness...

  13. Particle Tracking and Deposition from CFD Simulations using a Viscoelastic Particle Model

    OpenAIRE

    Losurdo, M.

    2009-01-01

    In the present dissertation the mathematical modelling of particle deposition is studied and the solution algorithms for particle tracking, deposition and deposit growth are developed. Particle deposition is modelled according to mechanical impact and contact mechanics taking into account the dependency on time, temperature and particle-deposit composition explicitly. Indeed, such a model lies in the field of the rheology of visco-elastic solids which the author of this dissertation refers to...

  14. A comparison of turbulence models in airship steady-state CFD simulations

    OpenAIRE

    Voloshin, Vitaly; Chen, Yong K.; Calay, Rajnish K.

    2012-01-01

    The accuracy and resource consumption of the four different turbulence models based on the eddy viscosity assumption, namely, $k-\\varepsilon$, two $k-\\omega$ and Spallart-Allmaram models, in modeling airships are investigated. The test airship shape is a conventional shape. Three different angles of attack are considered. The results are checked against the wind tunnel experimental data. The resource consumption study is based on the benchmark of 1500 iterations. Based on all data obtained it...

  15. Development of a CFD-compatible transition model based on linear stability theory

    Science.gov (United States)

    Coder, James G.

    A new laminar-turbulent transition model for low-turbulence external aerodynamic applications is presented that incorporates linear stability theory in a manner compatible with modern computational fluid dynamics solvers. The model uses a new transport equation that describes the growth of the maximum Tollmien-Schlichting instability amplitude in the presence of a boundary layer. To avoid the need for integration paths and non-local operations, a locally defined non-dimensional pressure-gradient parameter is used that serves as an estimator of the integral boundary-layer properties. The model has been implemented into the OVERFLOW 2.2f solver and interacts with the Spalart-Allmaras and Menter SST eddy-viscosity turbulence models. Comparisons of predictions using the new transition model with high-quality wind-tunnel measurements of airfoil section characteristics validate the predictive qualities of the model. Predictions for three-dimensional aircraft and wing geometries show the correct qualitative behavior even though limited experimental data are available. These cases also demonstrate that the model is well-behaved about general aeronautical configurations. These cases confirm that the new transition model is an improvement over the current state of the art in computational fluid dynamics transition modeling by providing more accurate solutions at approximately half the added computational expense.

  16. A comparison of turbulence models in airship steady-state CFD simulations

    CERN Document Server

    Voloshin, Vitaly; Calay, Rajnish K

    2012-01-01

    The accuracy and resource consumption of the four different turbulence models based on the eddy viscosity assumption, namely, $k-\\varepsilon$, two $k-\\omega$ and Spallart-Allmaram models, in modeling airships are investigated. The test airship shape is a conventional shape. Three different angles of attack are considered. The results are checked against the wind tunnel experimental data. The resource consumption study is based on the benchmark of 1500 iterations. Based on all data obtained it is evident that Spallart-Allmaras model is the most optimal one in the majority of cases.

  17. Prediction and validation of pool fire development in enclosures by means of CFD Models for risk assessment of nuclear power plants (Poolfire) - Report year 2

    International Nuclear Information System (INIS)

    Fires in nuclear power plants can be an important hazard for the overall safety of the facility. One of the typical fire sources is a pool fire. It is therefore important to have good knowledge on the fire behaviour of pool fire and be able to predict the heat release rate by prediction of the mass loss rate. This project envisages developing a pyrolysis model to be used in CFD models. In this report the activities for second year are reported, which is an overview of the experiments conducted, further development and validation of models and cases study to be selected in year 3. (Author)

  18. Prediction and validation of pool fire development in enclosures by means of CFD Models for risk assessment of nuclear power plants (Poolfire) - Report year 2

    Energy Technology Data Exchange (ETDEWEB)

    van Hees, P.; Wahlqvist, J.; Kong, D. [Lund Univ., Lund (Sweden); Hostikka, S.; Sikanen, T. [VTT Technical Research Centre of Finland (Finland); Husted, B. [Haugesund Univ. College, Stord (Norway); Magnusson, T. [Ringhals AB, Vaeroebacka (Sweden); Joerud, F. [European Spallation Source (ESS), Lund (Sweden)

    2013-05-15

    Fires in nuclear power plants can be an important hazard for the overall safety of the facility. One of the typical fire sources is a pool fire. It is therefore important to have good knowledge on the fire behaviour of pool fire and be able to predict the heat release rate by prediction of the mass loss rate. This project envisages developing a pyrolysis model to be used in CFD models. In this report the activities for second year are reported, which is an overview of the experiments conducted, further development and validation of models and cases study to be selected in year 3. (Author)

  19. Particle Tracking and Deposition from CFD Simulations using a Viscoelastic Particle Model

    NARCIS (Netherlands)

    Losurdo, M.

    2009-01-01

    In the present dissertation the mathematical modelling of particle deposition is studied and the solution algorithms for particle tracking, deposition and deposit growth are developed. Particle deposition is modelled according to mechanical impact and contact mechanics taking into account the depend

  20. CFD modeling of two immiscible fluids mixing in a commercial scale static mixer

    Directory of Open Access Journals (Sweden)

    V. Abdolkarimi

    2014-12-01

    Full Text Available A Computational Fluid Dynamics model based on the Eulerian formulation for multiphase flow was developed to model the mixing hydrodynamics of two immiscible fluids in a commercial scale static mixer. The two immiscible liquids were condensate and caustic solutions and were considered as two phases that are interpenetrating each other. The aim of this study was to develop a comprehensive Computational Fluid Dynamics model for predicting the impact of hydrodynamic parameters such as length, diameter and the arrangement of the corrugated plates of a static mixer on the degree of mixing and the pressure drop of the mixture. The model has been evaluated by comparing predictions of the degree of mixing and the mixture pressure drop with the same data available for the static mixer of the desulfurization plant of the Kharg petrochemical company. It has been shown that the predictions of the developed model are well adapted to the experimental data.

  1. Application of CFD techniques in the modelling and simulation of PBI PEMFC

    Energy Technology Data Exchange (ETDEWEB)

    Doubek, G.; Robalinho, E.; Cunha, E.F.; Linardi, M. [IPEN - Av. Prof. Lineu Prestes, 2242, 05508-000, Sao Paulo (Brazil); Cekinski, E. [IPT - Av. Prof. Almeida Prado, 532, 05508-901, Sao Paulo (Brazil)

    2011-12-15

    In the present work two 3-D models, for the catalytic layer, were employed in order to simulate the responses of a PBI high temperature polymeric membrane fuel cell. The simulations made use of an agglomerate model and a pseudo-homogenous model, both implemented taking into account the temperature influence over their parameters. The overall simulation was performed also as two models, linked by the variable pressure, one for the whole graphite plate simulating the distribution channels, and the other dealing with the MEA and thereof the catalytic layer. A discussion over the two models was done and the experimental results demonstrated that the pseudo-homogeneous obtained the better fits. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. CFD-DEM simulations of current-induced dune formation and morphological evolution

    Science.gov (United States)

    Sun, Rui; Xiao, Heng

    2016-06-01

    Understanding the fundamental mechanisms of sediment transport, particularly those during the formation and evolution of bedforms, is of critical scientific importance and has engineering relevance. Traditional approaches of sediment transport simulations heavily rely on empirical models, which are not able to capture the physics-rich, regime-dependent behaviors of the process. With the increase of available computational resources in the past decade, CFD-DEM (computational fluid dynamics-discrete element method) has emerged as a viable high-fidelity method for the study of sediment transport. However, a comprehensive, quantitative study of the generation and migration of different sediment bed patterns using CFD-DEM is still lacking. In this work, current-induced sediment transport problems in a wide range of regimes are simulated, including 'flat bed in motion', 'small dune', 'vortex dune' and suspended transport. Simulations are performed by using SediFoam, an open-source, massively parallel CFD-DEM solver developed by the authors. This is a general-purpose solver for particle-laden flows tailed for particle transport problems. Validation tests are performed to demonstrate the capability of CFD-DEM in the full range of sediment transport regimes. Comparison of simulation results with experimental and numerical benchmark data demonstrates the merits of CFD-DEM approach. In addition, the improvements of the present simulations over existing studies using CFD-DEM are presented. The present solver gives more accurate prediction of sediment transport rate by properly accounting for the influence of particle volume fraction on the fluid flow. In summary, this work demonstrates that CFD-DEM is a promising particle-resolving approach for probing the physics of current-induced sediment transport.

  3. CFD modelling of non-metallic inclusions removal process in the T-type tundish

    OpenAIRE

    Warzecha, M.; T. Merder; P. Warzecha

    2012-01-01

    Purpose: The aim of performed research is to diagnose the possibilities of non-metallic inclusions removal from liquid steel flowing through the two-strand T-type tundish with its current configuration.Design/methodology/approach: Research were performed with numerical simulations. Initial conditions for inclusions distribution were obtained earlier with experimental measurements during industrial casting conditions.Findings: Numerical simulations let to investigate the flow field structure o...

  4. A CFD Model for Fluid Dynamics in a Gas-fluidised Bed

    Institute of Scientific and Technical Information of China (English)

    ZHANG Kai; Stefano Brandani

    2004-01-01

    A modified particle bed model derived from the two-fluid momentum balance equations was employed to predict the gas-fluidised bed behaviour. Additional terms are included in both the fluid and the particle momentum balance equations to take into account the effect of the dispersed solid phase. This model has been extended to two-dimensional formulations and has been implemented in the commercial code CFX 4.3. The model correctly simulates the homogeneous fluidisation of Geldart Group A and the bubbling fluidisation of Geldart Group B in gas-solid fluidised beds.

  5. Advanced multi-phase flow CFD model development for solid rocket motor flowfield analysis

    Science.gov (United States)

    Liaw, Paul; Chen, Yen-Sen

    1995-03-01

    A Navier-Stokes code, finite difference Navier-Stokes (FDNS), is used to analyze the complicated internal flowfield of the SRM (solid rocket motor) to explore the impacts due to the effects of chemical reaction, particle dynamics, and slag accumulation on the solid rocket motor (SRM). The particulate multi-phase flowfield with chemical reaction, particle evaporation, combustion, breakup, and agglomeration models are included in present study to obtain a better understanding of the SRM design. Finite rate chemistry model is applied to simulate the chemical reaction effects. Hermsen correlation model is used for the combustion simulation. The evaporation model introduced by Spalding is utilized to include the heat transfer from the particulate phase to the gase phase due to the evaporation of the particles. A correlation of the minimum particle size for breakup expressed in terms of the Al/Al2O3 surface tension and shear force was employed to simulate the breakup of particles. It is assumed that the breakup occurs when the Weber number exceeds 6. A simple L agglomeration model is used to investigate the particle agglomeration. However, due to the large computer memory requirements for the agglomeration model, only 2D cases are tested with the agglomeration model. The VOF (Volume of Fluid) method is employed to simulate the slag buildup in the aft-end cavity of the redesigned solid rocket motor (RSRM). Monte Carlo method is employed to calculate the turbulent dispersion effect of the particles. The flowfield analysis obtained using the FDNS code in the present research with finite rate chemical reaction, particle evaporation, combustion, breakup, agglomeration, and VOG models will provide a design guide for the potential improvement of the SRM including the use of materials and the shape of nozzle geometry such that a better performance of the SRM can be achieved. The simulation of the slag buildup in the aft-end cavity can assist the designer to improve the design of

  6. Advanced Multi-phase Flow CFD Model Development for Solid Rocket Motor Flowfield Analysis

    Science.gov (United States)

    Liaw, Paul; Chen, Yen-Sen

    1995-01-01

    A Navier-Stokes code, finite difference Navier-Stokes (FDNS), is used to analyze the complicated internal flowfield of the SRM (solid rocket motor) to explore the impacts due to the effects of chemical reaction, particle dynamics, and slag accumulation on the solid rocket motor (SRM). The particulate multi-phase flowfield with chemical reaction, particle evaporation, combustion, breakup, and agglomeration models are included in present study to obtain a better understanding of the SRM design. Finite rate chemistry model is applied to simulate the chemical reaction effects. Hermsen correlation model is used for the combustion simulation. The evaporation model introduced by Spalding is utilized to include the heat transfer from the particulate phase to the gase phase due to the evaporation of the particles. A correlation of the minimum particle size for breakup expressed in terms of the Al/Al2O3 surface tension and shear force was employed to simulate the breakup of particles. It is assumed that the breakup occurs when the Weber number exceeds 6. A simple L agglomeration model is used to investigate the particle agglomeration. However, due to the large computer memory requirements for the agglomeration model, only 2D cases are tested with the agglomeration model. The VOF (Volume of Fluid) method is employed to simulate the slag buildup in the aft-end cavity of the redesigned solid rocket motor (RSRM). Monte Carlo method is employed to calculate the turbulent dispersion effect of the particles. The flowfield analysis obtained using the FDNS code in the present research with finite rate chemical reaction, particle evaporation, combustion, breakup, agglomeration, and VOG models will provide a design guide for the potential improvement of the SRM including the use of materials and the shape of nozzle geometry such that a better performance of the SRM can be achieved. The simulation of the slag buildup in the aft-end cavity can assist the designer to improve the design of

  7. CFD modelling of fluid flow and contaminant transport in hydrogeological systems

    OpenAIRE

    Frost, Nageena Kiani

    2006-01-01

    This study provides an understanding of various aspects of hydrogeological systems modelling and the use of computational techniques to predict and optimise hydrological parameter assessment, anisotropic scaling, macrodispersion and solute flux measurements under unsteady, uniform/non-uniform flow conditions. The incorporated models are structured around multi-physics continuum mechanics analysis to investigate fluid flow and solute transport in hydrogeological systems. The control-volum...

  8. Numerische Simulation turbulenter reaktiver Strömungen mit einem hybriden CFD/transported PDF Modell

    OpenAIRE

    Lipp, Stefan

    2011-01-01

    Die mathematische Modellierung turbulenter Flammen ist auf Grund der intensiven Kopplung zwischen turbulenten Transportprozessen und der chemischen Kinetik eine herausfordernde Aufgabe. In dieser Arbeit wird ein Modell vorgestellt, das seinen Fokus auf der detaillierten Simulation der Turbulenz-Chemie-Interaktion hat. Das Modell soll dabei generisch sein in dem Sinne, als das es für verschiedene Verbrennungsregime anwendbar und prädiktiv ist.

  9. Enhanced Kalman Filtering for a 2D CFD NS Wind Farm Flow Model

    Science.gov (United States)

    Doekemeijer, B. M.; van Wingerden, J. W.; Boersma, S.; Pao, L. Y.

    2016-09-01

    Wind turbines are often grouped together for financial reasons, but due to wake development this usually results in decreased turbine lifetimes and power capture, and thereby an increased levelized cost of energy (LCOE). Wind farm control aims to minimize this cost by operating turbines at their optimal control settings. Most state-of-the-art control algorithms are open-loop and rely on low fidelity, static flow models. Closed-loop control relying on a dynamic model and state observer has real potential to further decrease wind's LCOE, but is often too computationally expensive for practical use. In this paper two time-efficient Kalman filter (KF) variants are outlined incorporating the medium fidelity, dynamic flow model “WindFarmSimulator” (WFSim). This model relies on a discretized set of Navier-Stokes equations in two dimensions to predict the flow in wind farms at low computational cost. The filters implemented are an Ensemble KF and an Approximate KF. Simulations in which a high fidelity simulation model represents the true wind farm show that these filters are 101 —102 times faster than a regular KF with comparable or better performance, correcting for wake dynamics that are not modeled in WFSim (noticeably, wake meandering and turbine hub effects). This is a first big step towards real-time closed-loop control for wind farms.

  10. Passive urban ventilation by combined buoyancy-driven slope flow and wall flow: Parametric CFD studies on idealized city models

    Science.gov (United States)

    Luo, Zhiwen; Li, Yuguo

    2011-10-01

    This paper reports the results of a parametric CFD study on idealized city models to investigate the potential of slope flow in ventilating a city located in a mountainous region when the background synoptic wind is absent. Examples of such a city include Tokyo in Japan, Los Angeles and Phoenix in the US, and Hong Kong. Two types of buoyancy-driven flow are considered, i.e., slope flow from the mountain slope (katabatic wind at night and anabatic wind in the daytime), and wall flow due to heated/cooled urban surfaces. The combined buoyancy-driven flow system can serve the purpose of dispersing the accumulated urban air pollutants when the background wind is weak or absent. The microscopic picture of ventilation performance within the urban structures was evaluated in terms of air change rate (ACH) and age of air. The simulation results reveal that the slope flow plays an important role in ventilating the urban area, especially in calm conditions. Katabatic flow at night is conducive to mitigating the nocturnal urban heat island. In the present parametric study, the mountain slope angle and mountain height are assumed to be constant, and the changing variables are heating/cooling intensity and building height. For a typical mountain of 500 m inclined at an angle of 20° to the horizontal level, the interactive structure is very much dependent on the ratio of heating/cooling intensity as well as building height. When the building is lower than 60 m, the slope wind dominates. When the building is as high as 100 m, the contribution from the urban wall flow cannot be ignored. It is found that katabatic wind can be very beneficial to the thermal environment as well as air quality at the pedestrian level. The air change rate for the pedestrian volume can be as high as 300 ACH.

  11. Hemodynamics analysis of patient-specific carotid bifurcation: a CFD model of downstream peripheral vascular impedance.

    Science.gov (United States)

    Dong, Jingliang; Wong, Kelvin K L; Tu, Jiyuan

    2013-04-01

    The study of cardiovascular models was presented in this paper based on medical image reconstruction and computational fluid dynamics. Our aim is to provide a reality platform for the purpose of flow analysis and virtual intervention outcome predication for vascular diseases. By connecting two porous mediums with transient permeability at the downstream of the carotid bifurcation branches, a downstream peripheral impedance model was developed, and the effect of the downstream vascular bed impedance can be taken into consideration. After verifying its accuracy with a healthy carotid bifurcation, this model was implemented in a diseased carotid bifurcation analysis. On the basis of time-averaged wall shear stress, oscillatory shear index, and the relative residence time, fractions of abnormal luminal surface were highlighted, and the atherosclerosis was assessed from a hemodynamic point of view. The effect of the atherosclerosis on the transient flow division between the two branches because of the existence of plaque was also analysed. This work demonstrated that the proposed downstream peripheral vascular impedance model can be used for computational modelling when the outlets boundary conditions are not available, and successfully presented the potential of using medical imaging and numerical simulation to provide existing clinical prerequisites for diagnosis and therapeutic treatment.

  12. Investigation on the Use of a Multiphase Eulerian CFD solver to simulate breaking waves

    DEFF Research Database (Denmark)

    Tomaselli, Pietro D.; Christensen, Erik Damgaard

    2015-01-01

    The main challenge in CFD multiphase simulations of breaking waves is the wide range of interfacial length scales occurring in the flow: from the free surface measurable in meters down to the entrapped air bubbles with size of a fraction of a millimeter. This paper presents a preliminary...... investigation on a CFD model capable of handling this problem. The model is based on a solver, available in the open-source CFD toolkit OpenFOAM, which combines the Eulerian multi-fluid approach for dispersed flows with a numerical interface sharpening method. The solver, enhanced with additional formulations...... for mass and momentum transfer among phases, was satisfactorily tested against an experimental bubble column flow. The model was then used to simulate the propagation of a laboratory solitary breaking wave. The motion of the free surface was successfully reproduced up to the breaking point. Further...

  13. CFD modeling of a prismatic spouted bed with two adjustable gas inlets

    NARCIS (Netherlands)

    Gryczka, Oliver; Heinrich, Stefan; Deen, Niels G.; Sint Annaland, van Martin; Kuipers, Johannes A.M.; Mörl, Lothar

    2009-01-01

    Since the invention of the spouted bed technology by Mathur and Gishler (1955), different kinds of apparatus design were developed and a huge number of applications in nearly all branches of industry have emerged. Modeling of spouted beds by means of modern simulation tools, like discrete particle m

  14. 3D CFD computations of trasitional flows using DES and a correlation based transition model

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Bechmann, Andreas; Zahle, Frederik

    2011-01-01

    The present article describes the application of the correlation based transition model of Menter et al. in combination with the Detached Eddy Simulation (DES) methodology to two cases with large degree of flow separation typically considered difficult to compute. Firstly, the flow is computed over...

  15. Comparative analysis of CFD models for jetting fluidized beds: Effect of particle-phase viscosity

    Institute of Scientific and Technical Information of China (English)

    Pei Pei; Kai Zhang; Gang Xu; Yongping Yang; Dongsheng Wen

    2012-01-01

    Under the Eulerian-Eulerian framework of simulating gas-solid two-phase flow,the accuracy of the hydrodynamic prediction is strongly affected by the selection of rheology of the particulate phase,for which a detailed assessment is still absent.Using a jetting fluidized bed as an example,this work investigates the influence of solid theology on the hydrodynamic behavior by employing different particle-phase viscosity models.Both constant particle-phase viscosity model (CVM) with different viscosity values and a simple two-fluid model without particle-phase viscosity (NVM) are incorporated into the classical twofluid model and compared with the experimental measurements.Qualitative and quantitative results show that the jet penetration depth,jet frequency and averaged bed pressure drop are not a strong function of the particle-phase viscosity.Compared to CVM,the NVM exhibits better predictions on the jet behaviors,which is more suitable for investigating the hydrodynamics of gas-solid fluidized bed with a central jet.

  16. A simple thermodynamic model of diluted hydrogen gas/plasma for CFD applications

    Science.gov (United States)

    Quartapelle, L.; Muzzio, A.

    2015-06-01

    This work describes a simple thermodynamic model of the hydrogen gas at low densities and for temperatures going from those involving quantum rotations of ortho- and para-hydrogen up to the fully ionized state. The closed-form energy levels of Morse rotating oscillator given [D.C. Harris, M.D. Bertolucci, Symmetry and Spectroscopy (Dover, New York, 1989)] (but not those in Morse's original paper) are shown to provide an internal partition function of H2 that is a sufficiently accurate representation of that exploiting the state-of-the-art spectrum of roto-vibrational levels calculated by Pachucki and Komasa [K. Pachucki, J. Komasa, J. Chem. Phys. 130, 164113 (2009)]. A system of two coupled quadratic equations for molecular dissociation and atomic ionization at thermodynamical and chemical equilibrium is derived according to the statistical mechanics by assuming that the system is an ideal mixture containing molecules, neutral atoms and noninteracting protons and electrons. The system of two equations reduces to a single quartic equation for the ionization unknown, with the coefficients dependent on the temperature and the specific volume. Explicit relations for specific energy and entropy of the hydrogen ideal gas/plasma model are derived. These fully compatible equations of state provide a complete thermodynamic description of the system, uniformly valid from low temperatures up to a fully ionized state, with electrons and ions relaxed to one and the same temperature. The comparison with results of other models developed in the framework of the physical and chemical pictures shows that the proposed elementary model is adequate for computational fluid dynamics purposes, in applications with the hydrogen gas under diluted conditions and when the dissociation and ionization can be assumed at thermodynamical and chemical equilibrium.

  17. Experimental and CFD simulation studies of wall shear stress for different impeller configurations and MBR activated sludge.

    Science.gov (United States)

    Ratkovich, N; Chan, C C V; Bentzen, T R; Rasmussen, M R

    2012-01-01

    Membrane bioreactors (MBRs) have been used successfully in biological wastewater treatment for effective solids-liquid separation. However, a common problem encountered with MBR systems is fouling of the membrane resulting in frequent membrane cleaning and replacement which makes the system less appealing for full-scale applications. It has been widely demonstrated that the filtration performances in MBRs can be improved by understanding the shear stress over the membrane surface. Modern tools such as computational fluid dynamics (CFD) can be used to diagnose and understand the shear stress in an MBR. Nevertheless, proper experimental validation is required to validate CFD simulation. In this work experimental measurements of shear stress induced by impellers at a membrane surface were made with an electrochemical approach and the results were used to validate CFD simulations. As good results were obtained with the CFD model (<9% error), it was extrapolated to include the non-Newtonian behaviour of activated sludge. PMID:22592479

  18. The Three-Dimensional Velocity Distribution of Wide Gap Taylor-Couette Flow Modelled by CFD

    Directory of Open Access Journals (Sweden)

    David Shina Adebayo

    2016-01-01

    Full Text Available A numerical investigation is conducted for the flow between two concentric cylinders with a wide gap, relevant to bearing chamber applications. This wide gap configuration has received comparatively less attention than narrow gap journal bearing type geometries. The flow in the gap between an inner rotating cylinder and an outer stationary cylinder has been modelled as an incompressible flow using an implicit finite volume RANS scheme with the realisable k-ε model. The model flow is above the critical Taylor number at which axisymmetric counterrotating Taylor vortices are formed. The tangential velocity profiles at all axial locations are different from typical journal bearing applications, where the velocity profiles are quasilinear. The predicted results led to two significant findings of impact in rotating machinery operations. Firstly, the axial variation of the tangential velocity gradient induces an axially varying shear stress, resulting in local bands of enhanced work input to the working fluid. This is likely to cause unwanted heat transfer on the surface in high torque turbomachinery applications. Secondly, the radial inflow at the axial end-wall boundaries is likely to promote the transport of debris to the junction between the end-collar and the rotating cylinder, causing the build-up of fouling in the seal.

  19. Hydrodynamic optimization of twin-skeg LNG ships by CFD and model testing

    Science.gov (United States)

    Kim, Keunjae; Tillig, Fabian; Bathfield, Nicolas; Liljenberg, Hans

    2014-06-01

    SSPA experiences a growing interest in twin skeg ships as one attractive green ship solution. The twin skeg concept is well proven with obvious advantages for the design of ships with full hull forms, restricted draft or highly loaded propellers. SSPA has conducted extensive hull optimizations studies of LNG ships of different size based on an extensive hull data base with over 7,000 models tested, including over 400 twin skeg hull forms. Main hull dimensions and different hull concepts such as twin skeg and single screw were of main interest in the studies. In the present paper, one twin skeg and one single screw 170 K LNG ship were designed for optimally selected main dimension parameters. The twin skeg hull was further optimized and evaluated using SHIPFLOW FRIENDSHIP design package by performing parameter variation in order to modify the shape and positions of the skegs. The finally optimized models were then built and tested in order to confirm the lower power demand of twin skeg designed compaed with the signle screw design. This paper is a full description of one of the design developments of a LNG twin skeg hull, from early dimensional parameter study, through design optimization phase towards the confirmation by model tests.

  20. Coarse-grid-CFD. An advantageous alternative to subchannel analysis

    International Nuclear Information System (INIS)

    In the 1960th to 80th when current GEN II reactor technology was developed, the only possible approach was to use one-dimensional subchannel analysis to compute the flow inside a fuel bundle so that the subchannel scale could be resolved. For simulations of the whole reactor core either system codes or homogenization were employed. In system codes resolution of individual assemblies was the state of the art. Homogenization used porous media equations simulations and averaged the thermohydraulics on reactor core scale. Current potent computing power allows using Computational Fluid Dynamics (CFD) to simulate individual fuel assemblies. Yet the large number of fuel assemblies within the core forbids exploiting CFD for core wide simulation. We propose to combine ideas of subchannel analysis and CFD to develop a new methodology which takes advantage of the fast development of commercial CFD software and the efficiency of subchannel analysis. In this methodology was first applied to simulate a wire-wrap fuel bundle of the High Performance Light Water Reactor (HPLWR). Computations using an inviscid Euler solver on an extremely coarse grid were tuned to predict the true thermohydraulics by adding volumetric forces. These forces represent the non-resolved sub-grid physics. The volumetric forces cannot be measured directly. However, they can be accessed from detailed CFD simulations resolving all relevant physics. Parameterization of these subgrid forces can be realized analogous to models in subchannel codes. In the present work we extend the methodology to the open source solver OpenFOAM and a specific hexagonal fuel assembly which is studied in the framework of liquid metal cooled GEN IV reactor concepts. (orig.)

  1. Capabilities of Numerical Simulation of Multiphase Flows in Centrifugal Pumps using Modern CFD Software

    CERN Document Server

    Kochevsky, A N

    2005-01-01

    The paper describes capabilities of numerical simulation of liquid flows with solid and/or gas admixtures in centrifugal pumps using modern commercial CFD software packages, with the purpose to predict performance curves of the pumps treating such media. In particular, the approaches and multiphase flow models available in the package CFX-5 are described; their advantages and disadvantages are analyzed.

  2. Analysis of mass transfer characteristics in a tubular membrane using CFD modeling.

    Science.gov (United States)

    Yang, Jixiang; Vedantam, Sreepriya; Spanjers, Henri; Nopens, Ingmar; van Lier, Jules B

    2012-10-01

    In contrast to the large amount of research into aerobic membrane bioreactors, little work has been reported on anaerobic membrane bioreactors (AMBRs). As to the application of membrane bioreactors, membrane fouling is a key issue. Membrane fouling generally occurs more seriously in AMBRs than in aerobic membrane bioreactors. However, membrane fouling could be managed through the application of suitable shear stress that can be introduced by the application of a two-phase flow. When the two-phase flow is applied in AMBRs, little is known about the mass transfer characteristics, which is of particular importance, in tubular membranes of AMBRs. In our present work, we have employed fluid dynamic modeling to analyze the mass transfer characteristics in the tubular membrane of a side stream AMBR in which, gas-lift two-phase flow was applied. The modeling indicated that the mass transfer capacity at the membrane surface at the noses of gas bubbles was higher than the mass transfer capacity at the tails of the bubbles, which is in contrast to the results when water instead of sludge is applied. At the given mass transfer rate, the filterability of the sludge was found to have a strong influence on the transmembrane pressure at a steady flux. In addition, the model also showed that the shear stress in the internal space of the tubular membrane was mainly around 20 Pa but could be as high as about 40 Pa due to gas bubble movements. Nonetheless, at these shear stresses a stable particle size distribution was found for sludge particles.

  3. CFD modelling of condensation process of water vapor in supersonic flows

    DEFF Research Database (Denmark)

    Wen, Chuang; Walther, Jens Honore; Yan, Yuying;

    2016-01-01

    The condensation phenomenon of vapor plays an important role in various industries, such as the steam flow in turbines and refrigeration system. A mathematical model is developed to predict the spontaneous condensing phenomenon in the supersonic conditions using the nucleation and droplet growth......-liquid phase change both in space and in time. The spontaneous condensation of water vapor will not appear immediately when the steam reaches the saturation state. Instead, it occurs further downstream the nozzle throat, where the steam is in the state of supersaturation....

  4. CFD ANALYSIS OF FRANCIS TURBINE

    Directory of Open Access Journals (Sweden)

    Ravindra R. Navthar

    2012-07-01

    Full Text Available Hydroelectric power has become the most promising source in power sector to sustain the growth of any nation. In any hydroelectric power plant, hydraulic turbine plays a vital role which affects the overall performance of the plant and if utilized at suboptimal level, may lead to the loss of useful head. So, it becomes vital to predict the behavior of hydro-turbine under actual working conditions. Experimental approach of predicting the performance of hydro turbine is costly and time consuming compared to CFD approach. CFD has emerged out as a powerful tool for predicting the performance of mechanical bodies subjected to dynamic flow conditions. There are ample of evidences where analysts at various levels have taken the advantage of this tool to solve so many problems related to performance analysis. Along with it, simulation technique is key feature. The aim of this paper is to analyze the turbine for mechanical failure along with predicting its performance under actual operating condition by using CFD which is generally constrained by using a prototype. With the technique of simulation we can not only get the values of performance parameters but also the visualization of concentration and distribution of various parameters like pressure, velocity, stress at various locations where we may get versed with critical zones where the failure is supposed to occur.

  5. Experimental Measurements and CFD Simulations

    Directory of Open Access Journals (Sweden)

    Arijit A. Ganguli

    2012-01-01

    Full Text Available Bubble dynamics of a single condensing vapor bubble in a subcooled pool boiling system with a centrally heated cylindrical tank has been studied in the Rayleigh number range 7.9×1012CFD investigation has been performed using Volume of Fluid (VOF method. The heat source has been modeled using simple heat balance. The rise behavior of condensing bubbles (change in size during rise and path tracking was studied and the CFD model was validated both quantitatively and qualitatively.

  6. Numerical simulation for the upper airway flow characteristics of Chinese patients with OSAHS using CFD models.

    Science.gov (United States)

    Tan, Jie; Huang, Jianmin; Yang, Jianguo; Wang, Desheng; Liu, Jianzhi; Liu, Jingbo; Lin, Shuchun; Li, Chen; Lai, Haichun; Zhu, Hongyu; Hu, Xiaohua; Chen, Dongxu; Zheng, Longxiang

    2013-03-01

    OSAHS is a common disease with many factors related to the etiology. Airflow plays an important role in the pathogenesis of OSAHS. Previous research has not yielded a sufficient understanding of the relationship between airflow in upper airway and the pathophysiology of OSAHS. Therefore, a better understanding of the flow inside the upper airway in an OSAHS patient is necessary. In this study, ten Chinese adults with OSAHS were recruited. We used the software MIMICS 13.1 to construct 3-dimensional (3-D) models based on the computer tomography scans of them. The numerical simulations were carried out using the software ANSYS 12.0. We found that during the inhalation phase, the vortices and turbulences were located in both the anterior part of the cavity and nasopharynx. But there is no vortex in the whole nasal cavity during the expiratory phase. The airflow velocity is much higher than that of the normal models. The distributions of pressure and wall shear stress are different in two phases. The maximum velocity, pressure and wall shear stress (WSS) are located in velopharynx. It is notable that a strong negative pressure region is found in pharyngeal airway. The maximum velocity is 19.26 ± 12.4 and 19.46 ± 13.1 m/s; the average pressure drop is 222.71 ± 208.84 and 238.5 ± 218.56 Pa and the maximum average WSS is 0.72 ± 0.58 and 1.01 ± 0.61 Pa in inspiratory and expiratory, respectively. The changes of airflow due to the structure changes play an important role in the occurrence of collapse and obstruction of the upper airway, especially, the abnormal pressure changes in velopharyngeal during both inspiratory and expiratory phases. We can say that the airway narrowing in the pharynx may be one of the most important factors driving airway collapse. In addition, the most collapsible region of the pharyngeal airway of the patient with OSAHS may be the velopharynx and oropharynx. In spite of limitations, our results can provide a basis for the further research

  7. CFD simulations and reduced order modeling of a refrigerator compartment including radiation effects

    International Nuclear Information System (INIS)

    Highlights: ► Free convection in a refrigerator is simulated including radiation effects. ► Heat rates are affected drastically when radiation effects are considered. ► 95% of the flow energy can be represented by using one spatial POD mode. - Abstract: Considering the engineering problem of natural convection in domestic refrigerator applications, this study aims to simulate the fluid flow and temperature distribution in a single commercial refrigerator compartment by using the experimentally determined temperature values as the specified constant wall temperature boundary conditions. The free convection in refrigerator applications is evaluated as a three-dimensional (3D), turbulent, transient and coupled non-linear flow problem. Radiation heat transfer mode is also included in the analysis. According to the results, taking radiation effects into consideration does not change the temperature distribution inside the refrigerator significantly; however the heat rates are affected drastically. The flow inside the compartment is further analyzed with a reduced order modeling method called Proper Orthogonal Decomposition (POD) and the energy contents of several spatial and temporal modes that exist in the flow are examined. The results show that approximately 95% of all the flow energy can be represented by only using one spatial mode

  8. CFD Modeling of a Laser-Induced Ethane Pyrolysis in a Wall-less Reactor

    Science.gov (United States)

    Stadnichenko, Olga; Snytnikov, Valeriy; Yang, Junfeng; Matar, Omar

    2014-11-01

    Ethylene, as the most important feedstock, is widely used in chemical industry to produce various rubbers, plastics and synthetics. A recent study found the IR-laser irradiation induced ethane pyrolysis yields 25% higher ethylene production rates compared to the conventional steam cracking method. Laser induced pyrolysis is initiated by the generation of radicals upon heating of the ethane, then, followed by ethane/ethylene autocatalytic reaction in which ethane is converted into ethylene and other light hydrocarbons. This procedure is governed by micro-mixing of reactants and the feedstock residence time in reactor. Under mild turbulent conditions, the turbulence enhances the micro-mixing process and allows a high yield of ethylene. On the other hand, the high flow rate only allows a short residence time in the reactor which causes incomplete pyrolysis. This work attempts to investigate the interaction between turbulence and ethane pyrolysis process using large eddy simulation method. The modelling results could be applied to optimize the reactor design and operating conditions. Skolkovo Foundation through the UNIHEAT Project.

  9. CFD Model Development and validation for High Temperature Gas Cooled Reactor Cavity Cooling System (RCCS) Applications

    Energy Technology Data Exchange (ETDEWEB)

    Hassan, Yassin [Univ. of Wisconsin, Madison, WI (United Texas A & M Univ., College Station, TX (United States); Corradini, Michael; Tokuhiro, Akira; Wei, Thomas Y.C.

    2014-07-14

    The Reactor Cavity Cooling Systems (RCCS) is a passive safety system that will be incorporated in the VTHR design. The system was designed to remove the heat from the reactor cavity and maintain the temperature of structures and concrete walls under desired limits during normal operation (steady-state) and accident scenarios. A small scale (1:23) water-cooled experimental facility was scaled, designed, and constructed in order to study the complex thermohydraulic phenomena taking place in the RCCS during steady-state and transient conditions. The facility represents a portion of the reactor vessel with nine stainless steel coolant risers and utilizes water as coolant. The facility was equipped with instrumentation to measure temperatures and flow rates and a general verification was completed during the shakedown. A model of the experimental facility was prepared using RELAP5-3D and simulations were performed to validate the scaling procedure. The experimental data produced during the steady-state run were compared with the simulation results obtained using RELAP5-3D. The overall behavior of the facility met the expectations. The facility capabilities were confirmed to be very promising in performing additional experimental tests, including flow visualization, and produce data for code validation.

  10. On spurious behavior of CFD simulations

    Energy Technology Data Exchange (ETDEWEB)

    Yee, H.C. [National Aeronautics and Space Administration, Moffett Field, CA (United States). Ames Research Center; Torczynski, J.R. [Sandia National Labs., Albuquerque, NM (United States); Morton, S.A.; Visbal, M.R. [Wright Lab., Wright-Patterson AFB, OH (United States); Sweby, P.K. [Univ. of Reading (United Kingdom)

    1997-05-01

    Spurious behavior in underresolved grids and/or semi-implicit temporal discretizations for four computational fluid dynamics (CFD) simulations are studied. The numerical simulations consist of (a) a 1-D chemically relaxed nonequilibrium model, (b) the direct numerical simulation (DNS) of 2-D incompressible flow over a backward facing step, (c) a loosely-coupled approach for a 2-D fluid-structure interaction, and (d) a 3-D compressible unsteady flow simulation of vortex breakdown in delta wings. Using knowledge from dynamical systems theory, various types of spurious behaviors that are numerical artifacts were systematically identified. These studies revealed the various possible dangers of misinterpreting numerical simulation of realistic complex flows that are constrained by the available computing power. In large scale computations underresolved grids, semi-implicit procedures, loosely-coupled implicit procedures, and insufficiently long time integration in DNS are most often unavoidable. Consequently, care must be taken in both computation and in interpretation of the numerical data. The results presented confirm the important role that dynamical systems theory can play in the understanding of the nonlinear behavior of numerical algorithms and in aiding the identification of the sources of numerical uncertainties in CFD.

  11. CFD modeling and thermal-hydraulic analysis for the passive decay heat removal of a sodium-cooled fast reactor

    International Nuclear Information System (INIS)

    Research highlights: → The COOLOD/N2 and PARET/ANL codes were used for a steady-state thermal-hydraulic and safety analysis of the 2 MW TRIGA MARK II reactor located at the Nuclear Studies Center of Maamora (CENM), Morocco. → The main objective of this study is to ensure the safety margins of different safety related parameters by steady-state calculations at full power level (2 MW). → The most important conclusion is that all obtained values of DNBR, fuel center and surface temperature, cladding surface temperature and coolant temperature across the hottest channel are largely far to compromise safety of the reactor. - Abstract: In this study, a pool-typed design similar to sodium-cooled fast reactor (SFR) of the fourth generation reactors has been modeled using CFD simulations to investigate the characteristics of a passive mechanism of Shutdown Heat Removal System (SHRS). The main aim is to refine the reactor pool design in terms of temperature safety margin of the sodium pool. Thus, an appropriate protection mechanism is maintained in order to ensure the safety and integrity of the reactor system during a shutdown mode without using any active heat removal system. The impacts on the pool temperature are evaluated based on the following considerations: (1) the aspect ratio of pool diameter to depth, (2) the values of thermal emissivity of the surface materials of reactor and guard vessels, and (3) innerpool liner and core periphery structures. The computational results show that an optimal pool design in geometry can reduce the maximum pool temperature down to ∼551 oC which is substantially lower than ∼627 oC as calculated for the reference case. It is also concluded that the passive Reactor Air Cooling System (RACS) is effective in removing decay heat after shutdown. Furthermore, thermal radiation from the surface of the reactor vessel is found to be important; and thus, the selection of the vessel surface materials with a high emissivity would be a

  12. CFD modeling and thermal-hydraulic analysis for the passive decay heat removal of a sodium-cooled fast reactor

    Energy Technology Data Exchange (ETDEWEB)

    Hung, T.C., E-mail: tchung@ntut.edu.t [Department of Mechanical Engineering, National Taipei University of Technology, 1, Sec. 3, Chung-hsiao E. Rd., Taipei 10608, Taiwan (China); Dhir, V.K. [Department of Mechanical and Aerospace Engineering, UCLA, CA (United States); Chang, J.C. [Graduate Institute of Mechanical and Electrical Engineering, National Taipei University of Technology, Taiwan (China); Wang, S.K. [Department of Mechanical and Automation Engineering, I-Shou University, Taiwan (China)

    2011-01-15

    Research highlights: The COOLOD/N2 and PARET/ANL codes were used for a steady-state thermal-hydraulic and safety analysis of the 2 MW TRIGA MARK II reactor located at the Nuclear Studies Center of Maamora (CENM), Morocco. The main objective of this study is to ensure the safety margins of different safety related parameters by steady-state calculations at full power level (2 MW) The most important conclusion is that all obtained values of DNBR, fuel center and surface temperature, cladding surface temperature and coolant temperature across the hottest channel are largely far to compromise safety of the reactor. - Abstract: In this study, a pool-typed design similar to sodium-cooled fast reactor (SFR) of the fourth generation reactors has been modeled using CFD simulations to investigate the characteristics of a passive mechanism of Shutdown Heat Removal System (SHRS). The main aim is to refine the reactor pool design in terms of temperature safety margin of the sodium pool. Thus, an appropriate protection mechanism is maintained in order to ensure the safety and integrity of the reactor system during a shutdown mode without using any active heat removal system. The impacts on the pool temperature are evaluated based on the following considerations: (1) the aspect ratio of pool diameter to depth, (2) the values of thermal emissivity of the surface materials of reactor and guard vessels, and (3) innerpool liner and core periphery structures. The computational results show that an optimal pool design in geometry can reduce the maximum pool temperature down to {approx}551 {sup o}C which is substantially lower than {approx}627 {sup o}C as calculated for the reference case. It is also concluded that the passive Reactor Air Cooling System (RACS) is effective in removing decay heat after shutdown. Furthermore, thermal radiation from the surface of the reactor vessel is found to be important; and thus, the selection of the vessel surface materials with a high emissivity

  13. Experimental and CFD Studies of Coolant Flow Mixing within Scaled Models of the Upper and Lower Plenums of NGNP Gas-Cooled Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Hassan, Yassin [Texas A & M Univ., College Station, TX (United States); Anand, Nk [Texas A & M Univ., College Station, TX (United States)

    2016-03-30

    A 1/16th scaled VHTR experimental model was constructed and the preliminary test was performed in this study. To produce benchmark data for CFD validation in the future, the facility was first run at partial operation with five pipes being heated. PIV was performed to extract the vector velocity field for three adjacent naturally convective jets at statistically steady state. A small recirculation zone was found between the pipes, and the jets entered the merging zone at 3 cm from the pipe outlet but diverged as the flow approached the top of the test geometry. Turbulence analysis shows the turbulence intensity peaked at 41-45% as the jets mixed. A sensitivity analysis confirmed that 1000 frames were sufficient to measure statistically steady state. The results were then validated by extracting the flow rate from the PIV jet velocity profile, and comparing it with an analytic flow rate and ultrasonic flowmeter; all flow rates lie within the uncertainty of the other two methods for Tests 1 and 2. This test facility can be used for further analysis of naturally convective mixing, and eventually produce benchmark data for CFD validation for the VHTR during a PCC or DCC accident scenario. Next, a PTV study of 3000 images (1500 image pairs) were used to quantify the velocity field in the upper plenum. A sensitivity analysis confirmed that 1500 frames were sufficient to precisely estimate the flow. Subsequently, three (3, 9, and 15 cm) Y-lines from the pipe output were extracted to consider the output differences between 50 to 1500 frames. The average velocity field and standard deviation error that accrued in the three different tests were calculated to assess repeatability. The error was varied, from 1 to 14%, depending on Y-elevation. The error decreased as the flow moved farther from the output pipe. In addition, turbulent intensity was calculated and found to be high near the output. Reynolds stresses and turbulent intensity were used to validate the data by

  14. Investigations of Fluid-Structure-Coupling and Turbulence Model Effects on the DLR Results of the Fifth AIAA CFD Drag Prediction Workshop

    Science.gov (United States)

    Keye, Stefan; Togiti, Vamish; Eisfeld, Bernhard; Brodersen, Olaf P.; Rivers, Melissa B.

    2013-01-01

    The accurate calculation of aerodynamic forces and moments is of significant importance during the design phase of an aircraft. Reynolds-averaged Navier-Stokes (RANS) based Computational Fluid Dynamics (CFD) has been strongly developed over the last two decades regarding robustness, efficiency, and capabilities for aerodynamically complex configurations. Incremental aerodynamic coefficients of different designs can be calculated with an acceptable reliability at the cruise design point of transonic aircraft for non-separated flows. But regarding absolute values as well as increments at off-design significant challenges still exist to compute aerodynamic data and the underlying flow physics with the accuracy required. In addition to drag, pitching moments are difficult to predict because small deviations of the pressure distributions, e.g. due to neglecting wing bending and twisting caused by the aerodynamic loads can result in large discrepancies compared to experimental data. Flow separations that start to develop at off-design conditions, e.g. in corner-flows, at trailing edges, or shock induced, can have a strong impact on the predictions of aerodynamic coefficients too. Based on these challenges faced by the CFD community a working group of the AIAA Applied Aerodynamics Technical Committee initiated in 2001 the CFD Drag Prediction Workshop (DPW) series resulting in five international workshops. The results of the participants and the committee are summarized in more than 120 papers. The latest, fifth workshop took place in June 2012 in conjunction with the 30th AIAA Applied Aerodynamics Conference. The results in this paper will evaluate the influence of static aeroelastic wing deformations onto pressure distributions and overall aerodynamic coefficients based on the NASA finite element structural model and the common grids.

  15. CFD-DEM Simulations of Current-Induced Dune Formation and Morphological Evolution

    CERN Document Server

    Sun, Rui

    2015-01-01

    Understanding the fundamental mechanisms of sediment transport, particularly those during the formation and evolution of bedforms, is of critical scientific importance and has engineering relevance. Traditional approaches of sediment transport simulations heavily rely on empirical models, which are not able to capture the physics-rich, regime-dependent behaviors of the process. With the increase of available computational resources in the past decade, CFD-DEM (computational fluid dynamics-discrete element method) has emerged as a viable high-fidelity method for the study of sediment transport. However, a comprehensive, quantitative study of the generation and migration of different sediment bed patterns using CFD-DEM is still lacking. In this work, current-induced sediment transport problems in a wide range of regimes are simulated, including 'flat bed in motion', `small dune', `vortex dune' and suspended transport. Simulations are performed by using SediFoam, an open-source, massively parallel CFD-DEM solver...

  16. Asynchronous Parallelization of a CFD Solver

    Directory of Open Access Journals (Sweden)

    Daniel S. Abdi

    2015-01-01

    Full Text Available A Navier-Stokes equations solver is parallelized to run on a cluster of computers using the domain decomposition method. Two approaches of communication and computation are investigated, namely, synchronous and asynchronous methods. Asynchronous communication between subdomains is not commonly used in CFD codes; however, it has a potential to alleviate scaling bottlenecks incurred due to processors having to wait for each other at designated synchronization points. A common way to avoid this idle time is to overlap asynchronous communication with computation. For this to work, however, there must be something useful and independent a processor can do while waiting for messages to arrive. We investigate an alternative approach of computation, namely, conducting asynchronous iterations to improve local subdomain solution while communication is in progress. An in-house CFD code is parallelized using message passing interface (MPI, and scalability tests are conducted that suggest asynchronous iterations are a viable way of parallelizing CFD code.

  17. CFD simulations of the MEXICO rotor

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.; Zahle, Frederik

    2011-01-01

    The wake behind a wind turbine model is investigated using Computational Fluid Dynamics (CFD), and results are compared with measurements. The turbine investigated is the three‐bladed test rotor (D = 4.5 m) used in the Model Experiments in Controlled Conditions (MEXICO) wind tunnel experiment....... During the MEXICO experiment, particle image velocimetry measurements of the induction upstream and downstream of the rotor were performed for different operating conditions, giving a unique dataset to verify theoretical models and CFD models. The present paper first describes the efforts in reproducing...

  18. Investigation of different modeling approaches for computational fluid dynamics simulation of high-pressure rocket combustors

    Science.gov (United States)

    Ivancic, B.; Riedmann, H.; Frey, M.; Knab, O.; Karl, S.; Hannemann, K.

    2016-07-01

    The paper summarizes technical results and first highlights of the cooperation between DLR and Airbus Defence and Space (DS) within the work package "CFD Modeling of Combustion Chamber Processes" conducted in the frame of the Propulsion 2020 Project. Within the addressed work package, DLR Göttingen and Airbus DS Ottobrunn have identified several test cases where adequate test data are available and which can be used for proper validation of the computational fluid dynamics (CFD) tools. In this paper, the first test case, the Penn State chamber (RCM1), is discussed. Presenting the simulation results from three different tools, it is shown that the test case can be computed properly with steady-state Reynolds-averaged Navier-Stokes (RANS) approaches. The achieved simulation results reproduce the measured wall heat flux as an important validation parameter very well but also reveal some inconsistencies in the test data which are addressed in this paper.

  19. CFD Simulation of Polydispersed Bubbly Two-Phase Flow around an Obstacle

    Directory of Open Access Journals (Sweden)

    E. Krepper

    2009-01-01

    Full Text Available This paper concerns the model of a polydispersed bubble population in the frame of an ensemble averaged two-phase flow formulation. The ability of the moment density approach to represent bubble population size distribution within a multi-dimensional CFD code based on the two-fluid model is studied. Two different methods describing the polydispersion are presented: (i a moment density method, developed at IRSN, to model the bubble size distribution function and (ii a population balance method considering several different velocity fields of the gaseous phase. The first method is implemented in the Neptune_CFD code, whereas the second method is implemented in the CFD code ANSYS/CFX. Both methods consider coalescence and breakup phenomena and momentum interphase transfers related to drag and lift forces. Air-water bubbly flows in a vertical pipe with obstacle of the TOPFLOW experiments series performed at FZD are then used as simulations test cases. The numerical results, obtained with Neptune_CFD and with ANSYS/CFX, allow attesting the validity of the approaches. Perspectives concerning the improvement of the models, their validation, as well as the extension of their applicability range are discussed.

  20. Horizontal well performance flow simulation - CFD-application to model new perforation and facturation of tight and shale reservoir

    Energy Technology Data Exchange (ETDEWEB)

    Zeboudj, Faycal; Bahi, Lakhdar

    2010-09-15

    An understanding of flow along horizontal wells can be important for reservoir management, specially: Tight and shale reservoir, the flow field inside the wellbore can have a significant impact on the overall production characteristics of an oil reservoir. Flow in a well-bore is different from conventional pipe flow due to the presence of wall inflow or outflow and this affects the wall friction, acceleration, and flow patterns inside the pipe. To better understand wellbore flow, Computational Fluid Dynamics (CFD) simulation has been used. One of the applications of such information is the development of new techniques in the perforation technology and fracturation of shale and tight reservoir.

  1. Simulation and Scale-up of Barium Sulphate Precipitation Process Using CFD Modeling%应用CFD技术对工业结晶过程进行模拟和放大

    Institute of Scientific and Technical Information of China (English)

    龚俊波; 卫宏远; 王静康; John Garside

    2005-01-01

    Some empirical mixing models were used to describe the imperfect mixing in precipitation process.However, the models can not, in general, reflect the details of interactions between mixing and crystallization in a vessel. In this study, CFD (computational fluid dynamics) technique were developed by simulating the precipitation of barium sulphate in stirred tanks by integration of population balance equations with a CFD solver. Two typical impellers, Rushton and pitched blade turbines, were employed for agitation. The influence of feed concentration and position on crystal product properties was investigated by CFD simulation. The scale-up of these precipitators was systematically studied. Significant effect on the crystal properties was found for the scale-up under some conditions.

  2. Analysis of the Effect of Variation of Baffle Height on the Liquid Sloshing In the Tank with CFD Approach

    Directory of Open Access Journals (Sweden)

    Suresh Patil. G. L,

    2015-12-01

    Full Text Available Sloshing is a common physical phenomenon which occurs in moving tanks with contained liquid masses, such as liquid cargo carriers, rockets, aircrafts, and the seismically excited storage tanks, dams, reactors, and nuclear vessels. The sloshing frequencies of contained liquid are essential in the analysis and design of the liquid tanks and the associated structures. In this paper an attempt made with the VOF model and considered with immiscible fluids by solving a single set of momentum equations and tracking the volume fraction of each of the fluids throughout the domain. Further investigated the effect of the vertical baffle heights on the liquid sloshing in a three-dimensional (3D rectangular tank. studied dynamic analysis of sloshing in rectangular tanks with multiple vertical baffles. ANSYS-CFX software was used to study this dynamic analysis subjected to random excitations including earthquake induced motions. analytically estimated hydrodynamic damping ratio for liquid sloshing phenomenon in a partially filled rectangular tank for baffles. They used the velocity potential formulation and linear wave theory for analytic calculations.

  3. Visual Environments for CFD Research

    Science.gov (United States)

    Watson, Val; George, Michael W. (Technical Monitor)

    1994-01-01

    This viewgraph presentation gives an overview of the visual environments for computational fluid dynamics (CFD) research. It includes details on critical needs from the future computer environment, features needed to attain this environment, prospects for changes in and the impact of the visualization revolution on the human-computer interface, human processing capabilities, limits of personal environment and the extension of that environment with computers. Information is given on the need for more 'visual' thinking (including instances of visual thinking), an evaluation of the alternate approaches for and levels of interactive computer graphics, a visual analysis of computational fluid dynamics, and an analysis of visualization software.

  4. Thermal-hydraulic analysis of heat transfer in subchannels of the European high performance supercritical Water-Cooled Reactor for different CFD turbulence models

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Landy Y.; Rojas, Leorlen Y.; Gamez, Abel; Rosales, Jesus; Gonzalez, Daniel; Garcia, Carlos, E-mail: lcastro@instec.cu, E-mail: leored1984@gmail.com, E-mail: agamezgmf@gmail.com, E-mail: jrosales@instec.cu, E-mail: danielgonro@gmail.com, E-mail: cgh@instec.cu [Instituto Superior de Tecnologias y Ciencias Aplicadas (InSTEC), La Habana (Cuba); Oliveira, Carlos Brayner de, E-mail: cabol@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil); Dominguez, Dany S., E-mail: dsdominguez@gmail.com [Universidade Estadual de Santa Cruz (UESC), Ilheus, BA (Brazil). Pos-Graduacao em Modelagem Computacional

    2015-07-01

    Chosen as one of six Generation‒IV nuclear-reactor concepts, Supercritical Water-cooled Reactors (SCWRs) are expected to have high thermal efficiencies within the range of 45 - 50% owing to the reactor's high pressures and outlet temperatures. In this reactor, the primary water enters the core under supercritical-pressure condition (25 MPa) at a temperature of 280 deg C and leaves it at a temperature of up to 510 deg C. Due to the significant changes in the physical properties of water at supercritical-pressure, the system is susceptible to local temperature, density and power oscillations. The behavior of supercritical water into the core of the SCWR, need to be sufficiently studied. Most of the methods available to predict the effects of the heat transfer phenomena within the pseudocritical region are based on empirical one-directional correlations, which do not capture the multidimensional effects and do not provide accurate results in regions such as the deteriorated heat transfer regime. In this paper, computational fluid dynamics (CFD) analysis was carried out to study the thermal-hydraulic behavior of supercritical water flows in sub-channels of a typical European High Performance Light Water Reactor (HPLWR) fuel assembly using commercial CFD code CFX-14. It was determined the steady-state equilibrium parameters and calculated the temperature and density distributions. A comparative study for different turbulence models were carried out and the obtained results are discussed. (author)

  5. Applications of traditional pump design theory to artificial heart and CFD simulation

    Institute of Scientific and Technical Information of China (English)

    Yingpeng WANG; Xinwei SONG; Chuntong YING

    2008-01-01

    A novel heart pump model was obtained by improving the traditional axial pump design theory with the consideration of working and hydraulic situations for artificial hearts. The pump head range and the velocity triangle were introduced and an iterative approach was utilized for the initial model. Moreover, computational fluid dynamics (CFD) simulations were performed to determine relevant model parameters. The results show that this procedure can be used for designing a series of high-efficiency artificial heart pumps.

  6. CFD Simulation of Polydispersed Bubbly Two-Phase Flow around an Obstacle

    OpenAIRE

    E. Krepper; Ruyer, P.; Beyer, M.; Lucas, D.; H.-M. Prasser; Seiler, N

    2009-01-01

    This paper concerns the model of a polydispersed bubble population in the frame of an ensemble averaged two-phase flow formulation. The ability of the moment density approach to represent bubble population size distribution within a multi-dimensional CFD code based on the two-fluid model is studied. Two different methods describing the polydispersion are presented: (i) a moment density method, developed at IRSN, to model the bubble size distribution function and (ii) a population balance meth...

  7. Numerical Simulation of Desulfurization Behavior in Gas-Stirred Systems Based on Computation Fluid Dynamics-Simultaneous Reaction Model (CFD-SRM) Coupled Model

    Science.gov (United States)

    Lou, Wentao; Zhu, Miaoyong

    2014-10-01

    A computation fluid dynamics-simultaneous reaction model (CFD-SRM) coupled model has been proposed to describe the desulfurization behavior in a gas-stirred ladle. For the desulfurization thermodynamics, different models were investigated to determine sulfide capacity and oxygen activity. For the desulfurization kinetic, the effect of bubbly plume flow, as well as oxygen absorption and oxidation reactions in slag eyes are considered. The thermodynamic and kinetic modification coefficients are proposed to fit the measured data, respectively. Finally, the effects of slag basicity and gas flow rate on the desulfurization efficiency are investigated. The results show that as the interfacial reactions (Al2O3)-(FeO)-(SiO2)-(MnO)-[S]-[O] simultaneous kinetic equilibrium is adopted to determine the oxygen activity, and the Young's model with the modification coefficient R th of 1.5 is adopted to determine slag sulfide capacity, the predicted sulfur distribution ratio LS agrees well with the measured data. With an increase of the gas blowing time, the predicted desulfurization rate gradually decreased, and when the modification parameter R k is 0.8, the predicted sulfur content changing with time in ladle agrees well with the measured data. If the oxygen absorption and oxidation reactions in slag eyes are not considered in this model, then the sulfur removal rate in the ladle would be overestimated, and this trend would become more obvious with an increase of the gas flow rate and decrease of the slag layer height. With the slag basicity increasing, the total desulfurization ratio increases; however, the total desulfurization ratio changes weakly as the slag basicity exceeds 7. With the increase of the gas flow rate, the desulfurization ratio first increases and then decreases. When the gas flow rate is 200 NL/min, the desulfurization ratio reaches a maximum value in an 80-ton gas-stirred ladle.

  8. CFD Simulations of Joint Urban Atmospheric Dispersion Field Study

    Energy Technology Data Exchange (ETDEWEB)

    Lee, R; Humphreys III, T; Chan, S

    2004-06-17

    The application of Computational Fluid Dynamics (CFD) to the understanding of urban wind flow and dispersion processes has gained increasing attention over recent years. While many of the simpler dispersion models are based on a set of prescribed meteorology to calculate dispersion, the CFD approach has the ability of coupling the wind field to dispersion processes. This has distinct advantages when very detailed results are required, such as for the case where the releases occur around buildings and within urban areas. CFD also has great flexibility as a testbed for turbulence models, which has important implications for atmospheric dispersion problems. In the spring of 2003, a series of dispersion field experiments (Joint Urban 2003) were conducted at Oklahoma City (Allwine, et. al, 2004). These experiments were complimentary to the URBAN 2000 field studies at Salt Lake City (Shinn, et. al, 2000) in that they will provide a second set of comprehensive field data for evaluation of CFD as well as for other dispersion models. In contrast to the URBAN 2000 experiments that were conducted entirely at night, these new field studies took place during both daytime and nighttime thus including the possibility of convective as well as stable atmospheric conditions. Initially several CFD modeling studies were performed to provide guidance for the experimental team in the selection of release sites and in the deployment of wind and concentration sensors. Also, while meteorological and concentration measurements were taken over the greater Oklahoma City urban area, our CFD calculations were focused on the near field of the release point. The proximity of the source to a large commercial building and to the neighboring buildings several of which have multistories, present a significant challenge even for CFD calculations involving grid resolutions as fine as 1 meter. A total of 10 Intensive Observations Periods (IOP's) were conducted within the 2003 field experiments. SF6

  9. CFD analysis of poison injection in AHWR calandria

    International Nuclear Information System (INIS)

    The present work intends to give details of design and performance validation of SDS-2. The performance is evaluated on the basis of dispersion of poison in calandria in a given period of time. Location of injection tube and injection holes, size of jet hole and number of holes are some of the design parameters which greatly affect dispersion of poison in calandria. A Computational Fluid Dynamic (CFD) study for axial and radial injection of poison was carried out using open source CFD code OpenFOAM. CFD benchmarking was done using experiments performed by Johari (Johari et al. 1997) to identify suitable turbulence model for this problem. An experimental facility simulating poison injection in moderator in presence of calandria tubes was used to further validate the CFD model is shown in the paper. CFD analysis was carried out for axial as well as radial injection for AHWR geometry. CFD analysis using OpenFOAM has been carried out to study high pressure poison injection for single jet of Shut Down System - 2 (SDS- 2) of Advanced Heavy Water Reactor (AHWR) for various design options. CFD model used in analysis have been validated with experimental data available in literature as well as experiments performed for AHWR specific geometry. Various turbulence models are tested and their adequacy for such flow problems has been established. The CFD model is then used to simulate poison injection for two design options for AHWR and their performance is compared. (author)

  10. 基于CFD的潜艇模型水池试验方法研究%Test method of submarine model test in towing tank by CFD

    Institute of Scientific and Technical Information of China (English)

    郑亚雄; 史圣哲; 许靖锋

    2016-01-01

    The submarine model test in a towing tank is greatly different from the test conducted under the unlimited condition. This paper studies the inlfuences of the connection device in test and the size of the towing tank size on the submarine model test by the computational lfuid dynamic(CFD) method. The submarine sailing in the unlimited condition is ifrstly simulated to check and evaluate the CFD settings. Then, the submarine model test in towing tank is modeled and calculated. The results are analyzed to investigate the effects of the connection devices, the side wall and the bottom on the force measurement. Finally, the numerical simulation results are combined with the model test results to verify the feasibility of the test facilities.%潜艇水池试验与深广水域航行区别很大,采用计算流体力学(CFD)方法研究试验连接装置及试验水池尺度对潜艇试验的影响。首先对深广水域的潜艇进行计算,以此来校核CFD算法;然后对潜艇试验实况进行建模计算,根据计算结果来分析模型连接件、池壁和池底效应等对于潜艇受力测试的影响;最后结合实际试验和仿真计算结果,分析并证明试验装置的可行性。

  11. An improved approach for tank purge modeling

    Science.gov (United States)

    Roth, Jacob R.; Chintalapati, Sunil; Gutierrez, Hector M.; Kirk, Daniel R.

    2013-05-01

    Many launch support processes use helium gas to purge rocket propellant tanks and fill lines to rid them of hazardous contaminants. As an example, the purge of the Space Shuttle's External Tank used approximately 1,100 kg of helium. With the rising cost of helium, initiatives are underway to examine methods to reduce helium consumption. Current helium purge processes have not been optimized using physics-based models, but rather use historical 'rules of thumb'. To develop a more accurate and useful model of the tank purge process, computational fluid dynamics simulations of several tank configurations were completed and used as the basis for the development of an algebraic model of the purge process. The computationally efficient algebraic model of the purge process compares well with a detailed transient, three-dimensional computational fluid dynamics (CFD) simulation as well as with experimental data from two external tank purges.

  12. 双级膨胀腔消声器声学与阻力特性的CFD仿真分析%Simulative Analysis of Acoustic Attenuation and Flow Resistance Characteristics of a Double Expansion Chamber Silencer Using CFD Approach

    Institute of Scientific and Technical Information of China (English)

    苏胜利; 汪利; 卢兆刚; 鲁民月

    2014-01-01

    使用二维轴对称时域CFD法计算双级膨胀腔消声器在无流和有流条件下的声衰减性能,并与实测结果进行比较。由于时域方法在计算中可以考虑复杂气流流动和介质粘性的影响,因而可以比较准确地预测双级膨胀腔消声器的传递损失。基于定常流动模型,使用Fluent软件预测双级膨胀腔消声器的压力损失,CFD计算结果与实验测量结果吻合良好。%The axisymmetric time-domain CFD method is employed to calculate the acoustic attenuation performance of a double expansion chamber silencer without and with air flow. The prediction results are compared with the experimental measurement data. Since the influences of complex gas flow and viscosity on the sound propagation and attenuation inside the silencer are included in the time-domain CFD simulation, the time-domain CFD method can accurately predict the transmission loss of the double expansion chamber silencer. Finally, the pressure drops of the double expansion chamber silencer are calculated by means of Fluent code based on the steady flow model. The CFD predictions are found to agree well with the experimental results.

  13. Thermal management optimization of a thermoelectric-integrated methanol evaporator using a compact CFD modeling approach

    DEFF Research Database (Denmark)

    Xin, Gao; Chen, Min; Snyder, G. Jeffrey;

    2013-01-01

    , and uses a different material property acquisition method based on module manufacturers’ datasheets. Secondly, a simulation study is carried out on the novel evaporator to minimize its thermal resistance and to assess the evaporator pressure drop. The factors studied include: type of the fins of the heat...

  14. Modelling of Combustion and Pollutant Formation in a Large, Two-Stroke Marine Diesel Engine using Integrated CFD-Skeletal Chemical Mechanism

    DEFF Research Database (Denmark)

    Pang, Kar Mun; Karvounis, Nikolas; Schramm, Jesper;

    In this reported work, simulation studies of in-cylinder diesel combustion and pollutant formation processesin a two-stroke, low-speed uniflow-scavenged marine diesel engine are presented. Numerical computation is performed by integrating chemical kinetics into CFD computations. In order......). Prior to the marine engine simulation,coupling of the newly developed surrogate fuel model and a revised multi-step soot model [1] is validated on the basis of optical diagnostics measurement obtained at varying ambient pressure levels [2]. It is demonstrated that the variation of ignition delay times...... characteristics under high load condition in a marine diesel engine. Comparisons to the measurement show that the simulated pressure rise started 1.0 crank angle degree in advance and the calculated peak pressure is 1.7 % lower. The associated flame liftoff length is negligible, yielding high local equivalence...

  15. CFD computations of the second round of MEXICO rotor measurements

    DEFF Research Database (Denmark)

    Sørensen, Niels N.; Zahle, Frederik; Boorsma, K.;

    2016-01-01

    A comparison, between selected wind tunnel data from the NEW MEXICO measuring campaign and CFD computations are shown. The present work, documents that a state of the art CFD code, including a laminar turbulent transition model, can provide good agreement with experimental data. Good agreement...

  16. CFD study of ejector flow behavior in a blast furnace gas galvanizing plant

    Science.gov (United States)

    Besagni, Giorgio; Mereu, Riccardo; Inzoli, Fabio

    2015-02-01

    In recent years, there has been a growing interest toward Blast Furnace Gas (BFG) as a low-grade energy source for industrial furnaces. This paper considers the revamping of a galvanic plant furnace converted to BFG from natural gas. In the design of the new system, the ejector on the exhaust line is a critical component. This paper studies the flow behavior of the ejector using a Computational Fluid Dynamics (CFD) analysis. The CFD model is based on a 3D representation of the ejector, using air and exhaust gases as working fluids. This paper is divided in three parts. In the first part, the galvanic plant used as case study is presented and discussed, in the second part the CFD approach is outlined, and in the third part the CFD approach is validated using experimental data and the numerical results are presented and discussed. Different Reynolds-Averaged Navier-Stokes (RANS) turbulence models ( k-ω SST and k-ɛ Realizable) are evaluated in terms of convergence capability and accuracy in predicting the pressure drop along the ejector. Suggestions for future optimization of the system are also provided.

  17. Deformation simulation of cells seeded on a collagen-GAG scaffold in a flow perfusion bioreactor using a sequential 3D CFD-elastostatics model.

    Science.gov (United States)

    Jungreuthmayer, C; Jaasma, M J; Al-Munajjed, A A; Zanghellini, J; Kelly, D J; O'Brien, F J

    2009-05-01

    Tissue-engineered bone shows promise in meeting the huge demand for bone grafts caused by up to 4 million bone replacement procedures per year, worldwide. State-of-the-art bone tissue engineering strategies use flow perfusion bioreactors to apply biophysical stimuli to cells seeded on scaffolds and to grow tissue suitable for implantation into the patient's body. The aim of this study was to quantify the deformation of cells seeded on a collagen-GAG scaffold which was perfused by culture medium inside a flow perfusion bioreactor. Using a microCT scan of an unseeded collagen-GAG scaffold, a sequential 3D CFD-deformation model was developed. The wall shear stress and the hydrostatic wall pressure acting on the cells were computed through the use of a CFD simulation and fed into a linear elastostatics model in order to calculate the deformation of the cells. The model used numerically seeded cells of two common morphologies where cells are either attached flatly on the scaffold wall or bridging two struts of the scaffold. Our study showed that the displacement of the cells is primarily determined by the cell morphology. Although cells of both attachment profiles were subjected to the same mechanical load, cells bridging two struts experienced a deformation up to 500 times higher than cells only attached to one strut. As the scaffold's pore size determines both the mechanical load and the type of attachment, the design of an optimal scaffold must take into account the interplay of these two features and requires a design process that optimizes both parameters at the same time. PMID:19109048

  18. Loss of vacuum accident (LOVA): Comparison of computational fluid dynamics (CFD) flow velocities against experimental data for the model validation

    Energy Technology Data Exchange (ETDEWEB)

    Bellecci, C.; Gaudio, P.; Lupelli, I. [Faculty of Engineering, University of Rome ' Tor Vergata' , Via del Politecnico 1, 00133 Rome (Italy); Malizia, A., E-mail: malizia@ing.uniroma2.it [Faculty of Engineering, University of Rome ' Tor Vergata' , Via del Politecnico 1, 00133 Rome (Italy); Porfiri, M.T. [ENEA Nuclear Fusion Technologies, Via Enrico Fermi 45 I, 00044, Frascati (Italy); Quaranta, R.; Richetta, M. [Faculty of Engineering, University of Rome ' Tor Vergata' , Via del Politecnico 1, 00133 Rome (Italy)

    2011-06-15

    A recognized safety issue for future fusion reactors fueled with deuterium and tritium is the generation of sizeable quantities of dust. Several mechanisms resulting from material response to plasma bombardment in normal and off-normal conditions are responsible for generating dust of micron and sub-micron length scales inside the VV (Vacuum Vessel) of experimental fusion facilities. The loss of coolant accidents (LOCA), loss of coolant flow accidents (LOFA) and loss of vacuum accidents (LOVA) are types of accidents, expected in experimental fusion reactors like ITER, that may jeopardize components and plasma vessel integrity and cause dust mobilization risky for workers and public. The air velocity is the driven parameter for dust resuspension and its characterization, in the very first phase of the accidents, is critical for the dust release. To study the air velocity trend a small facility, Small Tank for Aerosol Removal and Dust (STARDUST), was set up at the University of Rome 'Tor Vergata', in collaboration with ENEA Frascati laboratories. It simulates a low pressurization rate (300 Pa/s) LOVA event in ITER due to a small air inlet from two different positions of the leak: at the equatorial port level and at the divertor port level. The velocity magnitude in STARDUST was investigated in order to map the velocity field by means of a punctual capacitive transducer placed inside STARDUST without obstacles. FLUENT was used to simulate the flow behavior for the same LOVA scenarios used during the experimental tests. The results of these simulations were compared against the experimental data for CFD code validation. For validation purposes, the CFD simulation data were extracted at the same locations as the experimental data were collected for the first four seconds, because at the beginning of the experiments the maximum velocity values (that could cause the almost complete dust mobilization) have been measured. In this paper the authors present and

  19. Development of multi-component diesel surrogate fuel models – Part II:Validation of the integrated mechanisms in 0-D kinetic and 2-D CFD spray combustion simulations

    DEFF Research Database (Denmark)

    Poon, Hiew Mun; Pang, Kar Mun; Ng, Hoon Kiat;

    2016-01-01

    -dimensional chemical kinetic simulations under a wide range of shock tube and jetstirred reactor conditions. Subsequently, the fidelity of the surrogate models is further evaluated in two-dimensional CFD spray combustion simulations. Simulation results show that ignition delay (ID) prediction corresponds well...

  20. Preliminary study of airflow and heat transfer in a cold room filled with apple pallets: Comparison between two modelling approaches and experimental results

    OpenAIRE

    Duret, Steven; Flick, Denis; Laguerre, Onrawee

    2015-01-01

    Two CFD modelling approaches of transient heat transfer by forced convection in a cold room filled with four apple pallets have been performed and compared with experimental data. For the first approach, each apple pallet is considered as one porous medium block. For the second, each pallet is considered as 8 solid blocks representing the apple bins. The numerical results obtained by these two approaches show a good agreement with the experimental results regarding air velocity and product te...

  1. Model Construct Based Enterprise Model Architecture and Its Modeling Approach

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    In order to support enterprise integration, a kind of model construct based enterprise model architecture and its modeling approach are studied in this paper. First, the structural makeup and internal relationships of enterprise model architecture are discussed. Then, the concept of reusable model construct (MC) which belongs to the control view and can help to derive other views is proposed. The modeling approach based on model construct consists of three steps, reference model architecture synthesis, enterprise model customization, system design and implementation. According to MC based modeling approach a case study with the background of one-kind-product machinery manufacturing enterprises is illustrated. It is shown that proposal model construct based enterprise model architecture and modeling approach are practical and efficient.

  2. Uncovering MIT wind myths through micro-climatological CFD analysis

    CERN Document Server

    Kalmikov, Alexander

    2013-01-01

    Popular campus myths of unusually strong pedestrian level winds are investigated with a Computational Fluid Dynamics (CFD) approach. The numerical simulations confirm the existence of the reported phenomena and provide a qualitative explanation of their physical mechanisms.

  3. CFD Modeling of Solid Suspension in a Stirred Tank: Effect of Drag Models and Turbulent Dispersion on Cloud Height

    Directory of Open Access Journals (Sweden)

    Shitanshu Gohel

    2012-01-01

    Full Text Available Many chemical engineering processes involve the suspension of solid particles in a liquid. In dense systems, agitation leads to the formation of a clear liquid layer above a solid cloud. Cloud height, defined as the location of the clear liquid interface, is a critical measure of process performance. In this study, solid-liquid mixing experiments were conducted and cloud height was measured as a function operating conditions and stirred tank configuration. Computational fluid dynamics simulations were then performed using an Eulerian-Granular multiphase model. The effects of hindered and unhindered drag models and turbulent dispersion force on cloud height were investigated. A comparison of the experimental and computational data showed excellent agreement over the full range of conditions tested.

  4. Developments in Impeller/Seal Secondary Flow Path Modeling for Dynamic Force Coefficients and Leakage

    Science.gov (United States)

    Palazzolo, Alan; Bhattacharya, Avijit; Athavale, Mahesh; Venkataraman, Balaji; Ryan, Steve; Funston, Kerry

    1997-01-01

    This paper highlights bulk flow and CFD-based models prepared to calculate force and leakage properties for seals and shrouded impeller leakage paths. The bulk flow approach uses a Hir's based friction model and the CFD approach solves the Navier Stoke's (NS) equation with a finite whirl orbit or via analytical perturbation. The results show good agreement in most instances with available benchmarks.

  5. CFD simulation of neutral ABL flows

    DEFF Research Database (Denmark)

    Zhang, Xiaodong

    and top boundary condition. Fluent employ wall function roughness modifications based on data from experiments with sand grain roughened pipes and channels, describe wall adjacent zone with Roughness Height (Ks) instead of Roughness Length (z0). In a CFD simulation of ABL flow, the mean wind velocity...... ABL and the measurements are best documented until now. Comparison with measured data shows that the CFD model can well predict the velocity field and relative turbulence kinetic energy field. Furthermore, a series of artificial complex terrains are designed, and some of the main simulation results...

  6. Multiple Model Approaches to Modelling and Control,

    DEFF Research Database (Denmark)

    solving. More complex plants, advances in information technology, and tightened economical and environmental constraints in recent years have lead topractising engineers being faced with modelling and control problems of increasing complexity. When confronted with such problems, there is a strongintuitive......Why Multiple Models?This book presents a variety of approaches which produce complex models or controllers by piecing together a number of simpler subsystems. Thisdivide-and-conquer strategy is a long-standing and general way of copingwith complexity in engineering systems, nature and human problem...... appeal in building systems which operate robustly over a wide range of operating conditions by decomposing them into a number of simplerlinear modelling or control problems, even for nonlinear modelling or control problems. This appeal has been a factor in the development of increasinglypopular `local...

  7. Combining CFD simulation with experimental RTD function for hydrocyclone separator studies

    International Nuclear Information System (INIS)

    The first part of this report presents radiotracer experimental Residence Time Distribution (RTD) functions for hydrocyclone separators, their analysis and macro modelling. The second part of the report presents the Computational Fluid Dynamics (CFD) simulation for the hydrocyclone. Combining the experimental data and the CFD simulation results allows understanding the fundamental principles of the flow and solids' separation in hydrocyclone. The experimental data help choosing the proper parameters for CFD simulation and from the other side the CFD results allow better analysis and macro modelling of the experimental data. Radiotracer methods have been used for industrial experiments. For CFD simulation the FLUENT software has been applied. (author)

  8. The TALL-3D facility design and commissioning tests for validation of coupled STH and CFD codes

    International Nuclear Information System (INIS)

    Highlights: • Design of a heavy liquid thermal-hydraulic loop for CFD/STH code validation. • Description of the loop instrumentation and assessment of measurement error. • Experimental data from forced to natural circulation transient. - Abstract: Application of coupled CFD (Computational Fluid Dynamics) and STH (System Thermal Hydraulics) codes is a prerequisite for computationally affordable and sufficiently accurate prediction of thermal-hydraulics of complex systems. Coupled STH and CFD codes require validation for understanding and quantification of the sources of uncertainties in the code prediction. TALL-3D is a liquid Lead Bismuth Eutectic (LBE) loop developed according to the requirements for the experimental data for validation of coupled STH and CFD codes. The goals of the facility design are to provide (i) mutual feedback between natural circulation in the loop and complex 3D mixing and stratification phenomena in the pool-type test section, (ii) a possibility to validate standalone STH and CFD codes for each subsection of the facility, and (iii) sufficient number of experimental data to separate the process of input model calibration and code validation. Description of the facility design and its main components, approach to estimation of experimental uncertainty and calibration of model input parameters that are not directly measured in the experiment are discussed in the paper. First experimental data from the forced to natural circulation transient is also provided in the paper

  9. Wind Loads on Ships and Offshore Structures Estimated by CFD

    DEFF Research Database (Denmark)

    Aage, Christian; Hvid, S.L.; Hughes, P.H.;

    1997-01-01

    on a seagoing ferry and on a semisubmersible offshore platform have been estimated by CFD. The results have been compared with wind tunnel model tests and, for the ferry, a few full-scale measurements, and good agreement is obtained. The CFD method offers the possibility of a computational estimate of scale...... effects related to wind tunnel model testing. An example of such an estimate on the ferry is discussed. Due to the time involved in generating the computational mesh and in computing the solution, the CFD method is not at the moment economically competitive to routine wind tunnel model testing....

  10. Steady and transient CFD analysis of automotive fans

    Energy Technology Data Exchange (ETDEWEB)

    Damodaran, V. [General Motors, Pontiac Product Center, Pontiac, Michigan (United States)]. E-mail: vijay.damodaran@gm.com; Danciu, J. [Optimal CAE, Inc., Novi, Michigan (United States)]. E-mail: john.danciu@gm.com

    2002-07-01

    The objective of this paper is to study different approaches in the numerical generation of fan curves. A steady state approximation of the fan using a Multiple Reference Frame (MRF) method is the most common CFD approach to generate fan curves. In this paper both the MRF method of modeling the fan and a fully transient model of the fan with moving mesh were created to compare the differences between the two approaches. A methodology to compute the system resistance at a particular vehicle speed using fan curves is also discussed. One advantage of doing a transient analysis is to determine velocity and pressure signals downstream of the fan. These signals are transformed into the frequency domain using Fast Fourier Transforms (FFT). The peak signal frequencies showed a strong correlation to the blade passing frequency and the fan rpm. (author)

  11. Steady and transient CFD analysis of automotive fans

    International Nuclear Information System (INIS)

    The objective of this paper is to study different approaches in the numerical generation of fan curves. A steady state approximation of the fan using a Multiple Reference Frame (MRF) method is the most common CFD approach to generate fan curves. In this paper both the MRF method of modeling the fan and a fully transient model of the fan with moving mesh were created to compare the differences between the two approaches. A methodology to compute the system resistance at a particular vehicle speed using fan curves is also discussed. One advantage of doing a transient analysis is to determine velocity and pressure signals downstream of the fan. These signals are transformed into the frequency domain using Fast Fourier Transforms (FFT). The peak signal frequencies showed a strong correlation to the blade passing frequency and the fan rpm. (author)

  12. Multi-dimensional boron transport modeling in subchannel approach: Part I. Model selection, implementation and verification of COBRA-TF boron tracking model

    Energy Technology Data Exchange (ETDEWEB)

    Ozdemir, Ozkan Emre, E-mail: ozdemir@psu.edu [Department of Mechanical and Nuclear Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Avramova, Maria N., E-mail: mna109@psu.edu [Department of Mechanical and Nuclear Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Sato, Kenya, E-mail: kenya_sato@mhi.co.jp [Mitsubishi Heavy Industries (MHI), Kobe (Japan)

    2014-10-15

    Highlights: ► Implementation of multidimensional boron transport model in a subchannel approach. ► Studies on cross flow mechanism, heat transfer and lateral pressure drop effects. ► Verification of the implemented model via code-to-code comparison with CFD code. - Abstract: The risk of reflux condensation especially during a Small Break Loss Of Coolant Accident (SB-LOCA) and the complications of tracking the boron concentration experimentally inside the primary coolant system have stimulated and subsequently have been a focus of many computational studies on boron tracking simulations in nuclear reactors. This paper presents the development and implementation of a multidimensional boron transport model with Modified Godunov Scheme within a thermal-hydraulic code based on a subchannel approach. The cross flow mechanism in multiple-subchannel rod bundle geometry as well as the heat transfer and lateral pressure drop effects are considered in the performed studies on simulations of deboration and boration cases. The Pennsylvania State University (PSU) version of the COBRA-TF (CTF) code was chosen for the implementation of three different boron tracking models: First Order Accurate Upwind Difference Scheme, Second Order Accurate Godunov Scheme, and Modified Godunov Scheme. Based on the performed nodalization sensitivity studies, the Modified Godunov Scheme approach with a physical diffusion term was determined to provide the best solution in terms of precision and accuracy. As a part of the verification and validation activities, a code-to-code comparison was carried out with the STAR-CD computational fluid dynamics (CFD) code and presented here. The objective of this study was two-fold: (1) to verify the accuracy of the newly developed CTF boron tracking model against CFD calculations; and (2) to investigate its numerical advantages as compared to other thermal-hydraulics codes.

  13. Multi-dimensional boron transport modeling in subchannel approach: Part I. Model selection, implementation and verification of COBRA-TF boron tracking model

    International Nuclear Information System (INIS)

    Highlights: ► Implementation of multidimensional boron transport model in a subchannel approach. ► Studies on cross flow mechanism, heat transfer and lateral pressure drop effects. ► Verification of the implemented model via code-to-code comparison with CFD code. - Abstract: The risk of reflux condensation especially during a Small Break Loss Of Coolant Accident (SB-LOCA) and the complications of tracking the boron concentration experimentally inside the primary coolant system have stimulated and subsequently have been a focus of many computational studies on boron tracking simulations in nuclear reactors. This paper presents the development and implementation of a multidimensional boron transport model with Modified Godunov Scheme within a thermal-hydraulic code based on a subchannel approach. The cross flow mechanism in multiple-subchannel rod bundle geometry as well as the heat transfer and lateral pressure drop effects are considered in the performed studies on simulations of deboration and boration cases. The Pennsylvania State University (PSU) version of the COBRA-TF (CTF) code was chosen for the implementation of three different boron tracking models: First Order Accurate Upwind Difference Scheme, Second Order Accurate Godunov Scheme, and Modified Godunov Scheme. Based on the performed nodalization sensitivity studies, the Modified Godunov Scheme approach with a physical diffusion term was determined to provide the best solution in terms of precision and accuracy. As a part of the verification and validation activities, a code-to-code comparison was carried out with the STAR-CD computational fluid dynamics (CFD) code and presented here. The objective of this study was two-fold: (1) to verify the accuracy of the newly developed CTF boron tracking model against CFD calculations; and (2) to investigate its numerical advantages as compared to other thermal-hydraulics codes

  14. Dicty_cDB: CFD579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD579 (Link to dictyBase) - - - Contig-U16381-1 CFD579P (Link to Original site) CFD...579F 129 CFD579Z 319 CFD579P 448 - - Show CFD579 Library CF (Link to library) Clone ID CFD... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-D/CFD579Q.Seq.d/ Representative seq. ID CFD...579P (Link to Original site) Representative DNA sequence >CFD579 (CFD579Q) /CSM/CF/CFD5-D/CFD5...alignments: (bits) Value CFD579 (CFD579Q) /CSM/CF/CFD5-D/CFD579Q.Seq.d/ 220 1e-56 CFD769 (CFD769Q) /CSM/CF/CFD7-C/CFD

  15. CFD Applications in Energy and Environment Sectors: Volume 1

    Directory of Open Access Journals (Sweden)

    Maher A.R. Sadiq Al-Baghdadi and Hashim R. Abdol Hamid

    2012-01-01

    Full Text Available Chapter 1: Simulation and Modelling of Oxygen Coal Combustion with Flue Gas Recirculation. Chaouki Ghenai Chapter 2: The Choice of the Best Air Distribution Concept in Air-Conditioned Auditorium by Means of CFD Numerical Prediction. Barbara Lipska, Piotr Koper Chapter 3: CFD Applications in Natural Ventilation of Buildings and Air Quality Dispersion. N. Nikolopoulos, A. Nikolopoulos, I. Papadakis, K.-S. P. Nikas Chapter 4: CFD Modeling of Air Pollutant Transport and Dispersion. Labovský Juraj, Jelemenský Ľudovít Chapter 5: CFD Modeling of Multiphase Flow in Environmental Engineering. Masroor Mohajerani, Mehrab Mehrvar, Farhad Ein-Mozaffari Chapter 6: CFD Study on the Roles of Trees on Airflow and Pollutant Dispersion within Urban Street Canyons. Salim Mohamed Salim, Andrew Chan, Riccardo Buccolieri, Silvana Di Sabatino Chapter 7: Energy Efficiency and Air Quality in Hospitals Design. Essam E. Khalil Chapter 8: Application of CFD in Pulverized Fuel Combustion. M. Tayyeb Javed, Tahira Sultana Chapter 9: A Heat Transfer Model For Fluids Based on Cellular Automaton Application to an Air Conditioning of A Building. Andrés Saiz Martínez Chapter 10: CFD Application in Power Plants. Essam E. Khalil Chapter 11: Analysis and Computation of the Heat Charge/Discharge Behavior in Packed Bed Thermal Storage Systems. Pei-Wen Li, Jon Van Lew, Wafaa Karaki, Cho Lik Chan, Jake Stephens

  16. Best Practice Guidelines for the use of CFD in Nuclear Reactor Safety Applications

    International Nuclear Information System (INIS)

    In May 2002, an 'Exploratory Meeting of Experts to Define an Action Plan on the Application of Computational Fluid Dynamics (CFD) Codes to Nuclear Reactor Safety Problems' was held at Aix-en-Provence, France. One of three recommended actions was the formation of this writing group to report on the need for guidelines for use of CFD in single phase Nuclear Reactor Safety (NRS) applications. CSNI approved this writing group at the end of 2002, and work began in March 2003. A final report was submitted to GAMA in September 2004, summarizing existing Best Practice Guidelines (BPG) for CFD, and recommending creation of a BPG document for Nuclear Reactor Safety (NRS) applications. The present document is intended to provide an internally complete set of guidelines for a range of single phase applications of CFD to NRS problems. However, it is not meant to be comprehensive; it is recognized that for any specific application a higher level of specificity is possible on questions of nodalization, model selection, and validation. This document should provide direct guidance on the key considerations in known single phase applications, and general directions for resolving remaining details. The intent is that it will serve as a template for further application specific (e.g. PTS, induced break) BPG documents that will provide much more detailed information and examples. The document begins with a summary of NRS related CFD analysis in countries represented by the authors. Chapter 3 deals with definition of the problem and its solution approach. This includes isolation of the portion of the NRS problem most in need of CFD, and use of a classic thermal hydraulic (TH) safety code to provide boundary conditions for the CFD based upon less detailed simulation of the balance of plant. Chapter 4 provides guidance in choosing between various options, and also discusses use of a transient calculation with tightly coupled CFD and TH codes. Chapter 5 discusses selection of physical

  17. Dicty_cDB: CFD557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD557 (Link to dictyBase) - - - Contig-U16450-1 CFD557E (Link to Original site) CFD...557F 601 CFD557Z 707 CFD557P 1308 CFD557E 1253 Show CFD557 Library CF (Link to library) Clone ID CFD...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD5-C/CFD557Q.Seq.d/ Representative seq. ID CFD...557E (Link to Original site) Representative DNA sequence >CFD557 (CFD557Q) /CSM/CF/CFD5-C/CFD...ragtvsfyl spkmtsdapadpsqdvffqnsihsspfgnctkyyentnnatctacfdlpmdispglyilq ffwefnpkgi

  18. Aero-elastic stability of airfoil flow using 2-D CFD

    Energy Technology Data Exchange (ETDEWEB)

    Johansen, J. [Risoe National Lab., Roskilde (Denmark)

    1999-03-01

    A three degrees-of-freedom structural dynamics model has been coupled to a two-dimensional incompressible CFD code. The numerical investigation considers aero-elastic stability for two different airfoils; the NACA0012 and the LM 2 18 % airfoils. Stable and unstable configurations and limit cycle oscillations are predicted in accordance with literature for the first airfoil. An attempt to predict stall induc