Atmospheric lifetimes of CFC 11 and CFC 12
International Nuclear Information System (INIS)
Owens, A.J.; Steed, J.M.; Miller, C.; Filkin, D.L.; Jesson, J.P.
1982-01-01
A two-dimensional (2-D) chemical model of the atmosphere is used to investigate the stratospheric removal rates of the chlorofluorocarbons CFC 11 (CFCl 3 ) and CFC 12 (CF 2 Cl 2 ). Assuming equivalent vertical transport rates, one-dimensional (1-D) models are shown to overestimate the atmospheric lifetime of CFC 11 by approx.10% because of their neglect of latitudinal effects. The present Du Pont 1-D and 2-D models have somewhat different effective transport rates and give steady state CFC 11 atmospheric lifetimes of 75 and 60 years, respectively, assuming no tropospheric destructive mechanism. For CFC 12, the corresponding calculated lifetimes are 140 and 120 years
Chlorofluorocarbons: CFC-11, CFC-12, CFC-113, HCFC-21, HCFC-31, HCFC-133a
DEFF Research Database (Denmark)
Bredsdorff, Lea; Nielsen, Else
The Danish EPA has requested documentation for health-based quality criteria in air and groundwater for the following six chlorofluorocarbons: CFC-11, CFC-12, HCFC-21, HCFC-31, CFC-113 (1,1,2-trichloro-1,2,2-trifluoroethane) and HCFC-133a (1-chloro-2,2,2-trifluoroethane). A concern for toxic effe...... effects of these chlorofluorocarbons related to soil contamination at old industrial sites, as well as of a carcinogenic potential has been expressed and therefore this issue will be addressed in the documentation....
National Oceanic and Atmospheric Administration, Department of Commerce — The initiation of global atmospheric monitoring programs for CFC-11, CFC-12, CFC-113 and CCl4 began in the late 1970's and early 1980's. Atmospheric concentrations...
Directory of Open Access Journals (Sweden)
R. Steinfeldt
2010-01-01
Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.
CFC legislation and its compliance with Community Law : Sweden's lack of double CFC tax relief
Kerr, Evelina
2009-01-01
CFC legislation has become an instrument to protect national tax bases and minimize the abusive effects of international tax planning. The Swedish CFC legislation is found in chapter 39a of the ITA whereas it is established under what circumstances CFC taxation can arise. If a shareholder of a foreign legal entity is liable of CFC taxation in Sweden such a holder is also entitled to deduct tax paid by the CFC abroad. The purpose of the granted tax credit is to avoid double taxation, although ...
Allin, S. J.; Laube, J. C.; Witrant, E.; Kaiser, J.; McKenna, E.; Dennis, P.; Mulvaney, R.; Capron, E.; Martinerie, P.; Roeckmann, Thomas; Blunier, T.; Schwander, J.; Fraser, P. J.; Langenfelds, R. L.; Sturges, W. T.
2015-01-01
The stratospheric degradation of chlorofluorocarbons (CFCs) releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O-3). A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, Laube et al.,
Directory of Open Access Journals (Sweden)
M. E. Davis
2016-07-01
Full Text Available The potential impact of CCl2FCF3 (CFC-114a and the recently observed CCl2FCCl2F (CFC-112, CCl3CClF2 (CFC-112a, and CCl3CF3 (CFC-113a chlorofluorocarbons (CFCs on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207–323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs, and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years of 63.6 (61.9–64.7, 51.5 (50.0–52.6, 55.4 (54.3–56.3, and 105.3 (102.9–107.4 for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs were estimated to be 4260 (CFC-112, 3330 (CFC-112a, 3650 (CFC-113a, and 6510 (CFC-114a for the 100-year time horizon.
CFC alternatives for thermal insulation foams
Energy Technology Data Exchange (ETDEWEB)
Shankland, I.R. (Allied-Signal Inc., Buffalo, NY (US))
1990-03-01
Low density polymeric foam materials expanded with chlorofluorocarbon (CFC) blowing agents have found widespread use as highly efficient thermal insulation materials in the construction, refrigeration appliance and transportation industries. The advent of regulations which are reducing the production and consumption of the fully halogenated CFCs for environmental reasons has prompted the development of environmentally acceptable substitutes for the CFC blowing agents. This paper summarizes the physical properties and performance of the leading alternatives for CFC-11, which is used to expand rigid polyurethane and polyisocyanurate foams, and the leading alternatives for CFC-12 which is used to expand extruded polystyrene board foam. Although the alternatives, HCFC-123 and HCFC-14lb for CFC-11 and HCFC142b and HCFC-124 for CFC-12, are not perfect matches from the performance viewpoint, they represent the optimum choice given the constraints on environmental acceptability, toxicity, flammability and performance. (author).
Vollmer, Martin K.; Young, Dickon; Trudinger, Cathy M.; Mühle, Jens; Henne, Stephan; Rigby, Matthew; Park, Sunyoung; Li, Shanlan; Guillevic, Myriam; Mitrevski, Blagoj; Harth, Christina M.; Miller, Benjamin R.; Reimann, Stefan; Yao, Bo; Steele, L. Paul; Wyss, Simon A.; Lunder, Chris R.; Arduini, Jgor; McCulloch, Archie; Wu, Songhao; Siek Rhee, Tae; Wang, Ray H. J.; Salameh, Peter K.; Hermansen, Ove; Hill, Matthias; Langenfelds, Ray L.; Ivy, Diane; O'Doherty, Simon; Krummel, Paul B.; Maione, Michela; Etheridge, David M.; Zhou, Lingxi; Fraser, Paul J.; Prinn, Ronald G.; Weiss, Ray F.; Simmonds, Peter G.
2018-01-01
Based on observations of the chlorofluorocarbons CFC-13 (chlorotrifluoromethane), ΣCFC-114 (combined measurement of both isomers of dichlorotetrafluoroethane), and CFC-115 (chloropentafluoroethane) in atmospheric and firn samples, we reconstruct records of their tropospheric histories spanning nearly 8 decades. These compounds were measured in polar firn air samples, in ambient air archived in canisters, and in situ at the AGAGE (Advanced Global Atmospheric Gases Experiment) network and affiliated sites. Global emissions to the atmosphere are derived from these observations using an inversion based on a 12-box atmospheric transport model. For CFC-13, we provide the first comprehensive global analysis. This compound increased monotonically from its first appearance in the atmosphere in the late 1950s to a mean global abundance of 3.18 ppt (dry-air mole fraction in parts per trillion, pmol mol-1) in 2016. Its growth rate has decreased since the mid-1980s but has remained at a surprisingly high mean level of 0.02 ppt yr-1 since 2000, resulting in a continuing growth of CFC-13 in the atmosphere. ΣCFC-114 increased from its appearance in the 1950s to a maximum of 16.6 ppt in the early 2000s and has since slightly declined to 16.3 ppt in 2016. CFC-115 increased monotonically from its first appearance in the 1960s and reached a global mean mole fraction of 8.49 ppt in 2016. Growth rates of all three compounds over the past years are significantly larger than would be expected from zero emissions. Under the assumption of unchanging lifetimes and atmospheric transport patterns, we derive global emissions from our measurements, which have remained unexpectedly high in recent years: mean yearly emissions for the last decade (2007-2016) of CFC-13 are at 0.48 ± 0.15 kt yr-1 (> 15 % of past peak emissions), of ΣCFC-114 at 1.90 ± 0.84 kt yr-1 (˜ 10 % of peak emissions), and of CFC-115 at 0.80 ± 0.50 kt yr-1 (> 5 % of peak emissions). Mean yearly emissions of CFC-115 for
Directory of Open Access Journals (Sweden)
M. K. Vollmer
2018-01-01
Full Text Available Based on observations of the chlorofluorocarbons CFC-13 (chlorotrifluoromethane, ΣCFC-114 (combined measurement of both isomers of dichlorotetrafluoroethane, and CFC-115 (chloropentafluoroethane in atmospheric and firn samples, we reconstruct records of their tropospheric histories spanning nearly 8 decades. These compounds were measured in polar firn air samples, in ambient air archived in canisters, and in situ at the AGAGE (Advanced Global Atmospheric Gases Experiment network and affiliated sites. Global emissions to the atmosphere are derived from these observations using an inversion based on a 12-box atmospheric transport model. For CFC-13, we provide the first comprehensive global analysis. This compound increased monotonically from its first appearance in the atmosphere in the late 1950s to a mean global abundance of 3.18 ppt (dry-air mole fraction in parts per trillion, pmol mol−1 in 2016. Its growth rate has decreased since the mid-1980s but has remained at a surprisingly high mean level of 0.02 ppt yr−1 since 2000, resulting in a continuing growth of CFC-13 in the atmosphere. ΣCFC-114 increased from its appearance in the 1950s to a maximum of 16.6 ppt in the early 2000s and has since slightly declined to 16.3 ppt in 2016. CFC-115 increased monotonically from its first appearance in the 1960s and reached a global mean mole fraction of 8.49 ppt in 2016. Growth rates of all three compounds over the past years are significantly larger than would be expected from zero emissions. Under the assumption of unchanging lifetimes and atmospheric transport patterns, we derive global emissions from our measurements, which have remained unexpectedly high in recent years: mean yearly emissions for the last decade (2007–2016 of CFC-13 are at 0.48 ± 0.15 kt yr−1 (> 15 % of past peak emissions, of ΣCFC-114 at 1.90 ± 0.84 kt yr−1 (∼ 10 % of peak emissions, and of CFC-115 at 0.80 ± 0.50
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFC652 (Link to dictyBase) - - - Contig-U02523-1 CFC652Z (Link... to Original site) - - CFC652Z 713 - - - - Show CFC652 Library CF (Link to library) Clone ID CFC652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02523-1 Original site URL http://dict... clone DKEY-104M9 in linkage group 19. 46 0.73 1 AC148615 |AC148615.2 Ictalurus punctatus clone CH212-99A22,...luding cell wall 4.0 %: peroxisomal >> prediction for CFC652 is mit 5' end seq. ID - 5' end seq. - Length of
CFC-beskatning og retsmisbrugsbegrebet i EU-retten
DEFF Research Database (Denmark)
Michelsen, Aage
2008-01-01
/9 2006 i Cadbury Schweppes-sagen (C-196/04 (SU 2006, 333)) om de engelske CFC-beskatningsregler, der blev anset for at være uforenelige med EF-traktatens art. 43 om fri etableringsret. Da de tidligere gældende danske CFC-regler mindede meget om de tidligere gældende engelske CFC-regler, er de danske regler...
Cell kinetics of GM-CFC in the steady state
International Nuclear Information System (INIS)
Hagan, M.P.; MacVittie, T.J.; Dodgen, D.P.
1985-01-01
The kinetics of cell turnover for myeloid/monocyte cells that form colonies in agar (GM-CFC) were measured through the progressive increase in their sensitivity to 313-nm light during a period of cell labeling with BrdCyd. Two components of cell killing with distinctly separate labeling kinetics revealed both the presence of two generations within the GM-CFC compartment and the properties of the kinetics of the precursors of the GM-CFC. These precursors of the GM-CFC were not assayable in a routine GM-CFC assay when pregnant mouse uterus extract and mouse L-cell-conditioned medium were used to stimulate colony formation but were revealed by the labeling kinetics of the assayable GM-CFC. Further, these precursor cells appeared to enter the assayable GM-CFC population from a noncycling state. This was evidenced by the failure of the majority of these cells to incorporate BrdCyd during five days of infusion. The half-time for cell turnover within this precursor compartment was measured to be approximately 5.5 days. Further, these normally noncycling cells proliferated rapidly in response to endotoxin. High-proliferative-potential colony-forming cells (HPP-CFC) were tested as a candidate for this precursor population. The results of the determination of the kinetics for these cells showed that the HPP-CFC exist largely in a Go state, existing at an average rate of once every four days. The slow turnover time for these cells and their response to endotoxin challenge are consistent with a close relationship between the HPP-CFC and the Go pool of cells that is the direct precursor of the GM-CFC
Non-destructive testing of CFC/Cu joints
International Nuclear Information System (INIS)
Casalegno, V.; Ferraris, M.; Salvo, M.; Vesprini, R.; Merola, M.
2006-01-01
Reliable non-destructive tests (NDT) are fundamental for the manufacturing of ITER components, especially for high heat flux plasma facing components. NDT include various techniques, which allow inspection of a component without impairing serviceability; it's important to detect and characterize defects (type, size and position) as well as the set-up of acceptance standards in order to predict their influence on the component performance in service conditions. The present study shows a description of NDT used to assess the manufacturing quality of CFC (carbon fibre reinforced carbon matrix composites)/Cu/CuCrZr joints. In the ITER divertor, armor tiles made of CFC are joined to the cooling structure made of precipitation hardened copper alloy CuCrZr; a soft pure Cu interlayer is required between the heat sink and the armour in order to mitigate the stresses at the joint interface. NDT on CFC/Cu joint are difficult because of the different behavior of CFC and copper with regard to physical excitations (e.g. ultrasonic wave) used to test the component; furthermore the response to this input must be accurately studied to identify the detachment of CFC tiles from Cu alloy. The inspected CFC/Cu/CuCrZr joints were obtained through direct casting of pure Cu on modified CFC surface and subsequently through brazing of CFC/Cu joints to CuCrZr by a Cu-based alloy. Different non-destructive methods were used for inspecting these joints: lock-in thermography, ultrasonic inspections, microtomography and microradiography. The NDT tests were followed by metallographic investigation on the samples, since the reliability of a certain non destructive test can be only validated by morphological evidence of the detected defects. This study will undertake a direct comparison of NDT used on CFC/Cu joints in terms of real flaws presence. The purpose of this work is to detect defects at the joining interface as well as in the cast copper ( for instance voids). The experimental work was
Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.
2016-07-01
Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) aboard the European satellite Envisat have been retrieved from versions MIPAS/4.61 to MIPAS/4.62 and MIPAS/5.02 to MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon-borne cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS-STRatospheric aircraft (MIPAS-STR), the satellite-borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS), as well as the ground-based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (full resolution, FR: July 2002-March 2004) and were used to validate MIPAS CFC-11 and CFC-12 products during that time, as well as profiles from the Improved Limb Atmospheric Spectrometer, ILAS-II. In general, we find that MIPAS shows slightly higher values for CFC-11 at the lower end of the profiles (below ˜ 15 km) and in a comparison of HATS ground-based data and MIPAS measurements at 3 km below the tropopause. Differences range from approximately 10 to 50 pptv ( ˜ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11 and is not as obvious in the relative differences between MIPAS and any of the comparison instruments. Differences at the lower end of the profile (below ˜ 15 km) and in
CFC legislation in the European Union
Directory of Open Access Journals (Sweden)
Cvjetković Cvjetana M.
2015-01-01
Full Text Available In this paper the author considers CFC legislation in the Member States of the European Union, and points to the official attitude of the institutions of the European Union toward CFC legislation. Special attention in this paper is focused on Judgment of the Court of Justice of the European Union in the case Cadbury Schweppes. The aim of the paper is to analyze CFC legislation in the Member States in order to determine its basic characteristics, as well as to determine its compatibility with freedoms guaranteed by the primary law of the European Union, i.e. with Judgment of the Court of Justice of the European Union in the Cadbury Schweppes case.
Development of decomposition method for chlorofluorocarbon (CFC) solvent by irradiation
International Nuclear Information System (INIS)
Shimokawa, Toshinari; Nakagawa, Seiko
1995-01-01
CFC is chemically and thermally stable, and almost harmless to human body, therefore, it has been used widely for various industries, in particular as the heat media for air conditioners and the washing agent for semiconductors and printed circuit substrates. In 1974, it was pointed out that CFC causes the breakdown of ozone layer, and the ozone hole was found, consequently, it was decided to limit its use, and to prohibit the production of specific CFC. The development of the decomposition treatment technology for the CFC now in use, which is friendly to the global environment including mankind and ozone layer, is strongly desired. Recently, the authors have examined the decomposition treatment method for specific CFC solvents by irradiation, and obtained the interesting knowledge. For the experiment, the CFC 113 was used, and its chemical structure is shown. The experimental method is explained. As the results, the effect of hydroxide ions, the decomposition products such as CFC 123, and the presumption of the mechanism of the chain dechlorination reaction of CFC 113 are reported. The irradiation decomposition method was compared with various other methods, and the cost of treatment is high. The development for hereafter is mentioned. (K.I.)
Directory of Open Access Journals (Sweden)
M. Zhou
2016-11-01
Full Text Available Profiles of CFC-11 (CCl3F, CFC-12 (CCl2F2 and HCFC-22 (CHF2Cl have been obtained from Fourier transform infrared (FTIR solar absorption measurements above the Saint-Denis (St Denis and Maïdo sites at Réunion Island (21° S, 55° E with low vertical resolution. FTIR profile retrievals are performed by the well-established SFIT4 program and the detail retrieval strategies along with the systematic/random uncertainties of CFC-11, CFC-12 and HCFC-22 are discussed in this study. The FTIR data of all three species are sensitive to the whole troposphere and the lowermost stratosphere, with the peak sensitivity between 5 and 10 km. The ground-based FTIR data have been compared with the collocated Michelson Interferometer for Passive Atmospheric Sounding (MIPAS/ENVISAT data and found to be in good agreement: the observed mean relative biases and standard deviations of the differences between the smoothed MIPAS and FTIR partial columns (6–30 km are (−4.3 and 4.4 %, (−2.9 and 4.6 % and (−0.7 and 4.8 % for CFC-11, CFC-12 and HCFC-22, respectively, which are within the combined error budgets from both measurements. The season cycles of CFC-11, CFC-12 and HCFC-22 from FTIR measurements and MIPAS data show a similar variation: concentration is highest in February–April and lowest in August–October. The trends derived from the combined St Denis and Maïdo FTIR time series are −0.86 ± 0.12 and 2.84 ± 0.06 % year−1 for CFC-11 and HCFC-22, respectively, for the period 2004 to 2016, and −0.76 ± 0.05 % year−1 for CFC-12 for 2009 to 2016. These measurements are consistent with the trends observed by the National Oceanic and Atmospheric Administration (NOAA Global Monitoring Division's (GMD Halocarbons & other Atmospheric Trace Species Group (HATS measurements at Samoa (14.2° S, 170.5° W for CFC-11 (−0.87 ± 0.04 % year−1, but slightly weaker for HCFC-22 (3.46 ± 0.05 % year−1 and
Lifescience Database Archive (English)
Full Text Available TTTAAAAAAAAAAAAANCAAAAAA AAAAXXXXXXXXXXTGTCGAATGTCCAGATTTCCATANATGTGTTGAAANACGTGG...--------- Length of 5' end seq. 124 3' end seq. ID CFC543Z 3' end seq. >CFC543Z.Seq ----------TGTCGAATGTCCAGATTTCCATANA...TTAAAAAAAAAAAAANCAAAAAA AAAA----------TGTCGAATGTCCAGATTTCCATANATGTGTTGAAANACGTGGT
Tropospheric observations of CFC-114 and CFC-114a with a focus on long-term trends and emissions
Directory of Open Access Journals (Sweden)
J. C. Laube
2016-12-01
Full Text Available Chlorofluorocarbons (CFCs are ozone-depleting substances as well as strong greenhouse gases, and the control of their production and use under the Montreal Protocol has had demonstrable benefits to both mitigation of increasing surface UV radiation and climate forcing. A global ban on consumption came into force in 2010, but there is evidence of continuing emissions of certain CFCs from a range of sources. One compound has received little attention in the literature, namely CFC-114 (C2Cl2F4. Of particular interest here is the differentiation between CFC-114 (CClF2CClF2 and its asymmetric isomeric form CFC-114a (CF3CCl2F as atmospheric long-term measurements in the peer-reviewed literature to date have been assumed to represent the sum of both isomers with a time-invariant isomeric speciation. Here we report the first long-term measurements of the two isomeric forms separately, and find that they have different origins and trends in the atmosphere. Air samples collected at Cape Grim (41° S, Australia, during atmospheric background conditions since 1978, combined with samples collected from deep polar snow (firn enable us to obtain a near-complete record of both gases since their initial production and release in the 1940s. Both isomers were present in the unpolluted atmosphere in comparably small amounts before 1960. The mixing ratio of CFC-114 doubled from 7.9 to 14.8 parts per trillion (ppt between the start of the Cape Grim record in 1978 and the end of our record in 2014, while over the same time CFC-114a trebled from 0.35 to 1.03 ppt. Mixing ratios of both isomers are slowly decreasing by the end of this period. This is consistent with measurements of recent aircraft-based samples showing no significant interhemispheric mixing ratio gradient. We also find that the fraction of CFC-114a mixing ratio relative to that of CFC-114 increased from 4.2 to 6.9 % over the 37-year period. This contradicts the current tacit assumption used in
Tropospheric observations of CFC-114 and CFC-114a with a focus on long-term trends and emissions
Laube, Johannes C.; Hanif, Norfazrin Mohd; Martinerie, Patricia; Gallacher, Eileen; Fraser, Paul J.; Langenfelds, Ray; Brenninkmeijer, Carl A. M.; Schwander, Jakob; Witrant, Emmanuel; Wang, Jia-Lin; Ou-Yang, Chang-Feng; Gooch, Lauren J.; Reeves, Claire E.; Sturges, William T.; Oram, David E.
2016-12-01
Chlorofluorocarbons (CFCs) are ozone-depleting substances as well as strong greenhouse gases, and the control of their production and use under the Montreal Protocol has had demonstrable benefits to both mitigation of increasing surface UV radiation and climate forcing. A global ban on consumption came into force in 2010, but there is evidence of continuing emissions of certain CFCs from a range of sources. One compound has received little attention in the literature, namely CFC-114 (C2Cl2F4). Of particular interest here is the differentiation between CFC-114 (CClF2CClF2) and its asymmetric isomeric form CFC-114a (CF3CCl2F) as atmospheric long-term measurements in the peer-reviewed literature to date have been assumed to represent the sum of both isomers with a time-invariant isomeric speciation. Here we report the first long-term measurements of the two isomeric forms separately, and find that they have different origins and trends in the atmosphere. Air samples collected at Cape Grim (41° S), Australia, during atmospheric background conditions since 1978, combined with samples collected from deep polar snow (firn) enable us to obtain a near-complete record of both gases since their initial production and release in the 1940s. Both isomers were present in the unpolluted atmosphere in comparably small amounts before 1960. The mixing ratio of CFC-114 doubled from 7.9 to 14.8 parts per trillion (ppt) between the start of the Cape Grim record in 1978 and the end of our record in 2014, while over the same time CFC-114a trebled from 0.35 to 1.03 ppt. Mixing ratios of both isomers are slowly decreasing by the end of this period. This is consistent with measurements of recent aircraft-based samples showing no significant interhemispheric mixing ratio gradient. We also find that the fraction of CFC-114a mixing ratio relative to that of CFC-114 increased from 4.2 to 6.9 % over the 37-year period. This contradicts the current tacit assumption used in international climate
Energy Technology Data Exchange (ETDEWEB)
Drehmann, Rico; Rupprecht, Christian; Wielage, Bernhard; Lampke, Thomas [Technische Univ. Chemnitz (Germany). Inst. fuer Werkstoffwissenschaft und Werkstofftechnik (IWW); Gilbert, Maria; Uhlig, Volker; Trimis, Dimosthenis [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Waermetechnik und Thermodynamik (IWTT); Heuer, Volker [ALD Vacuum Technologies GmbH, Hanau (Germany)
2013-03-15
In heat treating processes as well as in high temperature brazing processes, charge carriers enable the positioning and transport of work pieces. Recently, charge carriers consisting of graphite or carbon fibre reinforced carbon (CFC) are used. The main disadvantage of charge carriers based on CFC is the undesirable carburization of the overlying components due to diffusion processes. Under this aspect, thermally sprayed coatings are applied on CFC and tested with respect to their suitability as a high-temperature diffusion barrier. The ceramic powders aluminium oxide, aluminium oxide/chromium oxide, aluminium oxide/titanium oxide and zirconium oxide/yttrium oxide are used as a coating material which is processed by means of the powder flame spraying as well as atmospheric plasma spraying. Molybdenum and silicon carbide are used as an adhesive layer. The coating materials aluminium oxide and aluminium oxide/chromium oxide on siliconized CFC presented excellent results. This supplies a large potential of application for thermally sprayed ceramic coatings on carbon-based lightweight materials.
The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...
EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC INCINERATION
The report gives results of the collection of combustion emission characterization data from chlorofluorocarbon (CFC) incineration. A bench scale test program to provide emission characterization data from CFC incineration was developed and performed, with emphasis on the format...
HCl co-production from CFC alternatives: Threat or opportunity?
International Nuclear Information System (INIS)
Mikulka, C.J.
1990-01-01
CFC production facilities have typically been located near CFC consumers and not necessarily near their feedstock sources. The co-production of HCl from these facilities has in the past been small and manageable by the CFC producers. Production of the CFC replacements, however, will result in larger quantities of HCl co-production at a scrutiny. Since new facilities are likely to be required for the replacements, there may be the opportunity to site facilities next to chlorocarbon suppliers who may be in a better position to take back the HCl co-product for reuse in their production facilities. This paper provides an overview of these issues as well as considers the implications of returning the HCl to the chlorocarbon supplier as well as viability of converting HCl back to chlorine
Release of CFC-11 from disposal of polyurethane foam waste
DEFF Research Database (Denmark)
Kjeldsen, Peter; Jensen, M.H.
2001-01-01
The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...... will mainly depend on the continued release from PUR foams. Little is known about rates and time frames of the CFC release from foams especially after treatment and disposal of foam containing waste products. The CFC release is mainly controlled by slow diffusion out through the PUR. From the literature...... and by reevaluation of an old reported experiment, diffusion coefficients in the range of 0.05-1.7.10(-14) m(2) s(-1) were found reflecting differences in foam properties and experimental designs. Laboratory experiments studying the distribution of CFC in the foam and the short-term releases after shredding showed...
High heat flux testing of CFC composites for the tokamak physics experiment
Valentine, P. G.; Nygren, R. E.; Burns, R. W.; Rocket, P. D.; Colleraine, A. P.; Lederich, R. J.; Bradley, J. T.
1996-10-01
High heat flux (HHF) testing of carbon fiber reinforced carbon composites (CFC's) was conducted under the General Atomics program to develop plasma-facing components (PFC's) for Princeton Plasma Physics Laboratory's tokamak physics experiment (TPX). As part of the process of selecting TPX CFC materials, a series of HHF tests were conducted with the 30 kW electron beam test system (EBTS) facility at Sandia National Laboratories, and with the plasma disruption simulator I (PLADIS-I) facility at the University of New Mexico. The purpose of the tests was to make assessments of the thermal performance and erosion behavior of CFC materials. Tests were conducted with 42 different CFC materials. In general, the CFC materials withstood the rapid thermal pulse environments without fracturing, delaminating, or degrading in a non-uniform manner; significant differences in thermal performance, erosion behavior, vapor evolution, etc. were observed and preliminary findings are presented below. The CFC's exposed to the hydrogen plasma pulses in PLADIS-I exhibited greater erosion rates than the CFC materials exposed to the electron-beam pulses in EBTS. The results obtained support the continued consideration of a variety of CFC composites for TPX PFC components.
A carbon fibre composite (CFC Byelorussian peat corer
Directory of Open Access Journals (Sweden)
L.G. Franzén
2009-01-01
Full Text Available The design specification, development and manufacture of a Byelorussian (Russian peat corer constructed from carbon fibre composite (CFC are described. The availability of this new composite material introduces new possibilities for constructing field instruments that are as strong as, or stronger than, equipment made from steel and other metals. One advantage is a significant weight reduction. A 10.5 metre coring set in standard stainless and soft steel weighs around 16 kg, whereas the total weight of a similar CFC set is 5.2 kg, giving a weight reduction of almost 70%. The CFC sample chamber is 500 mm long with internal diameter 65 mm, and so contains almost twice the volume of peat that can be collected with a standard 45 mm diameter steel corer. The diameter of the rods is 30 mm, which improves ergonomics, and the CFC has better thermic properties for winter use. Another advantage is that the contamination of samples (notably by chromium and nickel associated with the use of steel corers is eliminated. The CFC sampler works well in soft peats such as Sphagnum and Carex types. It is less suitable for little-decomposed fibrous and forest peats (e.g. Polytrichum type and those containing hardwood remains, especially in the more compacted bottom layers. It should be totally satisfactory for organic lake sediments, but probably not for stiff and coarse mineral deposits.
2011-01-01
Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...
Lefty Blocks a Subset of TGFβ Signals by Antagonizing EGF-CFC Coreceptors
Cheng, Simon K; Olale, Felix; Brivanlou, Ali H
2004-01-01
Members of the EGF-CFC family play essential roles in embryonic development and have been implicated in tumorigenesis. The TGFβ signals Nodal and Vg1/GDF1, but not Activin, require EGF-CFC coreceptors to activate Activin receptors. We report that the TGFβ signaling antagonist Lefty also acts through an EGF-CFC-dependent mechanism. Lefty inhibits Nodal and Vg1 signaling, but not Activin signaling. Lefty genetically interacts with EGF-CFC proteins and competes with Nodal for binding to these coreceptors. Chimeras between Activin and Nodal or Vg1 identify a 14 amino acid region that confers independence from EGF-CFC coreceptors and resistance to Lefty. These results indicate that coreceptors are targets for both TGFβ agonists and antagonists and suggest that subtle sequence variations in TGFβ signals result in greater ligand diversity. PMID:14966532
Reglamentation of cfc rules in lithuania, junited kingdom and germany
Lukas, Mindaugas
2007-01-01
Šiame magistro darbe nagrinėjamos ir vertinamos Lietuvoje galiojančių kontroliuojamųjų užsienio vienetų pajamų apmokestinimo taisyklių, dar vadinamų CFC taisyklėmis, nuostatos. Būtinybę analizuoti ir tobulinti lietuviškąsias CFC taisykles patvirtina tiek besiformuojanti Europos Teisingumo Tesimo pozicija, vertinant šias taisykles Europos Sąjungos teisės kontekste, tiek itin skurdi CFC taisyklių taikymo praktika Lietuvoje. Pagrindinis darbo tikslas yra išanalizuoti esmines Lietuvoje taikomų CF...
Ontogeny of the granulocyte/macrophage progenitor cell (GM-CFC) pools in the beagle.
Nothdurft, W; Braasch, E; Calvo, W; Prümmer, O; Carbonell, F; Grilli, G; Fliedner, T M
1984-04-01
The pattern of development of the granulocyte/macrophage progenitor cell (GM-CFC) pools in the course of canine ontogeny was studied by means of the agar culture technique. Colony formation was stimulated by colony stimulating activity (CSA) in serum from lethally irradiated dogs in combination with erythrocyte-depleted peripheral blood leukocytes from normal adult dogs. The colonies thus obtained in cultures from the different organs were in general large (estimated maximum 50 000 cells) and consisted predominantly of mononucleated macrophages, suggesting that, in these studies, a progenitor cell with high proliferative potential (HPP-CFC) has been monitored. In the yolk sac, a transitory GM-CFC pool became established between day 23 and day 48 of gestation, reaching maximum numbers of approximately 41 X 10(3) per organ on days 36/37. At the same time the GM-CFC concentration in blood collected from the heart also reached a maximum of about 31 X 10(3)/ml, indicating its carrier function for the migration of GM-CFC. In the liver a quasi-exponential increase in the GM-CFC numbers took place between days 36/37 and days 57 to 59 when a total of about 15.2 X 10(6) was found but thereafter and up to day 4 post partum the GM-CFC numbers decreased by almost two orders of magnitude. A continuous increase in the GM-CFC numbers was found in the spleen between day 42 of gestation and day 4 post partum when a maximum of 5.1 X 10(6) to 8.7 X 10(6) was reached. In contrast to the GM-CFC numbers in the liver, the splenic GM-CFC dropped only by 50% of peak values when the dogs reached adulthood. The bone marrow always had the highest incidence of GM-CFC, the concentration per 10(6) cells being 18.7 X 10(3)/10(6) cells on days 45/46, the earliest time point at which cultures could be set up. The absolute GM-CFC numbers in the two femora increased continuously between days 45/46 and day 4 post partum in parallel with the growth of the bones. In the thymus a relatively small
Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors.
Directory of Open Access Journals (Sweden)
Simon K Cheng
2004-02-01
Full Text Available Members of the EGF-CFC family play essential roles in embryonic development and have been implicated in tumorigenesis. The TGFbeta signals Nodal and Vg1/GDF1, but not Activin, require EGF-CFC coreceptors to activate Activin receptors. We report that the TGFbeta signaling antagonist Lefty also acts through an EGF-CFC-dependent mechanism. Lefty inhibits Nodal and Vg1 signaling, but not Activin signaling. Lefty genetically interacts with EGF-CFC proteins and competes with Nodal for binding to these coreceptors. Chimeras between Activin and Nodal or Vg1 identify a 14 amino acid region that confers independence from EGF-CFC coreceptors and resistance to Lefty. These results indicate that coreceptors are targets for both TGFbeta agonists and antagonists and suggest that subtle sequence variations in TGFbeta signals result in greater ligand diversity.
Improvement of the CFC structure to withstand high heat flux
International Nuclear Information System (INIS)
Pestchanyi, S.; Landman, I.
2006-01-01
Analysis of the peculiarities of the erosion of NB31 CFC allowed proposition of a new CFC fibre structure for considerable reduction of the erosion rate. The improvement concerns the needling and vowing fibres arrangement only and keeping the same structure of the pitch fibres - the main heat conducting component of NB31. The needling and the vowing fibres of the improved structure provide the armour stiffness, comparable to that of NB31. Numerical simulation of erosion for CFC with the improved structure has confirmed that the erosion rate is four to five times lower in comparison with that of NB31
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-02-07
The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.
EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING THE INCINERATION OF RECOVERED CFC-11
The report gives results of an investigation of the formation of products of incomplete combustion (PICS) during "recovered" trichlorofluoromethane (CFC-11) incineration. Tests involved burning the recovered CFC-11 in a propane gas flame. combustion gas samples were taken and an...
Testing of improved CFC/Cu bondings for the W7-X divertor targets
International Nuclear Information System (INIS)
Greuner, H.; Buswirth, B.; Boscary, J.; Tivey, R.; Plankensteiner, A.; Schedler, B.
2007-01-01
Full text of publication follows: Extensive high heat flux (HHF) testing of pre-series divertor targets was performed to establish the industrial process for the manufacturing of 890 targets, which will be needed for the installation of the Wendelstein 7-X (W7-X) divertor. The target design consists of flat tiles of CFC NB31 as plasma facing material bonded by an Active Meta] Casting copper (AMC) interlayer onto a water-cooled CuCrZr structure. This design is required by the specific geometrical requirements of the W7-X divertor. The heat removal capability of this target concept has been demonstrated for the envisaged operational power load of 10 MW/m 2 in previous test series of more than 30 full-scale elements. No large detachment or loss of CFC tiles occurred during cyclic loading tests at 10.5 and 13 MW/m 2 , but growing local de-bonded zones at the free edges of several CFC tiles were observed. Therefore a detailed analysis of the system of CFC/Cu bonding was carried out with respect to a further reduction of the stress at the CFC/Cu interface. Based on the results of the 3/D non-linear thermomechanical FEM analysis of the CFC/Cu interface a set of 17 additional pre-series elements was manufactured by PLANSEE SE. Three types of design variations have been investigated: - adopting an additional plastically compliant Cu interlayer between the cooling structure and the AMC region, - reduced size of CFC tiles, - arrangement of tiles with 90 deg. rotation of the CFC fibre plane. HHF tests were performed in the ion beam test facility GLADIS at IPP Garching with up to 3000 cycles at 10.5 MW/m 2 on this elements. The aim of these tests is to investigate the crack propagation between CFC/Cu and to define the acceptable defect size after 100 HHF cycles as an acceptance criterion for the series manufacturing. The applied criterion should allow the selection of elements for W7-X expected to achieve a suitable operational life time. Finally, the design variant with the
Directory of Open Access Journals (Sweden)
Maryam Etminan
2014-07-01
Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.
Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.
The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart
Behaviour of Molten Beryllium with ITER Reference CFC NB31 (SNECMA) Under Moisture
International Nuclear Information System (INIS)
Lipa, M.; Martin, G.; Linke, J.
2006-01-01
A dramatic exothermic reaction with aluminium, a carbide forming metal, has been observed in Tore Supra. A small rod of 30 mm 3 , acting as a temperature proof, was enclosed in a blind hole of a thermally loaded low density PAN fiber CFC 1001Z block (SGL), which reached a temperature of about 1300 o C during plasma operation. The molten aluminium had penetrated the carbon matrix through to the block's front surface. After component removal and roughly 2 months of exposure to air in the laboratory, the CFC in front of the blind hole was found to have been locally destroyed over a crater-shaped structure of 2 cm diameter. This was due to an enhanced decomposition of aluminium carbide to aluminium hydroxide. Beryllium (Be), also a carbide forming metal, is used on the ITER first wall. Carbon reinforced carbon (CFC) of type NB31 (Snecma) covers the vertical divertor targets. It is expected that beryllium material will be transported during normal and/or off normal plasma operation to the carbon based divertor targets to form beryllium carbide. During air venting or a supposed accidental in-vessel water leak event, it will react exothermically under moisture to beryllium oxide. In order to investigate to which extent the CFC structure could be modified or eventually destroyed, this reaction process has been simulated with a CFC block NB31 of size 16 x 32 x 20 mm 3 , where about 40 mm 3 of Be S65 C (Brush Wellmann) has been placed in a previously drilled blind hole of 4 mm diameter oriented parallel to the high conductivity pitch fibers. When melted, by heating the CFC block, the Be penetrated in the carbon matrix through to the block's front surface. The front surface of the CFC was then exposed to humidity (tap water) for about 2 weeks and then stored for a further 2 months in a closed vinyl bag under atmospheric pressure after which the sample was analysed. After the exposure of the CFC to humidity, reaction products have been detected at the surface of the carbon
Mock-up test results of monoblock-type CFC divertor armor for JT-60SA
Energy Technology Data Exchange (ETDEWEB)
Higashijima, S. [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)], E-mail: higashijima.satoru@jaea.go.jp; Sakurai, S.; Suzuki, S.; Yokoyama, K.; Kashiwa, Y.; Masaki, K.; Shibama, Y.K.; Takechi, M.; Shibanuma, K.; Sakasai, A.; Matsukawa, M.; Kikuchi, M. [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)
2009-06-15
The JT-60 Super Advanced (JT-60SA) tokamak project starts under both the Japanese domestic program and the international program 'Broader Approach'. The maximum heat flux to JT-60SA divertor is estimated to {approx}15 MW/m{sup 2} for 100 s. Japan Atomic Energy Agency (JAEA) has developed a divertor armor facing high heat flux in the engineering R and D for ITER, and it is concluded that monoblock-type CFC divertor armor is promising for JT-60SA. The JT-60SA armor consists of CFC monoblocks, a cooling CuCrZr screw-tube, and a thin oxygen-free high conductivity copper (OFHC-Cu) buffer layer between the CFC monoblock and the screw-tube. CFC/OFHC-Cu and OFHC-Cu/CuCrZr joints are essential for the armor, and these interfaces are brazed. Needed improvements from ITER engineering R and D are good CFC/OFHC-Cu and OFHC-Cu/CuCrZr interfaces and suppression of CFC cracking. For these purposes, metalization inside CFC monoblock is applied, and we confirmed again that the mock-up has heat removal capability in excess of ITER requirement. For optimization of the fabrication method and understanding of the production yield, the mock-ups corresponding to quantity produced in one furnace at the same time is also produced, and the half of the mock-ups could remove 15 MW/m{sup 2} as required. This paper summarizes the recent progress of design and mock-up test results for JT-60SA divertor armor.
Handling of CFC's - on-site recycling versus off-site reclamation
International Nuclear Information System (INIS)
Gras, S.
1993-01-01
Most contractors will be doing both programs to one degree or another. There will be times when the refrigerant is brand new, when a very minor problem requires servicing and the CFCs will be put right back in with no concerns about quality. There will be other times that it makes more sense to have the gas reclaimed because of burn-out. Where equipment reliability is a prerequisite and the quality of the gas is imperative, the CFC management process should be through a reclamation center. Contractors can do this themselves or deal with a low cost/no cost CFC service that will do it for them. Both options have their merits and on every recovery occasion the contractor will have to make a judgement call. They are, after all, the ones that will carry all the associated risks and responsibilities. Let's hope they make the right decisions, and within the context of good CFC management
Dispensation fra CFC-reglerne for selskaber
DEFF Research Database (Denmark)
Schmidt, Peter Koerver
2011-01-01
Artiklen, der er fagfællebedømt, omhandler dispensationsbestemmelsen i SEL § 32, stk. 2, 2-4 pkt, hvorefter Skatterådet kan tillade, at indkomsten i et datterselskab med koncession til at udøve forskellig økonomisk virksomhed ikke skal være omfattet af reglerne om CFC-beskatning. I den forbindels...
Reactivity of solvent alcohol on degradation of CFC113
International Nuclear Information System (INIS)
Nakagawa, Seiko
2003-01-01
1,1,2-Trichloro-trifluoroethane (CFC113) was dissolved in alkaline 1-butanol, 2-butanol, iso-butyl alcohol, and phenyl ethyl alcohol and irradiated with 60 Co gamma rays after purged with pure nitrogen gas. In all these solvents, the concentration of CFC113 and hydroxide ion decreased and that of chloride ion increased with a dose observed in 2-propanol solution. The reaction efficiency increases in order of 1-butanol< iso-butyl alcohol< phenyl ethyl alcohol<2-butanol<2-propanol. The solvent effect will depend on the binding energy of the αC-H of the alcohol molecule and electron affinity and dipole moment of the ketones or aldehydes produced from the alcohols
EGF-CFC proteins are essential coreceptors for the TGF-β signals Vg1 and GDF1
Cheng, Simon K.; Olale, Felix; Bennett, James T.; Brivanlou, Ali H.; Schier, Alexander F.
2003-01-01
The TGF-β signals Nodal, Activin, GDF1, and Vg1 have been implicated in mesoderm induction and left-right patterning. Nodal and Activin both activate Activin receptors, but only Nodal requires EGF-CFC coreceptors for signaling. We report that Vg1 and GDF1 signaling in zebrafish also depends on EGF-CFC proteins, but not on Nodal signals. Correspondingly, we find that in Xenopus Vg1 and GDF1 bind to and signal through Activin receptors only in the presence of EGF-CFC proteins. These results establish that multiple TGF-β signals converge on Activin receptor/EGF-CFC complexes and suggest a more widespread requirement for coreceptors in TGF-β signaling than anticipated previously. PMID:12514096
The paper discusses simulation of the performance of chlorine-free fluorinated ethers and fluorinated hydrocarbons as potential long-term replacements for CFC-11 and -114. Modeling has been done with in-house refrigeration models based on the Carnahan-Starling-DeSantis Equation o...
Energy Technology Data Exchange (ETDEWEB)
Tsuru, Daigo, E-mail: tsuru.daigo@jaea.go.jp; Sakurai, Shinji; Nakamura, Shigetoshi; Ozaki, Hidetsugu; Seki, Yohji; Yokoyama, Kenji; Suzuki, Satoshi
2015-10-15
Highlights: • We carried out numerical simulations on residual thermal stress of targets for the JT-60SA divertor. • We developed three measures to reduce residual thermal stress. • We proposed two structures of CFC monoblock target for the JT-60SA divertor. • We confirmed the effectiveness of the structure by infrared thermography inspection and high heat flux test. - Abstract: Carbon fibre-reinforced carbon composite (CFC) monoblock target for JT-60SA divertor is under development towards the mass-production. CFC monoblocks, WCu interlayers and a CuCrZr cooling tube at the centre of the monoblocks were bonded by vacuum brazing in a high temperature, to a target. If residual thermal stress due to difference of thermal expansions between CFC and CuCrZr exceeds the maximum allowable stress of the CFC after the bonding, cracks are generated in the CFC monoblock and heat removal capacity of the target degrades. In this paper, new structures of the targets were proposed, to reduce residual thermal stress and to mitigate the degradation of heat removal capacity of the targets. Some measures, including slitting of the CFC monoblock aside of the cooling tube, replacement of the interlayer material and shifting the position of the cooling tube, were implemented. The effectiveness of the measures was evaluated by numerical simulations. Target mock-ups with the proposed structures were manufactured. Infrared thermography inspection and high heat flux test were carried out on the mock-ups in order to evaluate the heat removal capacity.
Distribution and ventilation of water masses in the western Ross Sea inferred from CFC measurements
Rivaro, Paola; Ianni, Carmela; Magi, Emanuele; Massolo, Serena; Budillon, Giorgio; Smethie, William M.
2015-03-01
During the CLIMA Project (R.V. Italica cruise PNRA XVI, January-February 2001), hydrographic and chlorofluorocarbons (CFCs) observations were obtained, particularly in the western Ross Sea. Their distribution demonstrated water mass structure and ventilation processes in the investigated areas. In the surface waters (AASW) the CFC saturation levels varied spatially: CFCs were undersaturated in all the areas (range from 80 to 90%), with the exception of few stations sampled near Ross Island. In particular, the Terra Nova Bay polynya, where high salinity shelf water (HSSW) is produced, was a low-saturated surface area (74%) with respect to CFCs. Throughout most of the shelf area, the presence of modified circumpolar deep water (MCDW) was reflected in a mid-depth CFC concentration minima. Beneath the MCDW, CFC concentrations generally increased in the shelf waters towards the seafloor. We estimated that the corresponding CFCs saturation level in the source water region for HSSW was about 68-70%. Waters with high CFC concentrations were detected in the western Ross Sea on the down slope side of the Drygalski Trough, indicating that AABW was being supplied to the deep Antarctic Basin. Estimates of ventilation ages depend strongly on the saturation levels. We calculated ventilation ages using the saturation level calibrated tracer ratio, CFC11/CFC12. We deduced a mean residence time of the shelf waters of about 6-7 years between the western Ross Sea source and the shelf break.
High RF power test of a CFC antenna module for lower hybrid current drive
International Nuclear Information System (INIS)
Maebara, S.; Seki, M.; Ikeda, Y.; Kiyono, K.; Suganuma, K.; Imai, T.; Goniche, M.; Bibet, Ph.; Brossaud, J.; Cano, V.; Kazarian-Vibert, F.; Froissard, P.; Rey, G.
1998-01-01
A mock-up of a 3.7 GHz Lower Hybrid Current Drive (LHCD) antenna module was fabricated from Carbon Fibre Composite (CFC) for the development of heat resistive low Z front facing the plasma. This 2 divided waveguide module is made from CFC plates and rods which are Cu-plated to reduce the RF losses. The withstand-voltage, the RF properties and the outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. A reference module made from Dispersion Strengthened Copper (DSC) was also fabricated. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m 2 were performed with no breakdowns on the CFC module. It was also checked that the highest power density, up to 150 MW/m 2 , could be transmitted when the waveguides are filled with H2 at a pressure of 5 x 10 -2 Pa. During a long pulse, the power reflection coefficient remains low in the 0.8-1.3 % range and no significant change in the reflection coefficient is measured after the thermal cycling provided by the long pulse operation. From thermocouple measurements, RF losses of the copper coated CFC and the DSC modules were compared. No significant differences were measured. From pressure measurements, it was found that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of DSC at 300 deg.C. It is concluded that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)
International research into chlorofluorocarbon (CFC) alternatives
Energy Technology Data Exchange (ETDEWEB)
Marseille, T.J.; Shankle, D.L.; Thurman, A.G.
1992-05-01
Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.
CFC/Cu bond damage in actively cooled plasma facing components
International Nuclear Information System (INIS)
Schlosser, J; Martin, E; Henninger, C; Boscary, J; Camus, G; Escourbiac, F; Leguillon, D; Missirlian, M; Mitteau, R
2007-01-01
Carbon fibre composite (CFC) armours have been successfully used for actively cooled plasma facing components (PFCs) of the Tore Supra (TS) tokamak. They were also selected for the divertor of the stellarator W7-X under construction and for the vertical target of the ITER divertor. In TS and W7-X a flat tile design for heat fluxes of 10 MW m -2 has been chosen. To predict the lifetime of such PFCs, it is necessary to analyse the damage mechanisms and to model the damage propagation when the component is exposed to thermal cycling loads. Work has been performed to identify a constitutive law for the CFC and parameters to model crack propagation from the edge singularity. The aim is to predict damage rates and to propose geometric or material improvements to increase the strength and the lifetime of the interfacial bond. For ITER a tube-in-tile concept (monoblock), designed to sustain heat fluxes up to 20 MW m -2 , has been developed. The optimization of the CFC/Cu bond, proposed for flat tiles, could be adopted for the monoblock concept
CFC rules in the context of the proposed CCCTB directive
Directory of Open Access Journals (Sweden)
Veronika Sobotková
2011-01-01
Full Text Available In the proposal for a Council Directive on a Common Consolidated Corporate Tax Base (CCCTB there have been introduced a specific anti-abuse provisions, CFC rules. These rules are aimed at tax evasions and tax avoidance. The basic principle is the protection of the tax base against erosion through practices of artificial income shifting. Generally, CFC rules prevent tax avoidance in a state of a shareholder by denying the deferred taxation of profits generated by its controlled company, which is a resident in a tax preference jurisdiction. Even thought the CCCTB directive would be aided easier and low-costs cross-border business as well as it would be restricted the harmful tax competition there are questions whether it is advisable to introduce these rules into such system of the CCCTB, whether these rules are compatible with the CCCTB and whether it is regulated properly. So, the focus of this paper rests on the interaction of the proposed CCCTB directive with existing CFC rules in the European Union. The paper deals with pros and cons, economic and legal perspectives these rules in the context of the proposed CCCTB directive.
Testing of CFC replacement fluids for arc-induced toxic by-products
Energy Technology Data Exchange (ETDEWEB)
Cravey, W.R.; Goerz, D.A.; Hawley-Fedder, R.A.
1993-06-01
The authors have developed a unique test-stand for quantifying the generation of perfluoroisobutylene (PFIB) in chlorofluorocarbon (CFC) replacement fluids when they are subjected to high electrical stress/breakdown environments. PFIB is an extremely toxic gas with a threshold limit value of 10 ppbv as set by the American Conference of Governmental Industrial Hygienists. They have tested several new fluids from various manufacturers for their potential to generate PFIB. Their goal is to determine breakdown characteristics and quantify toxic by-products of these replacement fluids to determine a safe, usable alternative for present CFC`s.
Apparent CFC and 3H/ 3He age differences in water from Floridan Aquifer springs
Happell, James D.; Opsahl, Stephen; Top, Zafer; Chanton, Jeffrey P.
2006-03-01
The apparent CFC-11, -12 and -113 ages of Upper Floridan Aquifer water discharged from 31 springs located in Florida and Georgia ranged from 11 to 44 years when samples were collected in 2002 and 2003. Apparent 3H/ 3He ages in these springs ranged from 12 to 66 years. Some of the springs sampled did not yield valid CFC ages because one or more of the CFCs were contaminated by non-atmospheric sources. Of the 31 springs sampled, six were contaminated with all three CFCs and nine were contaminated with one or two CFCs. Of the remaining 16 springs, the CFC distributions of four could be modeled assuming a single source of water, and 11 were best modeled by assuming two sources of water, with one of the water sources >60 years old. The CFC and 3H/ 3He apparent ages and the simple mixing models applied to these ages suggest that past impacts to the water quality of water recharging the sampled springs may take anywhere from 0 to ˜60 years or more to appear in the discharging spring water. In 27 springs where both 3H/ 3He ages and CFC ages were available, five springs gave similar results between the two techniques, while in the other 22 cases the 3H/ 3He apparent ages were 8-40 years greater than the CFC ages. Large excesses of 4He were observed in many of the springs, consistent with a source of older water. This older water may also carry an additional and unaccounted for source of 3He, which may be responsible for the greater 3H/ 3He ages relative to the CFC ages. We believe that the large excess 3He and 4He values and apparent age differences are related to regional climate variations because our samples were obtained at the end of a 4-year drought.
Numerical simulation of CFC and tungsten target erosion in ITER-FEAT divertor
International Nuclear Information System (INIS)
Filatov, V.
2003-01-01
Physical, chemical and thermal surface erosion for water-cooled target armoured by CFC and tungsten is simulated by numerical code ERosion OF Immolated Layer (EROFIL-1). Some calculation results on the CFC and tungsten vertical target (VT) erosion in the ITER-FEAT divertor are presented for various operation modes (normal operations, slow transients, ELMs and disruptions). The main erosion mechanisms of CFC armour are the chemical and sublimation ones. Maximum erosion depth per 3000 cycles during normal operations and slow transients is of 2.7 mm at H phase and of 13.5 mm at DT phase. An evaluation of VT tungsten armour erosion per 3000 cycles of H and DT operations shows that no physical or chemical erosion as well as no melting are expected for tungsten armour at normal operations and slow transients. The tungsten armour melting at 2x10 6 ELMs is not allowable. The 300 disruptions are not dangerous in view of evaporation
Adcock, Karina E.; Reeves, Claire E.; Gooch, Lauren J.; Leedham Elvidge, Emma C.; Ashfold, Matthew J.; Brenninkmeijer, Carl A. M.; Chou, Charles; Fraser, Paul J.; Langenfelds, Ray L.; Hanif, Norfazrin Mohd; O'Doherty, Simon; Oram, David E.; Ou-Yang, Chang-Feng; Moi Phang, Siew; Abu Samah, Azizan; Röckmann, Thomas; Sturges, William T.; Laube, Johannes C.
2018-04-01
Atmospheric measurements of the ozone-depleting substance CFC-113a (CCl3CF3) are reported from ground-based stations in Australia, Taiwan, Malaysia and the United Kingdom, together with aircraft-based data for the upper troposphere and lower stratosphere. Building on previous work, we find that, since the gas first appeared in the atmosphere in the 1960s, global CFC-113a mixing ratios have been increasing monotonically to the present day. Mixing ratios of CFC-113a have increased by 40 % from 0.50 to 0.70 ppt in the Southern Hemisphere between the end of the previously published record in December 2012 and February 2017. We derive updated global emissions of 1.7 Gg yr-1 on average between 2012 and 2016 using a two-dimensional model. We compare the long-term trends and emissions of CFC-113a to those of its structural isomer, CFC-113 (CClF2CCl2F), which still has much higher mixing ratios than CFC-113a, despite its mixing ratios and emissions decreasing since the 1990s. The continued presence of northern hemispheric emissions of CFC-113a is confirmed by our measurements of a persistent interhemispheric gradient in its mixing ratios, with higher mixing ratios in the Northern Hemisphere. The sources of CFC-113a are still unclear, but we present evidence that indicates large emissions in East Asia, most likely due to its use as a chemical involved in the production of hydrofluorocarbons. Our aircraft data confirm the interhemispheric gradient as well as showing mixing ratios consistent with ground-based observations and the relatively long atmospheric lifetime of CFC-113a. CFC-113a is the only known CFC for which abundances are still increasing substantially in the atmosphere.
Tungsten coatings electro-deposited on CFC substrates from oxide molten salt
Energy Technology Data Exchange (ETDEWEB)
Sun, Ningbo; Zhang, Yingchun, E-mail: zycustb@163.com; Lang, Shaoting; Jiang, Fan; Wang, Lili
2014-12-15
Tungsten is considered as plasma facing material in fusion devices because of its high melting point, its good thermal conductivity, its low erosion rate and its benign neutron activation properties. On the other hand, carbon based materials like C/C fiber composites (CFC) have been used for plasma facing materials (PFMs) due to their high thermal shock resistance, light weight and high strength. Tungsten coatings on CFC substrates are used in the JET divertor in the frame of the JET ITER-like wall project, and have been prepared by plasma spray (PS) and other techniques. In this study, tungsten coatings were electro-deposited on CFC from Na{sub 2}WO{sub 4}–WO{sub 3} molten salt under various deposition parameters at 900 °C in air. In order to obtain tungsten coatings with excellent performance, the effects of pulse duration ratio and pulse current density on microstructures and crystal structures of tungsten coatings were investigated by X-ray diffraction (XRD, Rigaku Industrial Co., Ltd., D/MAX-RB) and a scanning electron microscope (SEM, JSM 6480LV). It is found that the pulsed duration ratio and pulse current density had a significant influence on tungsten nucleation and electro-crystallization phenomena. SEM observation revealed that intact, uniform and dense tungsten coatings formed on the CFC substrates. Both the average grain size and thickness of the coating increased with the pulsed current density. The XRD results showed that the coatings consisted of a single phase of tungsten with the body centered cubic (BCC) structure. The oxygen content of electro-deposited tungsten coatings was lower than 0.05%, and the micro-hardness was about 400 HV.
Behaviour of molten beryllium with ITER reference CFC SEPCARB NB31 under moisture
Energy Technology Data Exchange (ETDEWEB)
Lipa, M. [CEA/Cadarache-DSM/DRFC, Euratom-Association, Saint Paul Lez Durance F-13108 (France)], E-mail: manfred.lipa@cea.fr; Linke, J. [Forschungszentrum Juelich, Euratom-Association, Juelich D-52425 (Germany); Martin, G. [CEA/Cadarache-DSM/DRFC, Euratom-Association, Saint Paul Lez Durance F-13108 (France); Wessel, E. [Forschungszentrum Juelich, Euratom-Association, Juelich D-52425 (Germany)
2007-10-15
A dramatic exothermic reaction has been observed in Tore Supra with molten aluminium enclosed in a thermally loaded 2D carbon fibre reinforced carbon composite (CFC) tile, exposed after component removal to atmospheric moisture. This led to an important local destruction of the graphite matrix and fibre texture. Beryllium, as aluminium, a carbide forming metal, is foreseen for the ITER first wall armour. Since it can be expected that sputtered, molten and/or evaporated beryllium material will be transported to the hot CFC based divertor surface during normal and off-normal plasma operation, a preliminary reaction experiment has been performed in order to investigate to which extent the Be contaminated graphite matrix and fibre texture of 3D-CFC SEPCARB NB31 could be locally damaged ('erosion') following a subsequent long lasting air venting or a supposed in-vessel ingress of coolant (steam) event (ICE)
EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC-12 INCINERATION
The report gives results of experiments to determine the effect of flame zone temperature on gas-phase flame formation and destruction of products of incomplete combustion (PICS) during dichlorodi-fluoromethane (CFC-12) incineration. The effect of water injection into the flame ...
Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components
Energy Technology Data Exchange (ETDEWEB)
Chevet, G., E-mail: gaelle.chevet@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Martin, E., E-mail: martin@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Boscary, J., E-mail: jean.boscary@ipp.mpg.de [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Camus, G., E-mail: camus@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Herb, V., E-mail: herb@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Schlosser, J., E-mail: jacques.schlosser@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Escourbiac, F., E-mail: frederic.escourbiac@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Missirlian, M., E-mail: marc.missirlian@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France)
2011-10-01
The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.
Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components
International Nuclear Information System (INIS)
Chevet, G.; Martin, E.; Boscary, J.; Camus, G.; Herb, V.; Schlosser, J.; Escourbiac, F.; Missirlian, M.
2011-01-01
The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.
Global warming impacts of CFC alternative technologies: Combining fluorocarbon and CO2 effects
International Nuclear Information System (INIS)
Fairchild, P.D.; Fischer, S.K.; Hughes, P.J.
1992-01-01
Chlorofluorocarbons (CFCs) are on their way out, due to their role in stratospheric ozone depletion and the related international Montreal Protocol agreement and various national phaseout timetables. As the research, engineering development, and manufacturing investment decisions have ensued to prepare for this transition away from CFCs, the climate change issue has emerged and there has recently been increased attention on the direct global warming potential (GWP) of the fluorocarbon alternatives as greenhouse gases. However, there has been less focus on the indirect global warming effect arising from end-use energy changes and associated CO 2 emissions. A study was undertaken to address these combined global warming effects. A concept of Total Equivalent Warming Impact (TEWI) was developed for combining the direct and indirect effects and was used for evaluating CFC-replacement options available in the required CFC transition time frame. Analyses of industry technology surveys indicate that CFC-user industries have made substantial progress toward near-equal energy efficiency with many HCFC/HFC alternatives. The findings also bring into question the relative importance of the direct effect in many applications and stress energy efficiency when searching for suitable CFC alternatives. For chillers, household refrigerators, and unitary air-conditioning or heat pump equipment, changes in efficiency of only 2--5% would have a greater effect on future TEWI than completely eliminating the direct effect
International Nuclear Information System (INIS)
Hassan, N
2014-01-01
Tree species composition estimations are important to sustain forest management. This study estimates relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of tree species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying tree species composition
Manufacturing study of Be, W and CFC bonded structures for plasma-facing components
Onozuka, M.; Hirai, S.; Kikuchi, K.; Oda, Y.; Shimizu, K.
2004-08-01
A manufacturing study has been conducted for Be, W, and CFC bonded structures employed in plasma-facing components for the ITER. For Be tiles bonded to the Cu-Cr-Zr alloy heat sink with stainless-steel cooling pipes, a one-axis hot press with two heating processes has been used to bond the three materials. An Al-Si base interlayer has been used to bond Be to the Cu-alloy. The heating processes have been selected to match the required heat treatment conditions for the Cu-alloy. Because of the limited heat processes using a conventional hot press, the manufacturing cost can be minimized. For both the W and CFC tiles, the materials have been brazed at the same time to the Cu-alloy. Ni-Cu-Mn and Cu-Ti brazing materials have been used for the W and CFC tiles, respectively. Using the above bonding techniques, partial mockups of a blanket first-wall panel and divertor target have been successfully manufactured.
Manufacturing study of Be, W and CFC bonded structures for plasma-facing components
International Nuclear Information System (INIS)
Onozuka, M.; Hirai, S.; Kikuchi, K.; Oda, Y.; Shimizu, K.
2004-01-01
A manufacturing study has been conducted for Be, W, and CFC bonded structures employed in plasma-facing components for the ITER. For Be tiles bonded to the Cu-Cr-Zr alloy heat sink with stainless-steel cooling pipes, a one-axis hot press with two heating processes has been used to bond the three materials. An Al-Si base interlayer has been used to bond Be to the Cu-alloy. The heating processes have been selected to match the required heat treatment conditions for the Cu-alloy. Because of the limited heat processes using a conventional hot press, the manufacturing cost can be minimized. For both the W and CFC tiles, the materials have been brazed at the same time to the Cu-alloy. Ni-Cu-Mn and Cu-Ti brazing materials have been used for the W and CFC tiles, respectively. Using the above bonding techniques, partial mockups of a blanket first-wall panel and divertor target have been successfully manufactured
Atmospheric Science and the CFC Industry
Steed, J. M.
2012-12-01
Industry involvement with developing atmospheric science and subsequent regulations to protect ozone was unusual. Chlorofluorocarbon manufacturers were research-based businesses accustomed to understanding the science behind product-related issues. When Lovelock's measurements in 1971 implied most of the cumulative production of CFCs remained in the atmosphere, global CFC producers funded academic research to identify natural sinks for the materials. The Fluorocarbon Program Panel (FPP) began in 1972, but changed focus to atmospheric photochemistry following Rowland and Molina's work in 1974. Despite early vociferous opposition, especially by the CFC-using aerosol industry, to any regulations, leaders among the producers worked to build their scientific understanding, expanding FPP funding and launching internal work in modeling and ozone trend analysis. The key first question for industry was not how much depletion might occur, but whether it would occur at all. If so, regardless of the amount, regulations and a major transition would be required in CFC-using industries, and the response would need to be global and prompt. So long as that basic question was in doubt, some businesses and countries would resist the economic cost of action. In the meantime, the producing industry worked to identify potential alternatives and to communicate atmospheric science to the downstream industries. Although the industry science effort was often disparaged as an attack on "real" science, my only assignment when I joined DuPont's Central Research Department in 1979 was to understand and contribute to the science, keeping both the company and our customers informed. Our modeling results were published freely. FPP funding led to better knowledge of the ClO + O rate constant, significantly increasing depletion in model calculations; supported the development of the techniques used to measure in situ atmospheric ClO, so important in later strengthening the case for chlorine
International Nuclear Information System (INIS)
Hassan, N
2014-01-01
Tree species composition estimations are important to sustain forest management. This study challenged estimates of relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of trees species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying trees species composition
International Nuclear Information System (INIS)
Escourbiac, F.; Constans, S.; Courtois, X.; Durocher, A.
2007-01-01
A non destructive testing technique - so called modulated photothermal thermography or lock-in thermography - has been set-up for plasma facing components examination. Reliable measurements of phase contrast were obtained on 8 mm carbon fiber composite (CFC) armoured W7-X divertor component with calibrated flaws. A 3D finite element analysis allowed the correlation of the measured phase contrast and showed that a 4 mm strip flaw can be detected at the CFC/copper interface
Energy Technology Data Exchange (ETDEWEB)
Kikuchi, Y., E-mail: ykikuchi@eng.u-hyogo.ac.jp [Graduate School of Engineering, University of Hyogo, 2167 Shosha, Himeji, 671-2280 Hyogo (Japan); Nishijima, D. [Center for Energy Research, University of California at San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0417 (United States); Nakatsuka, M.; Ando, K.; Higashi, T.; Ueno, Y.; Ishihara, M.; Shoda, K.; Nagata, M. [Graduate School of Engineering, University of Hyogo, 2167 Shosha, Himeji, 671-2280 Hyogo (Japan); Kawai, T.; Ueda, Y. [Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita, Osaka 565-0871 (Japan); Fukumoto, N. [Graduate School of Engineering, University of Hyogo, 2167 Shosha, Himeji, 671-2280 Hyogo (Japan); Doerner, R.P. [Center for Energy Research, University of California at San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0417 (United States)
2011-08-01
Surface damage of carbon fiber composite (CFC) and tungsten (W) due to repetitive ELM-like pulsed plasma irradiation has been investigated by using a magnetized coaxial plasma gun. CX2002U CFC and stress-relieved W samples were exposed to repetitive pulsed deuterium plasmas with duration of {approx}0.5 ms, incident ion energy of {approx}30 eV, and surface absorbed energy density of {approx}0.3-0.7 MJ/m{sup 2}. Bright spots on a CFC surface during pulsed plasma exposures were clearly observed with a high-speed camera, indicating a local surface heating. No melting of a W surface was observed under a single plasma pulse exposure at energy density of {approx}0.7 MJ/m{sup 2}, although cracks were formed. Cracking of the W surface grew with repetitive pulsed plasma exposures. Subsequently, the surface melted due to localized heat absorption.
Exposures of EU W-CFC combined targets with QSPA Kh-50 plasma streams simulating ITER ELM
International Nuclear Information System (INIS)
Makhlaj, V.A.; Garkusha, I.E.; Tereshin, V.I.; Bandura, A.N.; Chebotarev, V.V.; Staltsov, V.V.; Linke, J.; Pintsuk, G.
2009-01-01
Repeated load tests of special combined W-CFC samples were performed with QSPA plasma streams either resulting in strong melting of W surface layer or below the melting, but above the cracking threshold. Experiments show that in result of target exposures with heat load of 0.4 MJ/m 2 (no melting) only cracks formation was found on both tungsten and CFC surfaces. It is obtained that enhanced evaporation of CFC results in additional shielding of tungsten surface by C cloud and protects W surface from evaporation even for essentially increased energy density in impacting plasma. Exposures of combined target with heat loads of 0.82 MJ/m 2 resulted in strong melting of tungsten. Meshes of macro-cracks and micro-cracks as well as ripple structures are appeared on the resolidified surface
Research on interactions of plasma streams with CFC targets in the Rod Plasma Injector facility
Directory of Open Access Journals (Sweden)
Zaloga Dobromil R.
2016-06-01
Full Text Available This paper present results of optical spectroscopy studies of interactions of intense plasma streams with a solid target made of carbon fibre composite (CFC. The experiments were carried out within the Rod Plasma Injector (RPI IBIS facility. The optical measurements were performed first for a freely propagating plasma stream in order to determine the optimal operational parameters of this facility. Optical emission spectra (OES were recorded for different operational modes of the RPI IBIS device, and spectral lines were identified originating from the working gas (deuterium as well as some lines from the electrode material (molybdenum. Subsequently, optical measurements of plasma interacting with the CFC target were performed. In the optical spectra recorded with the irradiated CFC samples, in addition to deuterium and molybdenum lines, many carbon lines, which enabled to estimate erosion of the investigated targets, were recorded. In order to study changes in the irradiated CFC samples, their surfaces were analysed (before and after several plasma discharges by means of scanning electron microscope (SEM and energy dispersive spectroscopy (EDS techniques. The analysis of the obtained SEM images showed that the plasma irradiation induces noticeable changes in the surface morphology, for example vaporisation of some carbon fibres and formation of microcracks. The obtained EDS images showed that upon the irradiated target surface, some impurity ions are also deposited, particularly molybdenum ions from the applied electrodes.
International Nuclear Information System (INIS)
Begrambekov, L.; Brosset, C.; Bucalossi, J.; Delchambre, E.; Gunn, J.P.; Grisolia, C.; Lipa, M.; Loarer, T.; Mitteau, R.; Moner-Garbet, P.; Pascal, J.-Y.; Shigin, P.; Titov, N.; Tsitrone, E.; Vergazov, S.; Zakharov, A.
2007-01-01
The uniform layer with thickness at least 50-100 μm was found on the CFC tiles from the inboard midplane after more than four years of tokamak operation. The upper part of the uniform layer was amorphous, but at the depth of ∼5 μm a structure consisting of micro-size regions with aromatic chains located parallel to the surface was found. Gradual transition from uniform layer to underlying CFC structure was observed. The reciprocating material probe was used for installation of CFC samples in the Tore Supra deuterium plasma. The thermal desorptional spectra of these samples are compared with the spectra of the samples irradiated in the laboratory stand and with the spectra of hydrogenated carbon film. The peculiarities of hydrogen isotope trapping under plasma irradiation and at the atmosphere are presented and discussed
A program to evaluate the erosion on the CFC tiles of the ITER divertor
Energy Technology Data Exchange (ETDEWEB)
D' Agata, E. [ITER International Team, ITER Joint Work Site, Boltzmannstr 2, 85748 Garching (Germany)], E-mail: elio.dagata@iter.org; Ogorodnikova, O.V. [Association Euratom-CEA, CEA/DSM/DRFC, CEA/Cadarache, F-13108 Saint-Paul-Lez-Durance (France); Tivey, R. [ITER International Team, ITER Joint Work Site, Boltzmannstr 2, 85748 Garching (Germany); Lowry, C.; Schlosser, J. [Association Euratom-CEA, CEA/DSM/DRFC, CEA/Cadarache, F-13108 Saint-Paul-Lez-Durance (France)
2007-10-15
The plasma-facing surfaces of the ITER divertor are armoured with tungsten in the upper part of the inner and outer vertical targets, and carbon fibre composite (CFC) in the lower part, the region where the scrape-off layer intercepts the divertor. The CFC in the form of a monoblock in the vertical target is the most loaded part of the plasma-facing surfaces, and hence it is subjected to high erosion and has a significant risk of failure. A program has been developed with the aim of understanding the impact on the erosion lifetime due to a combination of two main effects: the material property variations (particularly pronounced in CFC) and the presence of joining defects. The software allows the evolution of the surface profile of the armour to be predicted and the margin on critical heat flux at the heat-sink-to-coolant interface to be estimated for a range of postulated defects, from start-of-life through to end-of-life of the component. In assessing erosion, the code takes account of geometry and sublimation, and physical and chemical erosion of the CFC armour. The incident angle (a glancing angle of a few degrees) of the particle and heat flux onto the target is taken into account. The program has been validated by comparison with analytical approximations very well validated against experimental data. The code has been developed in the APDL language to operate inside a commercial and certificated finite element program such as ANSYS.
A program to evaluate the erosion on the CFC tiles of the ITER divertor
International Nuclear Information System (INIS)
D'Agata, E.; Ogorodnikova, O.V.; Tivey, R.; Lowry, C.; Schlosser, J.
2007-01-01
The plasma-facing surfaces of the ITER divertor are armoured with tungsten in the upper part of the inner and outer vertical targets, and carbon fibre composite (CFC) in the lower part, the region where the scrape-off layer intercepts the divertor. The CFC in the form of a monoblock in the vertical target is the most loaded part of the plasma-facing surfaces, and hence it is subjected to high erosion and has a significant risk of failure. A program has been developed with the aim of understanding the impact on the erosion lifetime due to a combination of two main effects: the material property variations (particularly pronounced in CFC) and the presence of joining defects. The software allows the evolution of the surface profile of the armour to be predicted and the margin on critical heat flux at the heat-sink-to-coolant interface to be estimated for a range of postulated defects, from start-of-life through to end-of-life of the component. In assessing erosion, the code takes account of geometry and sublimation, and physical and chemical erosion of the CFC armour. The incident angle (a glancing angle of a few degrees) of the particle and heat flux onto the target is taken into account. The program has been validated by comparison with analytical approximations very well validated against experimental data. The code has been developed in the APDL language to operate inside a commercial and certificated finite element program such as ANSYS
A program to Evaluate the Erosion on the CFC tiles of the ITER Divertor
International Nuclear Information System (INIS)
DAgata, E.; Tivey, R.; Ogorodnikova, O.; Lowry, Ch.; Schlosser, J.
2006-01-01
The plasma-facing surfaces of the ITER divertor are armoured with tungsten in the upper part of the inner and outer vertical targets and carbon-fibre composite (CFC) in the lower part, the region where the scrape-off layer intercepts the divertor. The CFC in the form of a monoblock in the vertical target is the most loaded part of the plasma-facing surfaces, and hence it is subjected to high erosion and has a significant risk of failure. A program has been developed with the aim of understanding the impact on the erosion lifetime and on the probability of a critical heat flux event in the heat sink of a combination of two main effects: the material property variations (particularly pronounced in CFC) and the presence of joining defects. The software allows the evolution of the surface profile of the armour to be predicted and the margin on critical heat flux at the heat-sink-to-coolant interface to be estimated for a range of postulated defects, for start-of-life through to end-of-life of the component. In assessing erosion, the code takes account of geometry and sublimation, and physical and chemical erosion of the CFC armour. The code allows the computation of the effect of normal and off-normal (ELMs, etc.) operation. The incident angle (a glancing angle of a few degrees) of the particle and heat flux onto the target is taken into account. The program has been validated by comparison with analytical approximations and experimental data. The code has been developed in APDL language to operate inside a commercial and certificate finite element program such as ANSYS. (author)
Kratz, David P.; Chou, Ming-Dah; Yan, Michael M.-H.
1993-01-01
Fast and accurate parameterizations have been developed for the transmission functions of the CO2 9.4- and 10.4-micron bands, as well as the CFC-11, CFC-12, and CFC-22 bands located in the 8-12-micron region. The parameterizations are based on line-by-line calculations of transmission functions for the CO2 bands and on high spectral resolution laboratory measurements of the absorption coefficients for the CFC bands. Also developed are the parameterizations for the H2O transmission functions for the corresponding spectral bands. Compared to the high-resolution calculations, fluxes at the tropopause computed with the parameterizations are accurate to within 10 percent when overlapping of gas absorptions within a band is taken into account. For individual gas absorption, the accuracy is of order 0-2 percent. The climatic effects of these trace gases have been studied using a zonally averaged multilayer energy balance model, which includes seasonal cycles and a simplified deep ocean. With the trace gas abundances taken to follow the Intergovernmental Panel on Climate Change Low Emissions 'B' scenario, the transient response of the surface temperature is simulated for the period 1900-2060.
Manufacturing and testing of a copper/CFC divertor mock-up for JET
International Nuclear Information System (INIS)
Brossa, M.; Ciric, D.; Deksnis, E.; Falter, H.; Guerreschi, U.; Peacock, A.; Pick, M.; Rossi, M.; Shen, Y.; Zacchia, F.
1995-01-01
An actively cooled divertor is a possible option for future developments at The Joint European Torus (JET). A proof of principle actively cooled tile has been produced in order to qualify the relevant manufacturing technologies and the non destructive control processes. In this frame Ansaldo Ricerche (ARI) has been involved in the construction of a mock-up comprising 6 OFHC copper tubes for water cooling that are brazed to a plate made out of carbon fibre composite (CFC). The final objective was the high heat flux testing of the mock-up at JET in order to evaluate the general behaviour of the component under relevant operating conditions. The key point of the work was the realisation of a sound joint by adapting the expertise gained in ARI in previous R and D activities on brazing heterogeneous materials. Reliable methods for ultrasonic examinations of the pieces were also set up. For successful application to the JET pumped divertor a water-cooled CFC target plate must show surface temperatures of 2 . Furthermore, global hydraulic considerations specific to JET limit the system pressure to 0.7 MPa. In such a design, critical heat flux is not the key limit, rather the reliability of the CFC-copper joint in terms of extent of wetting. First tests in the neutral beam test bed at JET show an adequate response for fluxes up to 15 MW/m 2 . (orig.)
Safety characteristics of the monolithic CFC divertor
International Nuclear Information System (INIS)
Zucchetti, M.; Merola, M.; Matera, R.
1994-01-01
The main distinguishing feature of the monolithic CFC divertor is the use of a single material, a carbon fibre reinforced carbon, for the protective armour, the heat sink and the cooling channels. This removes joint interface problems which are one of the most important concerns related to the reference solutions of the ITER CDA divertor. An activation analysis of the different coolant options for this concept is presented. It turns out that neither short-term nor long-term activation are a concern for any coolants investigated. Therefore the proposed concept proves to be attractive from a safety stand-point also. ((orig.))
Safety characteristics of the monolithic CFC divertor
Zucchetti, M.; Merola, M.; Matera, R.
1994-09-01
The main distinguishing feature of the monolithic CFC divertor is the use of a single material, a carbon fibre reinforced carbon, for the protective armour, the heat sink and the cooling channels. This removes joint interface problems which are one of the most important concerns related to the reference solutions of the ITER CDA divertor. An activation analysis of the different coolant options for this concept is presented. It turns out that neither short-term nor long-term activation are a concern for any coolants investigated. Therefore the proposed concept proves to be attractive from a safety stand-point also.
International Nuclear Information System (INIS)
Chevet, G.; Schlosser, J.; Martin, E.; Herb, V.; Camus, G.; Escourbiac, F.
2009-01-01
Plasma facing components (PFCs) in magnetic confinement controlled fusion machines are armoured with carbon fibre composite (CFC) bonded to a copper alloy heat sink. The manufacturing process induces high level of residual stresses due to the thermal expansion mismatch between CFC and copper and PFCs have to withstand strong stress ranges during operation. To study the initiation and propagation of damage in the CFC part, the ONERA damage model is used to describe the behaviour of the N11 material. The finite element simulations show that the damage is located near the interface and develops during the manufacturing of the PFCs as a consequence of the high amplitude of shear stresses. Under high heat flux, stresses decrease and the damage does not evolve. Further studies will take into account the damageable behaviour of the composite/copper interface, which will lead to geometrical optimisations and better knowledge of the link between damage and conductivity.
International Nuclear Information System (INIS)
Visca, E.; Libera, S.; Mancini, A.; Mazzone, G.; Pizzuto, A.; Testani, C.
2006-01-01
ENEA association is involved in the European International Thermonuclear Experimental Reactor (ITER) R-and-D activities and in particular for the manufacturing of high heat flux plasma-facing components (HHFC), such as the divertor targets, the baffles and the limiters: During the last years ENEA has manufactured actively cooled mock-ups by using different technologies, namely brazing, diffusion bonding and hot isostatic pressing (HIPping). A new manufacturing process has been set up and tested. It was successfully applied for the manufacturing of W armoured monoblock mockups. This technique is the HRP (Hot Radial Pressing) based on performing a radial diffusion bonding between the cooling tube and the armour tile by pressurizing only the internal tube and by keeping the joining zone in vacuum and at the required bonding temperature. The heating is obtained by a standard air furnace. The next step was to apply the HRP technique for the manufacturing of CFC armoured monoblock components. For this purpose some issues have to be solved like as the low CFC tensile strength, the pure copper interlayer between the heat sink and the armour necessary to mitigate the stress at the joint interface and the low wettability of the pure copper on the CFC matrix. This paper reports the research path followed to manufacture a medium scale vertical target CFC and W armoured mockup by HRP. An ad hoc rig able to maintain the CFC in a compressive constant condition was also designed and tested. The casting of a soft copper interlayer between the tube and the tile was performed by a new technique: the Pre-Brazed Casting (PBC, ENEA patent). Some mock-ups with three NB31 CFC tiles were successfully manufactured and tested to thermal fatigue using electron beam facilities. They all reached at least 1000 cycles at 20 MW/m 2 without suffering any damage. The manufactured medium scale vertical target mock-up is now under testing at the FE2000 (France) facility. (author)
International Nuclear Information System (INIS)
Anderson, B.L.; Banaghan, E.
1993-01-01
The operating uranium enrichment gaseous diffusion plants (GDPs) in Portsmouth, Ohio and Paducah, Kentucky, which are operated for the United States Department for Energy by Martin Marietta Energy Systems (MMES), currently use a chlorofluorocarbon (CFC-114) as the primary process stream coolant. Due to recent legislation embodied in the Clean Air Act, the production of this and other related chlorofluorocarbons (CFCS) are to be phased out with no production occurring after 1995. Since the plants lose approximately 500,000 pounds per year of this process stream coolant through various leaks, the GDPs are faced with the challenge of identifying a replacement coolant that will allow continued operation of the plants. MMES formed the CFC Task Team to identify and solve the various problems associated with identifying and implementing a replacement coolant. This report includes a review of the work performed by the CFC Task Team, and recommendations that were formulated based on this review and upon original work. The topics covered include; identifying a replacement coolant, coolant leak detection and repair efforts, coolant safety concerns, coolant level sensors, regulatory issues, and an analytical decision analysis
Directory of Open Access Journals (Sweden)
A. Totterdill
2016-09-01
Full Text Available Fluorinated compounds such as NF3 and C2F5Cl (CFC-115 are characterised by very large global warming potentials (GWPs, which result from extremely long atmospheric lifetimes and strong infrared absorptions in the atmospheric window. In this study we have experimentally determined the infrared absorption cross sections of NF3 and CFC-115, calculated the radiative forcing and efficiency using two radiative transfer models and identified the effect of clouds and stratospheric adjustment. The infrared cross sections are within 10 % of previous measurements for CFC-115 but are found to be somewhat larger than previous estimates for NF3, leading to a radiative efficiency for NF3 that is 25 % larger than that quoted in the Intergovernmental Panel on Climate Change Fifth Assessment Report. A whole atmosphere chemistry–climate model was used to determine the atmospheric lifetimes of NF3 and CFC-115 to be (509 ± 21 years and (492 ± 22 years, respectively. The GWPs for NF3 are estimated to be 15 600, 19 700 and 19 700 over 20, 100 and 500 years, respectively. Similarly, the GWPs for CFC-115 are 6030, 7570 and 7480 over 20, 100 and 500 years, respectively.
International Nuclear Information System (INIS)
Visca, Eliseo; Libera, S.; Mancini, A.; Mazzone, G.; Pizzuto, A.; Testani, C.
2007-01-01
ENEA is involved in the European International Thermonuclear Experimental Reactor (ITER) R and D activities and, in particular, for the manufacturing of high heat flux plasma-facing components (HHFC), such as the divertor targets, the baffles and the limiters. During last years, ENEA has manufactured actively cooled mock-ups by using different technologies, namely brazing, diffusion bonding and hot isostatic pressing (HIPping). A new manufacturing process has been set up and tested. It was successfully applied for the manufacturing of W armoured monoblock mock-ups. This technique is the HRP (hot radial pressing) based on performing a radial diffusion bonding between the cooling tube and the armour tile by pressurizing only internal tube and by keeping the joining zone in vacuum at the required bonding temperature. The heating is obtained by a standard air furnace. The HRP technique is now used for the manufacturing of CFC armoured monoblock components. For this purpose, some issues have to be faced, like the low CFC tensile strength, the pure copper interlayer between the heat sink and the armour necessary to mitigate the stress at the joint interface, and the low wettability of the pure copper on the CFC matrix. This paper reports the research path followed to manufacture a medium scale vertical target CFC and W armoured mock-up by HRP. A casting of a soft copper interlayer between the tube and the tile was obtained by a new technique: the pre-brazed casting (PBC, ENEA patent). Some preliminary mock-ups with three NB31 CFC tiles were successfully manufactured and tested to thermal fatigue using electron beam facilities. They all reached at least 1000 cycles at 20 MW/m 2 without suffering any damage. The manufactured medium scale vertical target mock-up is now under testing at the FE2000 (France) facility. These activities were performed in the frame of ITER-EFDA contracts
Development and testing of CFC-copper high heat flux elements
International Nuclear Information System (INIS)
Mitteau, R.; Chappuis, P.; Deschamps, P.; Schlosser, J.; Viallet, H.; Vieider, G.
1994-01-01
In the frame of high heat flux development for plasma facing components, CEA has designed, fabricated and tested over twenty specimens, with some of them for the NET divertor application. Several Carbon Fibre Composites (CFC) and copper grades have been used with flat tile or macro bloc configuration. All the mock-ups were tested in the electron beam facility EB200, for steady-state flux and fatigue up to 1000 cycles. The best four are presented. (author) 3 refs.; 11 figs
2010-07-01
... Refrigerant Recycling Equipment Intended for Use With Both CFC-12 and HFC-134a E Appendix E to Subpart B of... Appendix E to Subpart B of Part 82—The Standard for Automotive Refrigerant Recycling Equipment Intended for... Intended for Use With Both CFC-12 and HFC-134a Foreword The purpose of this standard is to establish...
HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION
The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...
CFC and HFC recycling equipments: Test performances
International Nuclear Information System (INIS)
Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M.
1996-12-01
Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid
Energy Technology Data Exchange (ETDEWEB)
Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, Via E. Fermi, 45, IT-00044 Frascati, RM (Italy)], E-mail: visca@frascati.enea.it; Libera, S.; Mancini, A.; Mazzone, G.; Pizzuto, A. [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, Via E. Fermi, 45, IT-00044 Frascati, RM (Italy); Testani, C. [CSM S.p.A., IT-00128 Castel Romano, RM (Italy)
2007-10-15
ENEA is involved in the European International Thermonuclear Experimental Reactor (ITER) R and D activities and, in particular, for the manufacturing of high heat flux plasma-facing components (HHFC), such as the divertor targets, the baffles and the limiters. During last years, ENEA has manufactured actively cooled mock-ups by using different technologies, namely brazing, diffusion bonding and hot isostatic pressing (HIPping). A new manufacturing process has been set up and tested. It was successfully applied for the manufacturing of W armoured monoblock mock-ups. This technique is the HRP (hot radial pressing) based on performing a radial diffusion bonding between the cooling tube and the armour tile by pressurizing only internal tube and by keeping the joining zone in vacuum at the required bonding temperature. The heating is obtained by a standard air furnace. The HRP technique is now used for the manufacturing of CFC armoured monoblock components. For this purpose, some issues have to be faced, like the low CFC tensile strength, the pure copper interlayer between the heat sink and the armour necessary to mitigate the stress at the joint interface, and the low wettability of the pure copper on the CFC matrix. This paper reports the research path followed to manufacture a medium scale vertical target CFC and W armoured mock-up by HRP. A casting of a soft copper interlayer between the tube and the tile was obtained by a new technique: the pre-brazed casting (PBC, ENEA patent). Some preliminary mock-ups with three NB31 CFC tiles were successfully manufactured and tested to thermal fatigue using electron beam facilities. They all reached at least 1000 cycles at 20 MW/m{sup 2} without suffering any damage. The manufactured medium scale vertical target mock-up is now under testing at the FE2000 (France) facility. These activities were performed in the frame of ITER-EFDA contracts.
Directory of Open Access Journals (Sweden)
I MADE RASTA
2015-06-01
Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.
Narumi, Yoko; Aoki, Yoko; Niihori, Tetsuya; Neri, Giovanni; Cave, Helene; Verloes, Alain; Nava, Caroline; Kavamura, Maria Ines; Okamoto, Nobuhiko; Kurosawa, Kenji; Hennekam, Raoul C. M.; Wilson, Louise C.; Gillessen-Kaesbach, Gabriele; Wieczorek, Dagmar; Lapunzina, Pablo; Ohashi, Hirofumi; Makita, Yoshio; Kondo, Ikuko; Tsuchiya, Shigeru; Ito, Etsuro; Sameshima, Kiyoko; Kato, Kumi; Kure, Shigeo; Matsubara, Yokhi
2007-01-01
Cardio-facio-cutaneous (CFC) syndrome is a multiple congenital anomaly/mental retardation syndrome characterized by heart defects, a distinctive facial appearance, ectodermal abnormalities and mental retardation. Clinically, it overlaps with both Noonan syndrome and Costello syndrome, which are
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-03-01
Technical literature is referred to for the survey of recent trends in CFC (chlorofluorocarbon) phaseout in various countries overseas. The European Union will totally abolish CFC by the end of 1994 while other developed countries will totally abolish the same by the end of 1995 in compliance with the Montreal protocol. Many of the developing countries are actively striving to reduce CFC use with the help of the Multilateral Fund of Montreal. China and India have production facilities in themselves, and have not announced a phaseout program. There is a proposition for accelerating the regulation of HCFCs (hydrochlorofluorocarbons), but reliable substitutes for them are not yet available and their ozone layer restoring capability if used will be slight. It is feared that such will on the contrary retard CFC phaseout in developing countries. Accordingly, any abrupt acceleration of CFC phaseout implementation is inappropriate. Introduced in this report as fluorine-containing greenhouse gas-related information are a summary of the United Nations Framework Convention on Climate Change and the history of Intergovernmental Panel on Climate Change activities. According to an American survey, the aluminum industry emits 30,000 tons of CF{sub 4} and C{sub 2}F{sub 6}, and the semiconductor manufacturing industry 2,000-3,000 tons. As for SF{sub 6}, 5,000-8,000 tons are emitted mainly by the power industry. Measures for inhibiting them are being taken. (NEDO)
Modelling of steady state erosion of CFC actively water-cooled mock-up for the ITER divertor
Energy Technology Data Exchange (ETDEWEB)
Ogorodnikova, O.V. [Departement de Recherches sur la Fusion Controlee, Association Euratom-CEA, CEA-Cadarache, F-13108 Saint Paul Lez Durance cedex (France)], E-mail: igra32@rambler.ru
2008-04-15
Calculations of the physical and chemical erosion of CFC (carbon fibre composite) monoblocks as outer vertical target of the ITER divertor during normal operation regimes have been done. Off-normal events and ELM's are not considered here. For a set of components under thermal and particles loads at glancing incident angle, variations in the material properties and/or assembly of defects could result in different erosion of actively-cooled components and, thus, in temperature instabilities. Operation regimes where the temperature instability takes place are investigated. It is shown that the temperature and erosion instabilities, probably, are not a critical point for the present design of ITER vertical target if a realistic variation of material properties is assumed, namely, the difference in the thermal conductivities of the neighbouring monoblocks is 20% and the maximum allowable size of a defect between CFC armour and cooling tube is +/-90{sup o} in circumferential direction from the apex.
Modelling of steady state erosion of CFC actively water-cooled mock-up for the ITER divertor
Ogorodnikova, O. V.
2008-04-01
Calculations of the physical and chemical erosion of CFC (carbon fibre composite) monoblocks as outer vertical target of the ITER divertor during normal operation regimes have been done. Off-normal events and ELM's are not considered here. For a set of components under thermal and particles loads at glancing incident angle, variations in the material properties and/or assembly of defects could result in different erosion of actively-cooled components and, thus, in temperature instabilities. Operation regimes where the temperature instability takes place are investigated. It is shown that the temperature and erosion instabilities, probably, are not a critical point for the present design of ITER vertical target if a realistic variation of material properties is assumed, namely, the difference in the thermal conductivities of the neighbouring monoblocks is 20% and the maximum allowable size of a defect between CFC armour and cooling tube is +/-90° in circumferential direction from the apex.
Cyclic heat load testing of improved CFC/Cu bonding for the W 7-X divertor targets
International Nuclear Information System (INIS)
Greuner, H.; Boeswirth, B.; Boscary, J.; Chaudhuri, P.; Schlosser, J.; Friedrich, T.; Plankensteiner, A.; Tivey, R.
2009-01-01
Extensive high heat flux cycling testing of pre-series targets was performed in the neutral beam facility GLADIS to establish the industrial process for the manufacturing of 890 targets, which will be needed for the installation of the WENDELSTEIN 7-X divertor. The targets are manufactured of flat tiles of CFC NB31 as plasma facing material bonded by an Active Metal Casting copper interlayer onto a water-cooled CuCrZr structure. Based on the results of the 3D thermo-mechanical FEM analysis of the CFC/Cu interface, an additional set of 17 full-scale pre-series elements including three design variations was manufactured by PLANSEE SE. The insertion of an additional plastically compliant copper interlayer between the cooling structure and the Active Metal Casting interlayer showed the best results. No critical tile detachment was observed during >5000 cycles at 10 MW/m 2 . These results demonstrated the sufficient life time of the component for the expected heat load in operation.
Evaporation and Vapor Shielding of CFC Targets Exposed to Plasma Heat Fluxes Relevant to ITER ELMs
International Nuclear Information System (INIS)
Safronov, V.; Arkhipov, N.I.; Toporkov, D.A.; Zhitlukhin, A.M.; Landman, I.
2007-01-01
Full text of publication follows: Carbon-fibre composite (CFC) is foreseen presently as armour material for the divertor target in ITER. During the transient processes such as instabilities of Edge Localized Modes (ELMs) the target as anticipated will be exposed to the plasma heat loads of a few MJ/m 2 on the time scale of a fraction of ms, which causes an intense evaporation at the target surface and contaminates tokamak plasma by evaporated carbon. The ITER transient loads are not achievable at existing tokamaks therefore for testing divertor armour materials other facilities, in particular plasma guns are employed. In the present work the CFC targets have been tested for ITER at the plasma gun facility MK- 200 UG in Troitsk by ELM relevant heat fluxes. The targets in the applied magnetic field up to 2 T were irradiated by hydrogen plasma streams of diameter 6 - 8 cm, impact ion energy 2 - 3 keV, pulse duration 0.05 ms and energy density varying in the range 0.05 - 1 MJ/m 2 . Primary attention has been focused on the measurement of evaporation threshold and investigation of carbon vapor properties. Fast infrared pyrometer, optical and VUV spectrometers, framing cameras and plasma calorimeters were applied as diagnostics. The paper reports the results obtained on the evaporation threshold of CFC, the evaporation rate of the carbon fibers oriented parallel and perpendicular to the exposed target surface, the velocity of carbon vapor motion along and across the magnetic field lines, and the parameters of carbon plasma such as temperature, density and ionization state measured up to the distance 15 cm at varying plasma load. First experimental results on investigation of the vapor shield onset conditions are presented also. (authors)
3He and chlorofluorocarbons (CFC) in the Southern Ocean
International Nuclear Information System (INIS)
Jean-Baptiste, P.; Jamous, D.; Mantisi, F.; Memery, L.; Universite Paris 6
1991-01-01
The distribution of 3 He across the Southern Ocean is depicted on the basis of a meridional section between Antarctica and South Africa measured during the INDIGO-3 survey (1988). A core of δ 3 He values above 10% is observed south of the Polar Front, associated with very low CFC concentrations. This 3 He enriched layer is documented from the GEOSECS and INDIGO 3 He data in the Southern Ocean. It is found at a density level around θ σ =27.8 in all the waters close to Antarctica (i.e. south of 50 degS). Its zonal distribution suggests that it is likely that it originates from the central/eastern Pacific. Hence, it provides an indication of the deep Pacific waters in the Antarctic Circumpolar Current, which are not easily detectable from the standard hydrographic parameters. (author). 19 refs.; 8 figs
Energy Technology Data Exchange (ETDEWEB)
May, L.
1996-12-11
In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.
Mcgillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.
2014-01-01
CFCl3 (CFC-11) is both an atmospheric ozone-depleting and potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95 - 230 nm) and temperature (216 - 296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using a 2-D model and the spectrum parameterization developed in this work. The obtained global annually averaged lifetime was 58.1 +- 0.7 years (2 sigma uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current spectrum recommendations
Energy Technology Data Exchange (ETDEWEB)
Fleurance, M.
1996-12-31
Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Kai, H.; Fukuda, K.; Yoshioka, M. (Sharp Corp., Osaka (Japan))
1992-11-10
Polyurethane thermal insulator in which the usage of CFC-11 is 50% reduced by increasing the percentage of water has been developed for the purpose of reducing polyurethane-foaming CFC-11 used as thermal insulator of refrigerators. In this new water-intensive feedstock system, the overall OH-value in polyol was lowered; the usage of aromatic amines was curtailed; and the amount of sorbits was increased so as to secure adhesiveness at the foaming jig temperature of 35[degree]C. As for the improvement of fluidity, a combination of four kinds of polyols offered viscosity in the same level as in the conventional ones. Thermal conductivity was worsened, but the rate of its drop could be controlled below 3% by some measures such as homogenization of stock materials, choice of a suface-active agent which makes foam bubbles minute, etc. Concerning curing property which has a large effect on productivity, a reaction type amine-based catalyst delaying thickening behaviour at the time of foaming was selected and a gelling promotive tertiary amine-based catalyst which can develop foam curing promptly was combinedly used to reduce curing property from five minutes in the past to four minutes. 2 refs., 6 figs., 14 tabs.
CFC environmental problems and cooling technology
International Nuclear Information System (INIS)
Hornung, M.O.
1991-08-01
The aim of the report is to provide a broad survey of the technological problems imposed on the production of cooling systems by the demands for reduction in the use of chlorofluorocarbons as refrigerants. With regard to industrial research in this area the present situation is clarified and possible future developments are discussed. The influence of CFC gasses on the global environment and international and national legislation within this field are explained. Alternative refrigerants and cooling processes, and ways of reducing refrigerant leakage, are described. It is concluded that currently the use of alternative refrigerants is the policy which is generally accepted, and intensive research is being carried out in this field. R134a should substitute R12 in the cases of household refrigerators and air conditioning, and will soon be commercially available. The use of R22 and ammonia will be extended. This is a practical policy to follow up commercially, whereas the policy of alternative processes presents more problems because they are not so developed and there is less available know-how in this area. The possibilities for hermetic sealing of cooling systems are unrealistic and should anyway be regarded only as a supplement to alternative refrigerants. Within the European Community it is intended to provide standards and regulations in relation to air pollution from refrigerants. (AB) (58 refs.)
Investigation of tungsten coatings on graphite and CFC
International Nuclear Information System (INIS)
Neu, R; Maier, H; Gauthier, E; Greuner, H; Hirai, T; Hopf, Ch; Likonen, J; Maddaluno, G; Matthews, G F; Mitteau, R; Philipps, V; Piazza, G; Ruset, C
2007-01-01
In the frame of JET's ITER-like wall (ILW) project tungsten coatings on carbon fibre reinforced carbon substrates will be used in the divertor and highly loaded areas in the main chamber. Fourteen different types of samples were produced by physical or chemical vapour deposition and vacuum plasma spray (VPS) with coating thickness of 4, 10 and 200 μm. Similarly, three different VPS W coatings (200 μm) on two different graphite substrates, were produced for use at the strike-point regions of ASDEX Upgrade. All coatings were subjected to thermal screening and thermal cycling tests in the ion beam facility GLADIS. Additionally, the coatings intended for the ILW project were exposed to edge localized mode (ELM)-like thermal loads in the electron beam facility JUDITH. A general failure mode with the CFC substrate is crack formation upon cool-down, whereas the coatings on graphite do not show any crack formation. Additionally, metallographic investigations, x-ray diffraction measurements, adhesion testing as well as measurements on the contents of light impurities were performed
Directory of Open Access Journals (Sweden)
Mani Kolandavel
2008-01-01
Full Text Available This paper presents an experimental study on the replacement of CFC12 and HFC134a by the new R290/R600a refrigerant mixture as drop-in replacement refrigerant with and without the effect of magnetic field. Without any modification to the system components drop-in experimental tests were performed on a vapour compression refrigeration system with a reciprocating compressor, which was originally designed to operate with CFC12.The test results with no magnets showed that the refrigerant R290/R600a had 19.9-50.1% higher refrigerating capacity than R12 and 28.6-87.2% than R134a. The mixture R290/R600a consumed 6.8- -17.4% more energy than R12. The coefficient of performance of R290/R600a mixture increases from 3.9-25.1% than R12 at lower evaporating temperatures and 11.8-17.6% at higher evaporating temperatures. The effect of magnetic field force reduced the compressor energy consumption by 1.5-2.5% than with no magnets. The coefficient of performance of the system was higher in the range 1.5-2.4% with the effect of magnetic field force. The R290/600a (68/32 by wt.% mixture can be considered as an excellent alternative refrigerant for CFC12 and HFC134a systems.
Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential
Energy Technology Data Exchange (ETDEWEB)
Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)
1995-12-31
Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)
Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential
Energy Technology Data Exchange (ETDEWEB)
Pipatti, R; Savolainen, I; Sinisalo, J [VTT Energy, Espoo (Finland)
1996-12-31
Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)
Energy Technology Data Exchange (ETDEWEB)
Carpenter, Charles [Waste Policy Institute, Blacksburg, VA (United States)
1992-07-01
This paper presents information, examples, and opinions leading to the authors conclusions on practical dates for phase-out of 1,1,2-trichloro-1,1,2-trifluoroethane (CFC-113) and 1,1,1 trichloroethane (mythyl chloroform) when used as industrial solvents and cleaners. The dates refer to an expected Amendment to the Montreal Protocol. The paper is based on information obtained from the Department of Energy, the Air Force, from author participation on the United Nations Environmental Panel Solvents, Coatings, and Adhesives Technical Options Committee, and from recent publications. The paper informs the reader of impending legislature, possible impacts of that legislature, and of less obvious requirements which will impact cost of compliance and will extend the time required to reach compliance. The purpose of the paper is show users of CFC-113 and 1,1,1-trichloroethane the legal and moral necessity of rapid phase-out of those chemicals, point the user in the right direction for long-term solutions, and urge lawmakers to balance the need for action with the realities of the technical and economic situation. (author)
International Nuclear Information System (INIS)
Carpenter, Charles
1992-01-01
This paper presents information, examples, and opinions leading to the authors conclusions on practical dates for phase-out of 1,1,2-trichloro-1,1,2-trifluoroethane (CFC-113) and 1,1,1 trichloroethane (mythyl chloroform) when used as industrial solvents and cleaners. The dates refer to an expected Amendment to the Montreal Protocol. The paper is based on information obtained from the Department of Energy, the Air Force, from author participation on the United Nations Environmental Panel Solvents, Coatings, and Adhesives Technical Options Committee, and from recent publications. The paper informs the reader of impending legislature, possible impacts of that legislature, and of less obvious requirements which will impact cost of compliance and will extend the time required to reach compliance. The purpose of the paper is show users of CFC-113 and 1,1,1-trichloroethane the legal and moral necessity of rapid phase-out of those chemicals, point the user in the right direction for long-term solutions, and urge lawmakers to balance the need for action with the realities of the technical and economic situation. (author)
International Nuclear Information System (INIS)
Ciconkov, Risto
1995-01-01
The first vapor compression refrigeration systems and the problems with the used refrigerants are discussed. A result of the research were CFC fluids which are nontoxic, nonflammable, stable and inert. The excellent characteristics of CFC were a good reason for an enlarged expanding use in other applications, such as aerosols, polyurethane foam, solvent etc. After the discovery that CFCs damage the protective ozone layer in the stratosphere, Montreal protocol is signed (1987), which foresees a cutback in the production and use of CFCs. The phase out in the production of aerosols, foams and solvents is very effective and fast, but in the refrigeration systems is very slow because of their complex requirements and conflict of interests. The newest regulations from UNEAP are: the ban in the production and use of CFCs from 01 January, 1996. The long life of CFCs in the atmosphere contributes to the greenhouse effect and increase the average temperature on earth. The effect is mainly caused by carbon dioxide emissions (50%), while the contribution of CFCs is about 20 to 25%. The well known companies offer on the market new alternative fluids for refrigeration systems, mainly HFC fluids, but their influence upon the environment is still not proved. We already have the lesson of history. (author)
2010-07-01
... does not recycle, any single, specific automotive refrigerant other than CFC-12 or HFC-134a, including... or equivalent new product specifications before reuse in a mobile air-conditioning system.” The... capable of ensuring removal of refrigerant from the system being serviced by reducing the system pressure...
Formulation and evaluation of CFC free inhalers for beclomethasone dipropionate
Directory of Open Access Journals (Sweden)
Gopala Krishna Murthy Talasila
2013-06-01
Full Text Available Beclomethasone dipropionate CFC free inhalation formulations were developed with a view to treat asthma prophylactically. Dry powder inhalers (DPI for beclomethasone dipropionate were prepared with different grades of lactose monohydrate. The influence of carrier and overages on performance of DPI was studied. Metered dose inhalers (MDI with HFA based propellants were formulated with various doses, overages and different concentrations of alcohol. Formulated DPI and MDI were evaluated for various official and unofficial quality control tests. The influence of over doses on valve delivery, effect of overages on emitted dose and influence of alcohol on spray pattern from MDI were studied. The better fine particle fraction and emitted dose were obtained from the DPI formulated with 10:90 ratio of fine lactose: coarse lactose and with 20% w/w overages. The studies on MDI revealed that the 15% of overdoses are required for effective valve delivery and 20% overages are required for 100% drug delivery. 5-10%v/v alcohol was found to be preferable to get optimum emitted dose and fine particle fraction.
Bourke, Sarah A.; Cook, Peter G.; Dogramaci, Shawan; Kipfer, Rolf
2015-06-01
Groundwater recirculation occurs when groundwater is pumped from an aquifer onto the land surface, and a portion of that water subsequently infiltrates back to the aquifer. In environments where groundwater is recirculated, differentiation between various sources of recharge (e.g. natural rainfall recharge vs. recirculated water) can be difficult. Groundwater age indicators, in particular transient trace gases, are likely to be more sensitive tracers of recharge than stable isotopes or chloride in this setting. This is because, unlike stable isotopes or chloride, they undergo a process of equilibration with the atmosphere, and historical atmospheric concentrations are known. In this paper, groundwater age indicators (14C and CFC-12) were used as tracers of recharge by surplus mine water that is discharged to streams. Ternary mixing ratios were calculated based on 14C and CFC-12 concentrations measured along three transects of piezometers and monitoring wells perpendicular to the creeks, and from dewatering wells. Uncertainty in calculated mixing ratios was estimated using a Monte Carlo approach. Ternary mixing ratios in dewatering wells suggest that recharge by mine water accounted for between 10% and 87% of water currently abstracted by dewatering wells. The calculated mixing ratios suggest that recharge by mine water extends to a distance of more than 550 m from the creeks. These results are supported by seepage flux estimates based on the water and chloride balance along the creeks, which suggest that 85-90% of mine water discharged to the creeks recharges the aquifer and recharge by mine water extends between 110 and 730 m from the creeks. Mixing calculations based on gaseous groundwater age indicators could also be used to partition recharge associated with agricultural irrigation or artificial wetland supplementation.
Kolbe, Tamara; Marçais, Jean; Thomas, Zahra; Abbott, Benjamin W.; de Dreuzy, Jean-Raynald; Rousseau-Gueutin, Pauline; Aquilina, Luc; Labasque, Thierry; Pinay, Gilles
2016-12-01
Nitrogen pollution of freshwater and estuarine environments is one of the most urgent environmental crises. Shallow aquifers with predominantly local flow circulation are particularly vulnerable to agricultural contaminants. Water transit time and flow path are key controls on catchment nitrogen retention and removal capacity, but the relative importance of hydrogeological and topographical factors in determining these parameters is still uncertain. We used groundwater dating and numerical modeling techniques to assess transit time and flow path in an unconfined aquifer in Brittany, France. The 35.5 km2 study catchment has a crystalline basement underneath a ∼60 m thick weathered and fractured layer, and is separated into a distinct upland and lowland area by an 80 m-high butte. We used groundwater discharge and groundwater ages derived from chlorofluorocarbon (CFC) concentration to calibrate a free-surface flow model simulating groundwater flow circulation. We found that groundwater flow was highly local (mean travel distance = 350 m), substantially smaller than the typical distance between neighboring streams (∼1 km), while CFC-based ages were quite old (mean = 40 years). Sensitivity analysis revealed that groundwater travel distances were not sensitive to geological parameters (i.e. arrangement of geological layers and permeability profile) within the constraints of the CFC age data. However, circulation was sensitive to topography in the lowland area where the water table was near the land surface, and to recharge rate in the upland area where water input modulated the free surface of the aquifer. We quantified these differences with a local groundwater ratio (rGW-LOCAL), defined as the mean groundwater travel distance divided by the mean of the reference surface distances (the distance water would have to travel across the surface of the digital elevation model). Lowland, rGW-LOCAL was near 1, indicating primarily topographical controls. Upland, r
Towards the development of workable acceptance criteria for the divertor CFC monoblock armour
Energy Technology Data Exchange (ETDEWEB)
D' Agata, E. [ITER International Team, ITER Joint Work Site, Boltzmannstr. 2, D-85748 Garching (Germany)]. E-mail: dagatae@itereu.de; Tivey, R. [ITER International Team, ITER Joint Work Site, Boltzmannstr. 2, D-85748 Garching (Germany)
2005-11-15
The plasma-facing components (PFCs) of the ITER divertor will be subjected to high heat flux (HHF). Carbon-fibre composite (CFC) is selected as the armour for the region of highest heat flux where the scrape-off layer of the plasma intercepts the vertical targets (VT). Failure of the armour to heat sink joints will compromise the performance of the divertor and could ultimately result in its failure and the shut down of the ITER machine. There are tens of thousands of CFCs to CuCrZr joints. The aim of the PFC design is to ensure that the divertor can continue to function even with the failure of a few joints. In preparation for writing the procurement specification for the ITER vertical target PFCs, a programme of work is underway with the objective of defining workable acceptance criteria for the PFC armour joints.
Towards the development of workable acceptance criteria for the divertor CFC monoblock armour
International Nuclear Information System (INIS)
D'Agata, E.; Tivey, R.
2005-01-01
The plasma-facing components (PFCs) of the ITER divertor will be subjected to high heat flux (HHF). Carbon-fibre composite (CFC) is selected as the armour for the region of highest heat flux where the scrape-off layer of the plasma intercepts the vertical targets (VT). Failure of the armour to heat sink joints will compromise the performance of the divertor and could ultimately result in its failure and the shut down of the ITER machine. There are tens of thousands of CFCs to CuCrZr joints. The aim of the PFC design is to ensure that the divertor can continue to function even with the failure of a few joints. In preparation for writing the procurement specification for the ITER vertical target PFCs, a programme of work is underway with the objective of defining workable acceptance criteria for the PFC armour joints
Energy Technology Data Exchange (ETDEWEB)
Nozu, S [Univ. of Okayama Prefecture, Okayama (Japan); Katayama, H [Mitsubishi Chemical Co., Inc., Tokyo (Japan); Nakata, H [Daikin Industries, Ltd., Osaka (Japan); Honda, H [Kyushu University, Fukuoka (Japan). Institute of Advanced Material Study
1996-09-25
Local heat transfer and pressure drop measurements were made during condensation of CFC 11 in microfin tubes. A smooth tube and two microfin tubes with different fin dimensions were used. Flow observation study with use of an industrial bore-scope revealed that the condensate swirled along the grooves, and a thick condensate film covered fins in the lower part of the tube in the low quality region. Static pressure gradients in the microfin tubes were up to 70 percent larger than that in a smooth tube. A correlation equation for the local frictional pressure gradient was derived, in which the effect of refrigerant mass velocity was introduced on the basis of the flow regime consideration. The measured frictional pressure gradient data were found by the present method to have a mean absolute deviation of 8.3 percent. 24 refs., 11 figs., 3 tabs.
Influence of CFC quality on the performance of TS limiter elements under cyclic heat loading
International Nuclear Information System (INIS)
Missirlian, M.; Greuner, H.; Hoeschen, T.; Linsmeier, Ch.; Richou, M.; Lipa, M.; Boeswirth, B.; Boscary, J.
2011-01-01
For the fabrication of 600 actively cooled finger elements for the Tore Supra pump limiter in operation since 2001 it was necessary to rely on two different batches of the CFC N11 grade (Carbon Fibre reinforced Composite) namely so-called SEP N11-92 (fabricated in 1992) and N11-98 (fabricated in 1998). It came out during the incoming inspection of the fingers that the bonding quality was degraded for the 98-batch so that an important number of tiles had to be repaired. Due to the coming upgrade of the Tore Supra heating system, two high heat flux test campaigns were performed on the neutral beam GLADIS facility (IPP Garching, Germany) including micro-structural analyses in order to evaluate, compare and understand the fatigue behaviour of 92- and 98-batch finger elements.
Rozanski, Kazimierz; Bartyzel, Jakub; Dulinski, Marek; Kuc, Tadeusz; Sliwka, Ireneusz; Mochalski, Pawel; Kania, Jaroslaw; Witczak, Stanislaw
2013-04-01
Groundwater is an important source of potable water in many countries. While it covers ca. 50% of the global drinking water needs, in Europe this share is even higher, reaching approximately 70%. Nowadays, this strategic resource is at risk due to anthropogenic pollutants of various nature entering shallow aquifers. Proper management of groundwater resources requires thorough understanding of groundwater dynamics on time scales characteristic for the history of pollutant input to groundwater. The bomb-tritium has been used for several decades now as a tracer of choice to detect recent recharge and to quantify groundwater residence times on time scales extending from several years to several decades. The lumped-parameter modeling was the most often employed approach in this context. Since nowadays atmospheric concentrations of tritium are approaching natural levels in most parts of the world, the usage of this tracer has become more problematic. Therefore, there is a growing interest in alternative indicators of groundwater age in shallow aquifers. Anthropogenic trace gases present in the atmosphere, such as freons (CFC-11, CFC-12, CFC-113) and sulfur hexafluoride (SF6), have been applied in numerous case studies as substitutes of tritium. Here we present the results of a comprehensive study aimed at quantifying mean residence time of groundwater in the recharge area of porous sandy aquifer system located in the southern Poland. The principal economic role of the aquifer, consisting of two water-bearing strata, is to provide potable water for public and private users. The yield of the aquifer is insufficient to meet all the needs and, as a consequence, licensing conflicts arise between water supply companies and industry on the amount of water available for safe exploitation. To quantify residence time distribution (RTD) functions of water parcels arriving at the production wells located in the recharge area of the aquifer, tritium along with several gaseous tracers
Czech Academy of Sciences Publication Activity Database
Hofer, Michal; Vacek, Antonín; Weiterová, Lenka
2005-01-01
Roč. 54, - (2005), s. 207-213 ISSN 0862-8408 R&D Projects: GA AV ČR(CZ) IBS5004009; GA AV ČR(CZ) KSK5011112; GA ČR(CZ) GP305/03/D050 Institutional research plan: CEZ:AV0Z50040507 Keywords : murine hematopoiesis * GM-CFC * rhG- CSF Subject RIV: BO - Biophysics Impact factor: 1.806, year: 2005
Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11)
Benardini, James N.; Koukol, Robert C.; Kazarians, Gayane A.; Morales, Fabian
2013-01-01
NASA Procedural Requirement 8020.12C entitled "Planetary Protection Provisions for Robotic Extraterrestrial Missions" states that the source-specific encapsulated microbial density for encapsulated organisms (div(0)) in nonmetallic materials ranges from 1-30 spores/cubic cm. The standard laboratory procedure, NASA Standard Procedures for the Microbial Examination of Space Hardware, NHB 5340.1B, does not provide any direction into the methodologies to understand the bioburden within such a fluid as CFC-11 (Freon). This general specification value for the Freon would be applicable to the Freon charged within the Mars Science Laboratory fs (MSL fs) Heat Rejection System. Due to the large volume required to fill this system, MSL could not afford to conservatively allocate 55.8% of the total spore budget of the entire laboratory system (rover, descent stage, cruise stage, and aeroshell) of 5.00 X 10(exp 5) spores at launch. A novel filtration approach was developed to analyze the Freon employing a 50 kDa molecular weight cutoff (MCO) filter, followed by 0.22-micron pore-size filter to establish a calculated microbial bioburden.
The time goes by: R 134a and R 32, important substances for the substitution of CFC and HCFC
International Nuclear Information System (INIS)
Beckitt, J.W.; Harris, M.R.; Weissenborn, P.
1993-01-01
In this article an interview with representatives of a world-wide leading producer of refrigerants is given. Already five or six years ago they took the decision - which has already today proven to be correct - to find substituents which have a low toxicity, a low greenhouse potential and which do not deplete the ozone layer. R 134a turned out to be a promising substance. On the part of the producers it was stressed that tight regulations play an important role in the phase-out of CFC as only legal pressure will force the users to act. Also the establishment of an effective recycling system contributes to a better acceptance. (BWI) [de
Tritiated thymidine and deoxycytidine suicide of mouse hemopoietic colony forming cells (CFC)
International Nuclear Information System (INIS)
Uyeki, E.M.; Wierzba, K.; Bisel, T.U.
1981-01-01
Significant enhancement of tritiated dCyd suicide occurred when unlabelled dThd was added to cultures of mouse monocytic colony-forming cells. Incorporation experiments supported the suicide experiments in that incorporation of tritiated dCyd into DNA was significantly increased. One hundred micromolar dCyd significantly reduced the radiotoxicity of 0.3 μCi of tritiated dThd; incorporation experiments indicated a dose-related reduction in the incorporation of tritiated dThd into DNA with the addition of 1-100 μM unlabelled dCyd. The addition of 1 μM aminopterin reversed the effect of 100 μM deoxycytidine; viz., incorporation of dThd into DNA was 90% of controls. Aminopterin had a similar effect on deoxyuridine reversal of tritiated dThd incorporation into DNA. Aminopterin had no effect on the reduction of tritiated dThd incorporation into DNA due to the addition of 100 μM unlabelled thymidine. Unlabelled ribonucleosides, Urd and Cyd, did not significantly affect the suicide pattern of tritiated dThd or dCyd when they were added to CFC cultures. Unlabelled deoxyribonucleosides, dThd or dCyd, did not significantly affect the suicide pattern of either tritiated Cyd or Urd when they were added to cultures containing tritiated ribonucleosides. Unlabelled Urd or Cyd was effective in reversing the suicide due to tritiated Urd or Cyd. (author)
Energy Technology Data Exchange (ETDEWEB)
Shang, Xiao; Chi, Jing-Qi [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Lu, Shan-Shan [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Gou, Jian-Xia [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Dong, Bin, E-mail: dongbin@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Li, Xiao; Liu, Yan-Ru; Yan, Kai-Li; Chai, Yong-Ming [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liu, Chen-Guang, E-mail: cgliu@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China)
2017-01-15
Highlights: • WS{sub 2} nanoplates supported on carbon fiber cloth (WS{sub 2}/CFC) have been synthesized. • WS{sub 2}/CFC has the good dispersion and interwoven structure of WS{sub 2}. • CFC as substrate contributes to enhanced conductivity and close combination. • WS{sub 2}/CFC exhibits ultra-high activity and stability owing to CFC as support. - Abstract: The interwoven WS{sub 2} nanoplates supported on carbon fiber cloth (WS{sub 2}/CFC) have been successfully synthesized by a facile solvothermal process. XRD and XPS confirm the formation of WS{sub 2}/CFC. SEM images show the good dispersion of WS{sub 2} nanoplates with interwoven structures on the surface of CFC. Thanks to the 3D framework of CFC, WS{sub 2} nanoplates realize overall excellent-dispersion interwoven on the surface of CFC compared with pristine bulk WS{sub 2} with severe aggregation. Moreover, CFC not only serves as excellent conductive substrate to accelerate electron transport rate, but also contributes to the close combination between WS{sub 2} and CFC for long-term stability. The electrochemical measurements show that WS{sub 2}/CFC exhibit a high specific capacitance of 399 F g{sup −1} at 1.0 A g{sup −1}, demonstrating the obviously enhanced capability compared with pristine bulk WS{sub 2}. Furthermore, WS{sub 2}/CFC realizes ultra-stable cycling stability with 99% of retention of capacitance after 500 charge-discharge cycles. It may provide novel access of designing carbon-based transition metal disulfides composites for excellent super capacitive properties.
Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley
2016-04-01
To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (< 1 year). In both cases MRTs of 13 - 17 years, calculated
Transport and degradation of chlorofluorocarbons (CFCs) in the pyritic Rabis Creek aquifer, Denmark
DEFF Research Database (Denmark)
Hinsby, K.; Hojberg, A.L.; Engesgaard, P.
2007-01-01
Vertical profiles of the chlorofluorocarbons CFC-11, CFC-12, and CFC-113 penetrating aerobic and anaerobic parts of a shallow sandy aquifer show that the CFC gases are degraded in the Rabis Creek, Denmark...
Joireman, Jeff; Shaffer, Monte J; Balliet, Daniel; Strathman, Alan
2012-10-01
The authors extended research linking individual differences in consideration of future consequences (CFC) with health behaviors by (a) testing whether individual differences in regulatory focus would mediate that link and (b) highlighting the value of a revised, two-factor CFC-14 scale with subscales assessing concern with future consequences (CFC-Future) and concern with immediate consequences (CFC-Immediate) proper. Exploratory and confirmatory factor analyses of the revised CFC-14 scale supported the presence of two highly reliable factors (CFC-Future and CFC-Immediate; αs from .80 to .84). Moreover, structural equation modeling showed that those high in CFC-Future engage in exercise and healthy eating because they adopt a promotion orientation. Future use of the two-factor CFC-14 scale is encouraged to shed additional light on how concern with future and concern with immediate consequences (proper) differentially impact the way people resolve a host of intertemporal dilemmas (e.g., health, financial, and environmental behavior).
Noaa chlorofluorocarbon tracer program air and seawater measurements: 1986-1989. Data file
International Nuclear Information System (INIS)
Wisegarver, D.P.; Bullister, J.L.; Gammon, R.H.; Menzia, F.A.; Kelly, K.C.
1993-04-01
The NOAA Chlorofluorocarbon (CFC) Tracer Program at PMEL has been measuring the growing burden of these anthropogenic gases in the thermocline waters of the Pacific Ocean since 1980. The central goals of the NOAA CFC Tracer Program are to document the transient invasion of the CFC tracers into the Pacific Ocean, by means of repeat occupations of key hydrographic sections at 5-year intervals, and to interpret these changing distributions in terms of coupled ocean-atmosphere models. Studies are underway to use the CFC observations in model-validation studies, and to help develop predictive capabilities on the decade-to-century timescale. The report includes measurements of trichlorofluoromethane (CFC-11) and dichlorodifluoromethane (CFC-12) dissolved in seawater samples collected in the Pacific Ocean by the NOAA CFC Tracer Program on six cruises during the period of 1986-1989. Measurements of depth, pressure, salinity, temperature, and dissolved oxygen are included with the CFC data. Measurements of CFC-11 and CFC-12 in air samples collected along the cruise tracks are also included in the report. Data from the report are also available from the authors in digital format
Olsen, Svein Ottar; Tuu, Ho Huy
2017-09-01
This study uses the subscales of Consideration of Future Consequences (CFC) to explore the effects of future (CFC-future) and immediate (CFC-immediate) on convenience food consumption among teenagers in Vietnam. Furthermore, we investigate the mediating and dual role of hedonic and healthy eating values in the relationships between CFCs and convenience food consumption. Survey data from 451 teenagers in Central Vietnam and structural equation modelling were used to test the relationships in a proposed theoretical model. The results indicate that while CFC-immediate and hedonic eating value has a positive direct effect, CFC-future and healthy eating value has a negative direct effect on convenience food consumption. The findings also reveal that both CFC-immediate and CFC-future have positive effects on hedonic and healthy eating values. However, this study argues and tests the relative importance of the direct (asymmetric) effects of time perspectives on eating values, and finds that while CFC-future dominate in explaining healthy eating values, CFC-immediate dominate in explaining hedonic eating values. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Rao, S.V.S.; Lal, K.B.; Ahmed, J.; Narasimhan, S.V.
1999-01-01
A method has been developed for the removal of cesium from the aqueous radioactive waste using a composite ion-exchanger consisting of Copper-Ferrocyanide Powder (CFC) and Polyurethane (PU) Foam. Polyvinyl acetate has been used as a binder in the preparation of CFC-PU foam. The physical properties of CFC such as density, surface area, IR stretching frequency and lattice parameters have been evaluated and also its potassium and copper(II) content have been estimated. Optimization of loading of CFC on PU foam has been studied. The CFC-PU was viewed under microscope to find out the homogeneity of distribution. Exchange capacities of the CFC-PU foam in different media have been determined and column studies have been carried out. Studies have been undertaken on extraction of cesium from CFC foam and also on digestion of spent CFC-PU foam and immobilization of digested solution in cement matrix. The cement matrices have been characterized with respect to density, bio-resistance and leaching resistance. (author)
Flow boiling test of GDP replacement coolants
International Nuclear Information System (INIS)
Park, S.H.
1995-01-01
The tests were part of the CFC replacement program to identify and test alternate coolants to replace CFC-114 being used in the uranium enrichment plants at Paducah and Portsmouth. The coolants tested, C 4 F 10 and C 4 F 8 , were selected based on their compatibility with the uranium hexafluoride process gas and how well the boiling temperature and vapor pressure matched that of CFC-114. However, the heat of vaporization of both coolants is lower than that of CFC-114 requiring larger coolant mass flow than CFC-114 to remove the same amount of heat. The vapor pressure of these coolants is higher than CFC-114 within the cascade operational range, and each coolant can be used as a replacement coolant with some limitation at 3,300 hp operation. The results of the CFC-114/C 4 F 10 mixture tests show boiling heat transfer coefficient degraded to a minimum value with about 25% C 4 F 10 weight mixture in CFC-114 and the degree of degradation is about 20% from that of CFC-114 boiling heat transfer coefficient. This report consists of the final reports from Cudo Technologies, Ltd
International Nuclear Information System (INIS)
Di Pietro, E.; Visca, E.; Orsini, A.; Sacchetti, M.; Borruto, T.M.R.; Varone, P.; Vesprini, R.
1995-01-01
The design of plasma-facing components for ITER, as for any of the envisaged next-step machines, relies heavily on the use of brazed junctions to couple armour materials to the heat sink and cooling tubes. Moreover, the typical number of brazed components and the envisaged effects of local overheating due to failure in a single brazed junction stress the importance of having a set of NDE techniques developed that can ensure the flawless quality of the joint. The qualification and application of two NDE techniques (ultrasonic and thermographic analysis) for inspection of CFC-to-metal joints is described with particular regard to the annular geometry typical of macroblock/monoblock solutions for divertor high-heat-flux components. The results of the eddy current inspection are not reported. The development has been focused specifically on the joint between carbon-fiber composite and TZM molybdenum alloy; techniques for the production of reference defect samples have been devised and a set of reference defect samples produced. The comparative results of the NDE inspections are reported and discussed, also on the basis of the destructive examination of the samples. The nature and size of relevant and detectable defects are discussed together with hints for a possible NDE strategy for divertor high-heat-flux components
26 CFR 52.4682-3 - Imported taxable products.
2010-04-01
... Electronic integrated circuits and microassemblies 8542 CFC-113 0.0002 Signal generators 8543.20 CFC-113 0.6518 Avionics 8543.90.40 CFC-113 0.915 Signal generators subassemblies 8543.90.80 CFC-113 0.1265...:CORP:T:R (Imported Products Table), room 5228, Washington, DC 20044. (4) Public inspection and copying...
Groundwater recharge and flow on Montserrat, West Indies: Insights from groundwater dating
Directory of Open Access Journals (Sweden)
Brioch Hemmings
2015-09-01
New hydrological insights: δ2H and δ18O analysis indicates uniform recharge elevations for groundwaters on Montserrat. CFC-11 and CFC-12 analysis reveals age differences between isotopically similar, high elevation springs and low elevation aquifer waters. Low CFC concentrations within a confined low elevation aquifer suggest water ages of ∼45 years. High CFC concentrations in the northern and western springs are explained by rapid infiltration of cool (high CFC concentration rainfall into saturated compartments, with flow through the vadose zone to the phreatic zone dominated by compartment flow. Lower CFC concentrations in a number of aligned warmer springs suggest a contribution from older, warmer waters from depth. Temperatures and CFC concentrations indicate older component supply rates of up to 8 L/s to the highest yielding spring on Centre Hills, with contributions of up to 75% in the warmest spring waters.
2010-04-01
... exchange for $10x of CFC stock and $90x cash. US2's transfer of its stock to CFC is described in section 351, US2 recognizes no gain in the exchange under section 1032(a), and CFC's basis in the US2 stock acquired in the exchange is determined under section 362(a). (ii) Analysis. The US2 stock acquired by CFC...
International Nuclear Information System (INIS)
Kim, Sun-Kyung; Mehran, Muhammad Taqi; Mushtaq, Usman; Lim, Tak-Hyoung; Lee, Jong-Won; Lee, Seung-Bok; Park, Seok-Joo; Song, Rak-Hyun
2016-01-01
Highlights: • The addition of K_2CO_3 catalyst in carbon fuel improves the performance of SO-CFC. • Thermal and electrochemical analyses done to elucidate the catalytic enhancement. • Material characterization of SO-CFC performed after long-term degradation test. - Abstract: A solid oxide carbon fuel cell (SO-CFC) integrated with a dry gasifier was operated on activated carbon fuel and the effect of adding a reverse Boudouard gasification catalyst on the performance and long-term operation characteristics of the SO-CFC was investigated. The reactivity of the carbon fuels for the Boudouard gasification reaction was analyzed by a thermal analysis at various operating conditions. The SO-CFC was then operated on gasified fuel gas consisting of CO_2 and CO obtained from the integrated dry gasifier. The SO-CFC operated on activated carbon fuel with 5 wt.% K_2CO_3 achieved a maximum power density of 202, 262, and 271 mW/cm"2 at 750, 800, and 850 °C, respectively; the SO-CFC fueled with activated carbon fuel without a catalyst meanwhile yielded maximum power density of 168 mW/cm"2 at 850 °C. By using electrochemical impedance spectroscopy, the effect of adding the catalyst on the gasification products and subsequently on the performance of the SO-CFC was studied. A long-term degradation test was conducted by continuously operating the SO-CFC at 50 mA/cm"2 for 518 h at 750 °C. During the long-term degradation test, the average degradation rate of the SO-CFC was found to be 183 mV/kh. The post-mortem SEM and XRD analyses of the SO-CFC after the long-term test revealed the presence of carbon deposits and oxidation of Ni at the anode, causing a relatively higher degree of degradation in the SO-CFC integrated with the dry gasifier during the long-term operation. The addition of the K_2CO_3 based dry gasification catalyst significantly enhances the performance of the SO-CFC integrated with dry gasification, but during long-term operation, the degradation rate is found
Zhao, Xiaoquan; Nan, Xiaoli; Iles, Irina Alexandra; Yang, Bo
2015-01-01
This research examines the influence of temporal framing (long-term vs. short-term) and individual difference in consideration of future consequences (CFC) on the effectiveness of cigarette health warnings among smokers and at-risk nonsmokers in a college population. An online experiment (N = 395) revealed a three-way interaction among temporal framing, CFC, and smoking status. The results among at-risk nonsmokers supported the temporal fit hypothesis--those high in CFC responded more favorably to long-term framing, whereas those low in CFC responded more positively to short-term framing. The findings among smokers revealed a different pattern in which short-term framing was more effective among high-CFC smokers, whereas among low-CFC smokers the framing effect was not distinct. Theoretical and practical implications of the findings are discussed.
Anderson, Frank; Donkor, Peter; de Vries, Raymond; Appiah-Denkyira, Ebenezer; Dakpallah, George Fidelis; Rominski, Sarah; Hassinger, Jane; Lou, Airong; Kwansah, Janet; Moyer, Cheryl; Rana, Gurpreet K; Lawson, Aaron; Ayettey, Seth
2014-08-01
The potential of international academic partnerships to build global capacity is critical in efforts to improve health in poorer countries. Academic collaborations, however, are challenged by distance, communication issues, cultural differences, and historical context. The Collaborative Health Alliance for Reshaping Training, Education, and Research project (funded by the Bill and Melinda Gates Foundation and implemented through academic medicine and public health and governmental institutions in Michigan and Ghana) took a prospective approach to address these issues. The project had four objectives: to create a "charter for collaboration" (CFC), to improve data-driven policy making, to enhance health care provider education, and to increase research capacity. The goal of the CFC was to establish principles to guide the course of the technical work. All participants participated at an initial conference in Elmina, Ghana. Nine months later, the CFC had been revised and adopted. A qualitative investigation of the CFC's effects identified three themes: the CFC's unique value, the influence of the process of creating the CFC on patterns of communication, and the creation of a context for research and collaboration. Creating the CFC established a context in which implementing technical interventions became an opportunity for dialogue and developing a mutually beneficial partnership. To increase the likelihood that research results would be translated into policy reforms, the CFC made explicit the opportunities, potential problems, and institutional barriers to be overcome. The process of creating a CFC and the resulting document define a new standard in academic and governmental partnerships.
Activation of human natural killer cells by the soluble form of cellular prion protein
Energy Technology Data Exchange (ETDEWEB)
Seong, Yeon-Jae [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Hafis Clinic, Seoul (Korea, Republic of); Sung, Pil Soo; Jang, Young-Soon; Choi, Young Joon [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Bum-Chan [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Park, Su-Hyung [Laboratory of Translational Immunology and Vaccinology, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Young Woo [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Shin, Eui-Cheol, E-mail: ecshin@kaist.ac.kr [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of)
2015-08-21
Cellular prion protein (PrP{sup C}) is widely expressed in various cell types, including cells of the immune system. However, the specific roles of PrP{sup C} in the immune system have not been clearly elucidated. In the present study, we investigated the effects of a soluble form of recombinant PrP{sup C} protein on human natural killer (NK) cells. Recombinant soluble PrP{sup C} protein was generated by fusion of human PrP{sup C} with the Fc portion of human IgG{sub 1} (PrP{sup C}-Fc). PrP{sup C}-Fc binds to the surface of human NK cells, particularly to CD56{sup dim} NK cells. PrP{sup C}-Fc induced the production of cytokines and chemokines and the degranulation of granzyme B from NK cells. In addition, PrP{sup C}-Fc facilitated the IL-15-induced proliferation of NK cells. PrP{sup C}-Fc induced phosphorylation of ERK-1/2 and JNK in NK cells, and inhibitors of the ERK or the JNK pathways abrogated PrP{sup C}-Fc-induced cytokine production in NK cells. In conclusion, the soluble form of recombinant PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways. - Highlights: • Recombinant soluble PrP{sup C} (PrP{sup C}-Fc) was generated by fusion of human PrP{sup C} with IgG1 Fc portion. • PrP{sup C}-Fc protein induces the production of cytokines and degranulation from human NK cells. • PrP{sup C}-Fc protein enhances the IL-15-induced proliferation of human NK cells. • PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways.
MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR
The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...
The effects of temporal perspective on college students' energy drink consumption.
Kim, Jarim; Anagondahalli, Deepa
2017-09-01
Consideration of future consequences (CFC) describes the extent to which individuals consider potential future outcomes of their present behaviors. This personality trait has been found to predict repetitive health behaviors. Research is yet to explore the role of health beliefs, which may mediate the relationship between CFC and self-directed health behaviors. Thus, this study examined how CFC affects energy drink-related health beliefs and consumption behavior. A cross-sectional correlational online survey with 1,050 college students was conducted. Key measures include the CFC Scale, health belief measures, and current energy drink consumption pattern. CFC was associated with energy drink consumption as well as several health beliefs. CFC had indirect effects on energy drink consumption through health beliefs, including perceived severity of consuming energy drinks (indirect effect estimate = -.191, 95% confidence interval [CI] [-.271, -.122]), perceived benefits of avoiding energy drinks (indirect effect estimate = -.108, 95% CI [-.174, -.050]), and perceived barriers in abstaining from energy drinks (energy level-related barriers, indirect effect estimate = -.274, 95% CI [-.387, -.181]; and socialization-related barriers, indirect effect estimate = .152, 95% CI [.078, .249]). As the first study to examine CFC's indirect effects on a self-directed health behavior through health beliefs, this study extended CFC's applicability by examining its role in the context of college students' energy drink consumption. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Energy Technology Data Exchange (ETDEWEB)
Happell, J.D.; Wallace, D.W.R.; Wills, K.D.; Wilke, R.J.; Neill, C.C.
1996-06-01
This report describes an automated, accurate, precise and sensitive capillary column purge- and -trap method capable of quantifying CFC-12, CFC-11, CFC-113, CH{sub 3}CCL{sub 3}, and CCL{sub 4} during a single chromatographic analysis in either water or gas phase samples.
Chapter 12. Sampling and analytical methods
International Nuclear Information System (INIS)
Busenberg, E.; Plummer, L.N.; Cook, P.G.; Solomon, D.K.; Han, L.F.; Groening, M.; Oster, H.
2006-01-01
When water samples are taken for the analysis of CFCs, regardless of the sampling method used, contamination of samples by contact with atmospheric air (with its 'high' CFC concentrations) is a major concern. This is because groundwaters usually have lower CFC concentrations than those waters which have been exposed to the modern air. Some groundwaters might not contain CFCs and, therefore, are most sensitive to trace contamination by atmospheric air. Thus, extreme precautions are needed to obtain uncontaminated samples when groundwaters, particularly those with older ages, are sampled. It is recommended at the start of any CFC investigation that samples from a CFC-free source be collected and analysed, as a check upon the sampling equipment and methodology. The CFC-free source might be a deep monitoring well or, alternatively, CFC-free water could be carefully prepared in the laboratory. It is especially important that all tubing, pumps and connection that will be used in the sampling campaign be checked in this manner
2010-07-01
... demonstrate it can be used safely in this end-use. CFC-12 Motor Vehicle Air Conditioners (Retrofit and New... Conditions Application Substitute Decision Conditions Comments CFC-12 Automobile Motor Vehicle Air... refrigerant. CFC-12 Automobile Motor Vehicle Air Conditioning (New equipment only) R-152a as a substitute for...
2010-07-01
... safely in this end-use. CFC-12, motor vehicle air conditioners (retrofit) HCFC-22/HFC-142b/CFC-12... to demonstrate it can be used safely in this end-use. CFC-12, motor vehicle air conditioners (new... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) PROTECTION OF STRATOSPHERIC OZONE...
Katz, Brian G.; Lee, Terrie M.; Plummer, L. Niel; Busenberg, Eurybiades
1995-06-01
Leakage from sinkhole lakes significantly influences recharge to the Upper Floridan aquifer in poorly confined sediments in northern Florida. Environmental isotopes (oxygen 18, deuterium, and tritium), chlorofluorocarbons (CFCs: CFC-11, CCl3F; CFC-12, CCl2F2; and CFC-113, C2Cl3F3), and solute tracers were used to investigate groundwater flow patterns near Lake Barco, a seepage lake in a mantled karst setting in northern Florida. Stable isotope data indicated that the groundwater downgradient from the lake contained 11-67% lake water leakage, with a limit of detection of lake water in groundwater of 4.3%. The mixing fractions of lake water leakage, which passed through organic-rich sediments in the lake bottom, were directly proportional to the observed methane concentrations and increased with depth in the groundwater flow system. In aerobic groundwater upgradient from Lake Barco, CFC-modeled recharge dates ranged from 1987 near the water table to the mid 1970s for water collected at a depth of 30 m below the water table. CFC-modeled recharge dates (based on CFC-12) for anaerobic groundwater downgradient from the lake ranged from the late 1950s to the mid 1970s and were consistent with tritium data. CFC-modeled recharge dates based on CFC-11 indicated preferential microbial degradation in anoxic waters. Vertical hydraulic conductivities, calculated using CFC-12 modeled recharge dates and Darcy's law, were 0.17, 0.033, and 0.019 m/d for the surficial aquifer, intermediate confining unit, and lake sediments, respectively. These conductivities agreed closely with those used in the calibration of a three-dimensional groundwater flow model for transient and steady state flow conditions.
Energy Technology Data Exchange (ETDEWEB)
Chi, Jing-Qi; Shang, Xiao [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liang, Fei [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Dong, Bin, E-mail: dongbin@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Li, Xiao; Liu, Yan-Ru; Yan, Kai-Li [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Gao, Wen-Kun [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); College of Science, China University of Petroleum (East China), Qingdao 266580 (China); Chai, Yong-Ming [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China); Liu, Chen-Guang, E-mail: cgliu@upc.edu.cn [State Key Laboratory of Heavy Oil Processing, China University of Petroleum (East China), Qingdao 266580 (China)
2017-04-15
Highlights: • Binary pyrite-type Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}/CFC was prepared by a facile two-step process. • The effect of Ni/Fe (Ni{sub x}Fe{sub 1-x}Se{sub 2} x = 0, 0.2, 0.5, 0.8, 1) on OER was investigated. • Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}/CFC (x = 0.5) possesses the better electrocatalytic activity for OER. • The enhanced activity may be attributed to binary Ni{sub 0.5}Fe{sub 0.5}Se{sub 2} and CFC support. - Abstract: Pyrite-type binary nickel iron diselenides (Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}) supported on carbon fiber cloth (CFC) as electrocatalysts for oxygen evolution reaction (OER) have been prepared by a facile two-step process. Firstly, binary Ni{sub 0.5}Fe{sub 0.5} hydroxide nanosheets have been electrodeposited on CFC. Secondly, a solvothermal selenization process has been used to convert Ni{sub 0.5}Fe{sub 0.5}/CFC into Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}/CFC. XRD shows that Ni{sub 0.5}Fe{sub 0.5}Se{sub 2} on CFC has the typically octahedral crystalline. XPS proves the existence and valence of Ni, Fe and Se. SEM images show that Ni{sub 0.5}Fe{sub 0.5}Se{sub 2} has novel pyrite-type octahedral morphology with uniform size and good dispersion on the surface of CFC. SEM elemental mapping images confirm the good distribution of Ni, Fe, Se element on CFC. TEM and SAED provide the clear diffraction rings of octahedral Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}, which is consistent with the results of XRD. Furtherly, the effect of different ratio of Ni/Fe (Ni{sub x}Fe{sub 1-x}Se{sub 2} x = 0, 0.2, 0.5, 0.8, 1) on OER performances has been systematically investigated. The electrochemical measurements results show that Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}/CFC (x = 0.5) possesses the better electrocatalytic activity with the lower overpotential, Tafel slope and long-term stability than other samples. The enhanced activity of Ni{sub 0.5}Fe{sub 0.5}Se{sub 2}/CFC may be attributed to the intrinsic activity of binary Ni{sub 0.5}Fe{sub 0.5}Se{sub 2} and faster electron
Effect of low-dose irradiation on pregnant mouse haemopoiesis
International Nuclear Information System (INIS)
Weinberg, S.R.; McCarthy, E.G.; MacVittie, T.J.; Baum, S.J.
1981-01-01
The effects of low-dose gamma radiation to haemopoietic progenitor cell compartments of the marrow and spleen of virgin female mice and pregnant mice were studied. Microplasma clot cultures were used to assess burst-forming uniterythroid (BFU-E) and colony-forming unit-erythroid (CFU-E) activity, and double-layer agar cultures were established to evaluate granulocyte-macrophage colony-forming cell (GM-CFC) and macrophage colony-forming cell (M-CFC). The apparent shift in maternal erythropoiesis from the bone marrow to the enlarged spleen was reflected by an increase in CFU-E and BFU-E per spleen and a concomitant decrease in CFU-E and BFU-E per femur. Whereas maternal GM-CFC values per femur increased 36%, maternal GM-CFC per spleen increased by 172% compared to virgin values. Total-body irradiation to the day-10.5 pregnant mouse caused a further suppression of day-14.5 medullary erythropoiesis (i.e. decreased CFU-E values) compared to the virgin female mouse. An ability of the maternal spleen to support further compensatory erythropoiesis following increasing doses of radiation was demonstrated. Four days after 1.0 Gy exposure, maternal values for GM-CFC per femur or spleen decreased to nonirradiated virgin mice values. M-CFC per maternal femur decreased to nonirradiated virgin mice values. M-CFC per maternal femur decreased following 1.5 Gy, but M-CFC per spleen appeared to be unaffected with doses from 0.5 to 2.0 Gy. (author)
Single-step brazing process for mono-block joints and mechanical testing
Energy Technology Data Exchange (ETDEWEB)
Casalegno, V.; Ferraris, M.; Salvo, M.; Rizzo, S. [Politecnico di Torino, Materials Science and Chemical Engineering Dept., Torino (Italy); Merola, M. [ITER International Team, llER Joint Work Site, Cadarache, 13 - St Paul Lez Durance (France)
2007-07-01
Full text of publication follows: Plasma facing components act as actively cooled thermal shields to sustain thermal and particle loads during normal and transient operations in ITER (International Thermonuclear Experimental Reactor). The plasma-facing layer is referred to as 'armour', which is made of either carbon fibre reinforced carbon composite (CFC) or tungsten (W). CFC is the reference design solution for the lower part of the vertical target of the ITER divertor. The armour is joined onto an actively cooled substrate, the heat sink, made of precipitation hardened copper alloy CuCrZr through a thin pure copper interlayer to decrease, by plastic deformation, the joint interface stresses; in fact, the CFC to Cu joint is affected by the CTE mismatch between the ceramic and metallic material. A new method of joining CFC to copper and CFC/Cu to CuCrZr alloy was effectively developed for the flat-type configuration; the feasibility of this process also for mono-block geometry and the development of a procedure for testing mono-block-type mock-ups is described in this work. The mono-block configuration consists of copper alloy pipe shielded by CFC blocks. It is worth noting that in mono-block configuration, the large thermal expansion mismatch between CFC and copper alloy is more significant than for flat-tile configuration, due to curved interfaces. The joining technique foresees a single-step brazing process: the brazing of the three materials (CFC-Cu-CuCrZr) can be performed in a single heat treatment using the same Cu/Ge based braze. The composite surface was modified by solid state reaction with chromium with the purpose of increasing the wettability of CFC by the brazing alloy. The CFC substrate reacts with Cr which, forming a carbide layer, allows a large reduction of the contact angle; then, the brazing of CFC to pure copper and pure copper to CuCrZr by the same treatment is feasible. This process allows to obtain good joints using a non
Single-step brazing process for mono-block joints and mechanical testing
International Nuclear Information System (INIS)
Casalegno, V.; Ferraris, M.; Salvo, M.; Rizzo, S.; Merola, M.
2007-01-01
Full text of publication follows: Plasma facing components act as actively cooled thermal shields to sustain thermal and particle loads during normal and transient operations in ITER (International Thermonuclear Experimental Reactor). The plasma-facing layer is referred to as 'armour', which is made of either carbon fibre reinforced carbon composite (CFC) or tungsten (W). CFC is the reference design solution for the lower part of the vertical target of the ITER divertor. The armour is joined onto an actively cooled substrate, the heat sink, made of precipitation hardened copper alloy CuCrZr through a thin pure copper interlayer to decrease, by plastic deformation, the joint interface stresses; in fact, the CFC to Cu joint is affected by the CTE mismatch between the ceramic and metallic material. A new method of joining CFC to copper and CFC/Cu to CuCrZr alloy was effectively developed for the flat-type configuration; the feasibility of this process also for mono-block geometry and the development of a procedure for testing mono-block-type mock-ups is described in this work. The mono-block configuration consists of copper alloy pipe shielded by CFC blocks. It is worth noting that in mono-block configuration, the large thermal expansion mismatch between CFC and copper alloy is more significant than for flat-tile configuration, due to curved interfaces. The joining technique foresees a single-step brazing process: the brazing of the three materials (CFC-Cu-CuCrZr) can be performed in a single heat treatment using the same Cu/Ge based braze. The composite surface was modified by solid state reaction with chromium with the purpose of increasing the wettability of CFC by the brazing alloy. The CFC substrate reacts with Cr which, forming a carbide layer, allows a large reduction of the contact angle; then, the brazing of CFC to pure copper and pure copper to CuCrZr by the same treatment is feasible. This process allows to obtain good joints using a non-active brazing
Plummer, Niel; Busenberg, E.; Drenkard, S.; Schlosser, P.; Ekwurzel, B.; Weppernig, R.; McConnell, J.B.; Michel, R.L.
1998-01-01
Tritium/helium-3 (3H/3He) and chlorofluorocarbon (CFCs, CFC-11, CFC-12, CFC-113) data are used to date the young fraction in groundwater mixtures from a karstic limestone aquifer near Valdosta, Georgia, where regional paleowater in the Upper Floridan aquifer receives recharge from two young sources the flow of Withlacoochee River water through sinkholes in the river bed, and leakage of infiltration water through post-Eocene semi-confining beds above the Upper Floridan aquifer. In dating the young fraction of mixtures using CFCs, it is necessary to reconstruct the CFC concentration that was in the young fraction prior to mixing. The 3H/3He age is independent of the extent of dilution with older (3H-free and 3He(trit)-free) water. The groundwater mixtures are designated as Type-I for mixtures of regional paleowater and regional infiltration water and Type-2 for mixtures containing more than approximately 4% of river water. The fractions of regional paleowater, regional infiltration water, and Withlacoochee River water in the groundwater mixtures were determined from Cl- and ??18O data for water from the Upper Floridan aquifer at Valdosta, Georgia The chlorofluorocarbons CFC-11 and CFC-113 are removed by microbial degradation and/or sorption processes in most allaerobic (Type-2) groundwater at Valdosta, but are present in some aerobic Type-I water. CFC-12 persists in both SO4-reducing and methanogenic water. The very low detection limits for CFCs (approximately 0.3 pg kg-1) permitted CFC-11 and CFC-12 dating of the fraction of regional infiltration water in Type-I mixtures, and CFC-12 dating of the river-water fraction in Type-2 mixtures. Overall, approximately 50% of the 85 water sam pies obtained from the Upper Floridan aquifer have CFC-12-based ages of the young traction that are consistent with the 3H concentration of the groundwater. Because of uncertainties associated with very low 3H and 3He content in dilute mixtures, 3H/3He dating is limited to the river
Energy Technology Data Exchange (ETDEWEB)
Chevet, G. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France)], E-mail: gaelle.chevet@cea.fr; Schlosser, J. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France); Martin, E.; Herb, V.; Camus, G. [Universite Bordeaux 1, UMR 5801 (CNRS-SAFRAN-CEA-UB1), Laboratoire des Composites Thermostructuraux, F-33600 Pessac (France)
2009-03-31
Plasma facing components (PFCs) of magnetic fusion machines have high manufactured residual stresses and have to withstand important stress ranges during operation. These actively cooled PFCs have a carbon fibre composite (CFC) armour and a copper alloy heat sink. Cracks mainly appear in the CFC near the composite/copper interface. In order to analyse damage mechanisms, it is important to well simulate the damage mechanisms both of the CFC and the CFC/Cu interface. This study focuses on the mechanical behaviour of the N11 material for which the scalar ONERA damage model was used. The damage parameters of this model were identified by similarity to a neighbour material, which was extensively analysed, according to the few characterization test results available for the N11. The finite elements calculations predict a high level of damage of the CFC at the interface zone explaining the encountered difficulties in the PFCs fabrication. These results suggest that the damage state of the CFC cells is correlated with a conductivity decrease to explain the temperature increase of the armour surface under fatigue heat load.
Chevet, G.; Schlosser, J.; Martin, E.; Herb, V.; Camus, G.
2009-03-01
Plasma facing components (PFCs) of magnetic fusion machines have high manufactured residual stresses and have to withstand important stress ranges during operation. These actively cooled PFCs have a carbon fibre composite (CFC) armour and a copper alloy heat sink. Cracks mainly appear in the CFC near the composite/copper interface. In order to analyse damage mechanisms, it is important to well simulate the damage mechanisms both of the CFC and the CFC/Cu interface. This study focuses on the mechanical behaviour of the N11 material for which the scalar ONERA damage model was used. The damage parameters of this model were identified by similarity to a neighbour material, which was extensively analysed, according to the few characterization test results available for the N11. The finite elements calculations predict a high level of damage of the CFC at the interface zone explaining the encountered difficulties in the PFCs fabrication. These results suggest that the damage state of the CFC cells is correlated with a conductivity decrease to explain the temperature increase of the armour surface under fatigue heat load.
International Nuclear Information System (INIS)
Chevet, G.; Schlosser, J.; Martin, E.; Herb, V.; Camus, G.
2009-01-01
Plasma facing components (PFCs) of magnetic fusion machines have high manufactured residual stresses and have to withstand important stress ranges during operation. These actively cooled PFCs have a carbon fibre composite (CFC) armour and a copper alloy heat sink. Cracks mainly appear in the CFC near the composite/copper interface. In order to analyse damage mechanisms, it is important to well simulate the damage mechanisms both of the CFC and the CFC/Cu interface. This study focuses on the mechanical behaviour of the N11 material for which the scalar ONERA damage model was used. The damage parameters of this model were identified by similarity to a neighbour material, which was extensively analysed, according to the few characterization test results available for the N11. The finite elements calculations predict a high level of damage of the CFC at the interface zone explaining the encountered difficulties in the PFCs fabrication. These results suggest that the damage state of the CFC cells is correlated with a conductivity decrease to explain the temperature increase of the armour surface under fatigue heat load
Performance analysis of the electric vehicle air conditioner by replacing hydrocarbon refrigerant
Santoso, Budi; Tjahjana, D. D. D. P.
2017-01-01
The thermal comfort in passenger cabins needs an automotive air-conditioning system. The electric vehicle air conditioner system is driven by an electric compressor which includes a compressor and an electric motor. Almost air-conditioning system uses CFC-12, CFC-22 and HFC-134a as refrigerant. However, CFC-12 and CFC-22 will damage the ozone layer. The extreme huge global warming potentials (GWP) values of CFC-12, CFC-22, and HFC-134a represent the serious greenhouse effect of Earth. This article shows new experimental measurements and analysis by using a mixture of HC-134 to replace HFC-134a. The result is a refrigerating effect, the coefficient of performance and energy factor increase along with cooling capacity, both for HFC-134a and HC-134. The refrigerating effect of HC-134 is almost twice higher than HFC-134a. The coefficient of performance value of HC-134 is also 36.42% greater than HFC-134a. Then, the energy factor value of HC-134 is 3.78% greater than HFC-134a.
International Nuclear Information System (INIS)
Chevet, G; Schlosser, J; Courtois, X; Escourbiac, F; Missirlian, M; Herb, V; Martin, E; Camus, G; Braccini, M
2009-01-01
In order to predict the lifetime of carbon fibre composite (CFC) armoured plasma-facing components in magnetic fusion devices, it is necessary to analyse the damage mechanisms and to model the damage propagation under cycling heat loads. At Tore Supra studies have been launched to better understand the damage process of the armoured flat tile elements of the actively cooled toroidal pump limiter, leading to the characterization of the damageable mechanical behaviour of the used N11 CFC material and of the CFC/Cu bond. Up until now the calculations have shown damage developing in the CFC (within the zone submitted to high shear stress) and in the bond (from the free edge of the CFC/Cu interface). Damage is due to manufacturing shear stresses and does not evolve under heat due to stress relaxation. For the ITER divertor, NB31 material has been characterized and the characterization of NB41 is in progress. Finite element calculations show again the development of CFC damage in the high shear stress zones after manufacturing. Stresses also decrease under heat flux so the damage does not evolve. The characterization of the CFC/Cu bond is more complex due to the monoblock geometry, which leads to more scattered stresses. These calculations allow the fabrication difficulties to be better understood and will help to analyse future high heat flux tests on various mock-ups.
Evaluation of the Erosion on the CFC tiles of the ITER Divertor by means o f FE calculations
International Nuclear Information System (INIS)
Schlosser, J.; Bouvet, J.; Riccardi, B.
2007-01-01
Full text of publication follows: The vertical target of the ITER divertor is armoured with Carbon Fibre Composite (CFC) mono-blocks in the lower part. This part is subjected to the maximum power and particles loads and, consequently, has a risk of high erosion and a significant risk of failure. In order to calculate the erosion during operation an original methodology has been developed using the CASTEM CEA finite element code. The calculation is based on a series of steady states the mesh being updated at each step of the iteration taking into account the rate of erosion between two steps. The model was developed thanks to the routines developed 10 years ago for the toroidal pump limiter of Tore Supra and takes into account shadowing effect and possible penetration of power into the gap between two mono-blocks. Both physical and chemical sputtering together with sublimation have been included in the code to describe the loss of material by the thermal and particle loads envisaged for ITER normal operation regime. This model has been validated by comparison with analytical or other code results. As erosion instability in normal operation in case of one faulty mono-block besides good ones due to the balanced rate between the various erosion mechanisms at different temperatures can be expected, coherent plasma parameters, which represent the worse cases of erosion in normal operation, have been taken into account to analyse the erosion behaviour of the mono-blocks. The aim of the study was also to evaluate the influence of a mono-block defect on erosion behaviour and the impact of these phenomena on the mono-block acceptance criteria. The calculations have pointed out the occurrence of some erosion instabilities for the studied cases (neighbour mono-block with reduced conductivity or with 90 deg. defects). Moreover it was shown that, when applying 20 MW/m 2 to the erosion model already subjected to the normal condition loads for 10,000 s, the plasma shaping of the
Gastrointestinal and renal abnormalities in cardio-facio-cutaneous syndrome
Energy Technology Data Exchange (ETDEWEB)
Herman, Thomas E.; McAlister, William H. [Washington University School of Medicine, St. Louis Children' s Hospital, Mallinckrodt Institute of Radiology, St. Louis, MO (United States)
2005-02-01
Cardio-facio-cutaneous syndrome (CFC) is an uncommon autosomal recessive condition recently distinguished from Noonan syndrome but with more marked growth failure and ectodermal dysplasia. Abdominal symptoms are frequently described but anatomic lesions in CFC have rarely been described. We have found significant anatomic abnormalities in CFC patients including antral foveolar hyperplasia, severe constipation with fecal impaction, nephrocalcinosis and renal cysts. (orig.)
Gastrointestinal and renal abnormalities in cardio-facio-cutaneous syndrome
International Nuclear Information System (INIS)
Herman, Thomas E.; McAlister, William H.
2005-01-01
Cardio-facio-cutaneous syndrome (CFC) is an uncommon autosomal recessive condition recently distinguished from Noonan syndrome but with more marked growth failure and ectodermal dysplasia. Abdominal symptoms are frequently described but anatomic lesions in CFC have rarely been described. We have found significant anatomic abnormalities in CFC patients including antral foveolar hyperplasia, severe constipation with fecal impaction, nephrocalcinosis and renal cysts. (orig.)
Portuguese Validation of the Consideration of Future Consequences Scale.
Echeverría, Alejandro Vásquez; Esteves, Cristina; Gomes, Catarina Vilares; Ortuño, Victor E C
2015-03-11
The Consideration of Future Consequences Scale (CFC-S) is a measure of the extent to which individuals reflect and are influenced by the immediate as well as by the distant outcomes of current behavior. It's composed by 12 items, grouped into two subscales (future and immediate). This study aims to explore the factor structure, psychometric properties and construct validity of the Portuguese version of the CFC-S in 5 samples, composed by 527 participants with ages between 13 and 71. A 2 factor structure has been found through Confirmatory Factor Analysis among several tested models. Item 5 has been eliminated in order to achieve better fit indices (χ2 df = 3.88, CFI = .90, GFI = .95, RMSEA = .07) and improve internal consistency. Both CFC subscales presented strong correlations with several psychological phenomena (Sensation Seeking, Self-Esteem, Temporal Extension and Time Perspective) and main effects among groups of age and criminal record (for CFC-I, p < .001, for CFC-F, p < .001). These results allow us to support CFC as an efficient psychological evaluation instrument and as an important metric for individual differences in the study of temporal orientation.
International Nuclear Information System (INIS)
von Melchner, H.; Lieschke, G.J.
1981-01-01
The regeneration of hemopoietic precursor cells (colony-forming cells, CFC) was monitored in spleen organ cultures from lethally irradiated mice injected with 10(7) normal syngeneic or allogeneic bone marrow cells. The important role of the microenvironment in supporting hemopoiesis was confirmed by the failure of mutant S1/S1d spleens to support CFC regeneration in organ cultures. However, the extent and quality of the CFC regeneration was clearly dependent on the genetic properties of the injected cells. Evidence for this was obtained from the regeneration patterns of various CFC types in organ cultured spleens derived from different mouse donor-recipient strain combinations (CBA/CBA, CBA/C57BL, CBA/BALB/c, C57BL/C57BL, C57BL/CBA, C57BL/BALB/c) that maintained the differences in the bone marrow frequency of various CFC types characteristic of the donor strain
Features of the closure of the nuclear fuel cycle in Russia
International Nuclear Information System (INIS)
Glebov, A.P.; Klushin, A.V.; Baranaev, Yu.D.
2014-01-01
The strategy for the development of nuclear energy and a closed fuel cycle (CFC) in such foreign countries as China, France, India, Japan, Korea, as well as the features of the development of nuclear energy and CFC in Russia is discussed. When using the BN and BREST reactors are not solved all the problems with CFC. The introduction of the WWER-SCP reactor will help solve problems with CFC. Improving the economy, the implementation of a deep burning of minor actinides, a significant reduction in nuclear hazardous work, the use of the produced during the processing of spent nuclear fuel (U+Pu) - prospects for using WWER-SCP [ru
Energy Technology Data Exchange (ETDEWEB)
Plummer, L.N.; Busenberg, E. [U.S. Geological Survey, 432 National Center, Reston, VA (United States); Drenkard, S.; Schlosser, P.; Ekwurzel, B.; Weppernig, R. [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9W, Palisades, NY (United States); McConnell, J.B. [U.S. Geological Survey, 3039 Amwiler Rd., Atlanta, GA (United States); Michel, R.L. [U.S. Geological Survey, Mail Stop 434, 345 Middlefield Road, Menlo Park, CA (United States)
1998-11-01
Tritium/helium-3 ({sup 3}H/{sup 3}He) and chlorofluorocarbon (CFCs, CFC-11, CFC-12, CFC-113) data are used to date the young fraction in groundwater mixtures from a karstic limestone aquifer near Valdosta, Georgia, where regional paleowater in the Upper Floridan aquifer receives recharge from two young sources-the flow of Withlacoochee River water through sinkholes in the river bed, and leakage of infiltration water through post-Eocene semi-confining beds above the Upper Floridan aquifer. In dating the young fraction of mixtures using CFCs, it is necessary to reconstruct the CFC concentration that was in the young fraction prior to mixing. The {sup 3}H/{sup 3}He age is independent of the extent of dilution with older ({sup 3}H-free and {sup 3}He{sub trit}-free) water. The groundwater mixtures are designated as Type-1 for mixtures of regional paleowater and regional infiltration water and Type-2 for mixtures containing more than approximately 4% of river water. The fractions of regional paleowater, regional infiltration water, and Withlacoochee River water in the groundwater mixtures were determined from Cl{sup -} and {delta}{sup 18}O data for water from the Upper Floridan aquifer at Valdosta, Georgia.The chlorofluorocarbons CFC-11 and CFC-113 are removed by microbial degradation and/or sorption processes in most anaerobic (Type-2) groundwater at Valdosta, but are present in some aerobic Type-1 water. CFC-12 persists in both SO{sub 4}-reducing and methanogenic water. The very low detection limits for CFCs (approximately 0.3 pg kg{sup -1}) permitted CFC-11 and CFC-12 dating of the fraction of regional infiltration water in Type-1 mixtures, and CFC-12 dating of the river-water fraction in Type-2 mixtures. Overall, approximately 50% of the 85 water samples obtained from the Upper Floridan aquifer have CFC-12-based ages of the young fraction that are consistent with the {sup 3}H concentration of the groundwater. Because of uncertainties associated with very low {sup 3}H
International Nuclear Information System (INIS)
Plummer, L.N.; Busenberg, E.; Drenkard, S.; Schlosser, P.; Ekwurzel, B.; Weppernig, R.; McConnell, J.B.; Michel, R.L.
1998-01-01
Tritium/helium-3 ( 3 H/ 3 He) and chlorofluorocarbon (CFCs, CFC-11, CFC-12, CFC-113) data are used to date the young fraction in groundwater mixtures from a karstic limestone aquifer near Valdosta, Georgia, where regional paleowater in the Upper Floridan aquifer receives recharge from two young sources-the flow of Withlacoochee River water through sinkholes in the river bed, and leakage of infiltration water through post-Eocene semi-confining beds above the Upper Floridan aquifer. In dating the young fraction of mixtures using CFCs, it is necessary to reconstruct the CFC concentration that was in the young fraction prior to mixing. The 3 H/ 3 He age is independent of the extent of dilution with older ( 3 H-free and 3 He trit -free) water. The groundwater mixtures are designated as Type-1 for mixtures of regional paleowater and regional infiltration water and Type-2 for mixtures containing more than approximately 4% of river water. The fractions of regional paleowater, regional infiltration water, and Withlacoochee River water in the groundwater mixtures were determined from Cl - and δ 18 O data for water from the Upper Floridan aquifer at Valdosta, Georgia.The chlorofluorocarbons CFC-11 and CFC-113 are removed by microbial degradation and/or sorption processes in most anaerobic (Type-2) groundwater at Valdosta, but are present in some aerobic Type-1 water. CFC-12 persists in both SO 4 -reducing and methanogenic water. The very low detection limits for CFCs (approximately 0.3 pg kg -1 ) permitted CFC-11 and CFC-12 dating of the fraction of regional infiltration water in Type-1 mixtures, and CFC-12 dating of the river-water fraction in Type-2 mixtures. Overall, approximately 50% of the 85 water samples obtained from the Upper Floridan aquifer have CFC-12-based ages of the young fraction that are consistent with the 3 H concentration of the groundwater. Because of uncertainties associated with very low 3 H and 3 He content in dilute mixtures, 3 H/ 3 He dating is
Hirata, Riki; Matsumoto, Machiko; Judo, Chika; Yamaguchi, Taku; Izumi, Takeshi; Yoshioka, Mitsuhiro; Togashi, Hiroko
2009-07-01
Hippocampal long-term potentiation (LTP) is suppressed not only by stress paradigms but also by low frequency stimulation (LFS) prior to LTP-inducing high frequency stimulation (HFS; tetanus), termed metaplasticity. These synaptic responses are dependent on N-methyl-D-aspartate receptors, leading to speculations about the possible relationship between metaplasticity and stress-induced LTP impairment. However, the functional significance of metaplasticity has been unclear. The present study elucidated the electrophysiological and neurochemical profiles of metaplasticity in the hippocampal CA1 field, with a focus on the synaptic response induced by the emotional stress, contextual fear conditioning (CFC). The population spike amplitude in the CA1 field was decreased during exposure to CFC, and LTP induction was suppressed after CFC in conscious rats. The synaptic response induced by CFC was mimicked by LFS, i.e., LFS impaired the synaptic transmission and subsequent LTP. Plasma corticosterone levels were increased by both CFC and LFS. Extracellular levels of gamma-aminobutyric acid (GABA), but not glutamate, in the hippocampus increased during exposure to CFC or LFS. Furthermore, electrical stimulation of the medial prefrontal cortex (mPFC), which caused decreases in freezing behavior during exposure to CFC, counteracted the LTP impairment induced by LFS. These findings suggest that metaplasticity in the rat hippocampal CA1 field is related to the neural basis of stress experience-dependent fear memory, and that hippocampal synaptic response associated stress-related processes is under mPFC regulation.
Sputtering characteristics of B4C-overlaid graphite for keV energy deuterium ion irradiation
International Nuclear Information System (INIS)
Gotoh, Y.; Yamaki, T.; Ando, T.; Jimbou, R.; Ogiwara, N.; Saidoh, M.; Teruyama, K.
1992-01-01
Two types of B 4 C-overlaid graphite (CFC), conversion and CVD B 4 C, together with bare CFC (PCC-2S) and/or HP B 4 C, were investigated with respect to erosion yields for 1 keV D + , D 2 /CD 4 TDS after 1 keV D + implantation, and thermal diffusivity/conductivity, in a temperature range from 300 to 1400 K. The erosion yields of both conversion and CVD B 4 C were found to be much lower than that of the bare CFC (PCC-2S), in both chemical sputtering (600-1100 K) and RES (1200-1400 K) temperature regions. The D 2 TDS peak of the conversion B 4 C was found to be located at nearly 200 K lower temperature than that of the bare CFC (PCC-2S), indicating much lower activation energy for detrapping/recombination of trapped D in the conversion B 4 C and in the CFC. The CD 4 TDS peak of the conversion B 4 C was found to be much weaker in intensity than that of the bare CFC (PCC-2S), in agreement with the present erosion yield results. Thermal diffusivities and conductivities of both the conversion B 4 C/PCC-2S and the CVD B 4 C, were measured to be nearly 1/10 of that of the bare CFC (PCC-2S), and to decrease with increasing temperatures. (orig.)
International Nuclear Information System (INIS)
Broxmeyer, H.E.; Galbraith, P.R.; Baker, F.L.
1976-01-01
Suspensions of human bone marrow cells were subjected to 137 Cs irradiation in vitro and then cultured in semisolid agar medium. Cultures of irradiated cells were stimulated with colony-stimulating activity (CSA) of different potencies, and it was found that the amount of stimulation applied to cultures influenced the apparent kill of colony-forming cells (CFC). It was also found that the effects of irradiation on colony formation were not confined to CFC kill since medium conditioned by cells during irradiation exhibited stimulatory and inhibitory properties after treatment by 600 and 1000 rads, respectively. Studies in which irradiated cells were pretreated with hydroxyurea indicated that CFC in the DNA synthetic phase of the cell cycle were particularly sensitive to low doses of irradiation. The proliferative capacity of CFC surviving 1000 rads was undiminished as judged by their ability to form large colonies. Estimates of CFC kill by hydroxyurea were also affected by the level of CSA
Seffner, Fernando; Garcia, Jonathan; Muñoz-Laboy, Miguel; Parker, Richard
2011-01-01
The Casa Fonte Colombo (CFC) is a religious organisation that assists people living with HIV/AIDS (PLWHA). The funding for its activities comes from public sources such as the Brazilian National STD/AIDS Program as well as the Catholic Church. Capuchin (Franciscan) priests run the CFC and it has an extensive group of volunteers made up mostly of women. Between 2006 and 2009, we observed daily life at the CFC and interviewed priests, volunteers, employees, service providers, and clients. We also attended meetings, group sessions, and celebrations. Everyday actions carried out by the CFC reveal the efforts to resolve the tension between the position of the Catholic Church and the Brazilian state in the politics of AIDS. These efforts affirm that the CFC presents itself as a space where the position of the Catholic Church, as much as the politics of public health, are re-worked, giving way to a progressive act of Catholic prevention and assistance for AIDS that we call 'theology of prevention'.
ITER transient consequences for material damage: modelling versus experiments
International Nuclear Information System (INIS)
Bazylev, B; Janeschitz, G; Landman, I; Pestchanyi, S; Loarte, A; Federici, G; Merola, M; Linke, J; Zhitlukhin, A; Podkovyrov, V; Klimov, N; Safronov, V
2007-01-01
Carbon-fibre composite (CFC) and tungsten macrobrush armours are foreseen as PFC for the ITER divertor. In ITER the main mechanisms of metallic armour damage remain surface melting and melt motion erosion. In the case of CFC armour, due to rather different heat conductivities of CFC fibres a noticeable erosion of the PAN bundles may occur at rather small heat loads. Experiments carried out in the plasma gun facilities QSPA-T for the ITER like edge localized mode (ELM) heat load also demonstrated significant erosion of the frontal and lateral brush edges. Numerical simulations of the CFC and tungsten (W) macrobrush target damage accounting for the heat loads at the face and lateral brush edges were carried out for QSPA-T conditions using the three-dimensional (3D) code PHEMOBRID. The modelling results of CFC damage are in a good qualitative and quantitative agreement with the experiments. Estimation of the droplet splashing caused by the Kelvin-Helmholtz (KH) instability was performed
Cashman, J D; Clark-Lewis, I; Eaves, A C; Eaves, C J
1999-12-01
Nonobese diabetic/severe combined immunodeficient (NOD/SCID) mice transplanted with human cord blood or adult marrow cells and injected 6 weeks posttransplant with 2 daily doses of transforming growth factor-beta(1) (TGF-beta(1)), monocyte chemoattractant protein-1 (MCP-1), or a nonaggregating form of macrophage inflammatory protein-1alpha (MIP-1alpha) showed unique patterns of inhibition of human progenitor proliferation 1 day later. TGF-beta(1) was active on long-term culture initiating cells (LTC-IC) and on primitive erythroid and granulopoietic colony-forming cells (HPP-CFC), but had no effect on mature CFC. MCP-1 inhibited the cycling of both types of HPP-CFC but not LTC-IC. MIP-1alpha did not inhibit either LTC-IC or granulopoietic HPP-CFC but was active on erythroid HPP-CFC and mature granulopoietic CFC. All of these responses were independent of the source of human cells transplanted. LTC-IC of either human cord blood or adult marrow origin continue to proliferate in NOD/SCID mice for many weeks, although the turnover of all types of human CFC in mice transplanted with adult human marrow (but not cord blood) is downregulated after 6 weeks. Interestingly, administration of either MIP-1beta, an antagonist of both MIP-1alpha and MCP-1 or MCP-1(9-76), an antagonist of MCP-1 (and MCP-2 and MCP-3), into mice in which human marrow-derived CFC had become quiescent, caused the rapid reactivation of these progenitors in vivo. These results provide the first definition of stage-specific inhibitors of human hematopoietic progenitor cell cycling in vivo. In addition they show that endogenous chemokines can contribute to late graft failure, which can be reversed by the administration of specific antagonists.
International Nuclear Information System (INIS)
Schlosser, Peter; Bayer, Reinhold
1991-01-01
The application of natural and anthropogenic trace substances in oceanographic studies of the Weddell Sea is reviewed. The potential of some steady-state and transient tracers (tritium, CFC-11 and CFC-12, 18 O, and helium isotopes) for studies of deep water formation and circulation is discussed on the basis of data sets collected mainly on cruises of R/V 'Polastern' to the Weddell Sea during the 1980s. CFC/ tritium ratio dating of young water masses is applied to estimate mean age and transit times of water involved in Weddell Sea Bottom Water formation. The history of the CFC-11/tritium ratio through time is derived for Weddell Sea shelf waters. (author). 36 refs.; 18 figs
International Nuclear Information System (INIS)
von Melchner, H.; Lieschke, G.J.
1981-01-01
The regeneration of hemopoietic precursor cells was monitored in spleen organ cultures from lethally irradiated mice injected with 10(7) normal syngeneic or allogeneic bone marrow cells. The important role of the microenvironment in supporting hemopoiesis was confirmed by the failure of mutant Sl/Sld spleens to support CFC regeneration in organ cultures. However, the extent and quality of the CFC regeneration was clearly dependent on the genetic properties of the injected cells. Evidence for this was obtained from the regeneration patterns of various CFC types in organ cultured spleens derived from different mouse donor-recipient strain combinations that maintained the differences in the bone marrow frequency of various CFC types characteristic of the donor strain
Kim, Jarim; Nan, Xiaoli
2016-09-01
This study examines how individual difference in consideration of future consequences (CFC) and temporal framing (i.e., present- vs. future-oriented message) interact to influence the persuasive outcomes of a health message promoting human papillomavirus (HPV) vaccination among young adults. Results of an experiment (N = 416) showed a significant interaction effect of CFC and temporal framing on persuasion. The nature of the interaction suggested that individuals with high CFC generally were more persuaded by the present-oriented messages, compared to the future-oriented messages. On the other hand, those with low CFC responded similarly to the present- and future-oriented messages. Implications of the findings for HPV vaccination messaging are discussed.
International Nuclear Information System (INIS)
Ezato, Koichiro; Suzuki, Satoshi; Seki, Yohji; Nishi, Hiroshi; Mohri, Kensuke; Enoeda, Mikio
2012-01-01
Japan Domestic Agency (JADA) carried out R and Ds activities to improve joining CFC monoblocks onto a CuCrZr cooling tube in PFUs to boost the success rate of joint and to confirm load carrying capability of the monoblock attachments to Steel Support Structure (SSS) against tensile force simulating electromagnetic load to pull PFUs from SSS. In joining the CFC monoblocks to the cooling tube, JADA has adopted brazing by using noble-metal-free filler with the following improvements; (1) metalizing joint surface of CFC using Ti-coating with accurate thickness controlling, (2) Changing buffer layer material from soft pure copper to Cu–W alloy. By using the present improved joint, JADA has manufactured three mock-ups with 5 CFC monoblocks and tested against repetitive high heat loads more than 20 MW/m 2 . All of CFC monoblocks of each mockup can survive the high heat loads throughout 1000 cycles with no degradation of heat removal capability. Regarding the load carrying capability of monoblock attachments to SSS, tensile experiments were carried out using the same geometries of CFC and tungsten monoblocks in PFUs and the results show that both geometries and joints meet the ITER requirements, that is, 3 kN and 8 kN, respectively.
Ag supported on carbon fiber cloth as the catalyst for hydrazine oxidation in alkaline medium
International Nuclear Information System (INIS)
Liu, Ran; Ye, Ke; Gao, Yinyi; Zhang, Wenping; Wang, Guiling; Cao, Dianxue
2015-01-01
Highlights: • CFC supported microspherical Ag is obtained by square-wave potential method. • Ag/CFC electrode has high catalytic activity toward hydrazine oxidation. • Hydrazine oxidation on the electrode proceeds by a near 4-electron pathway. - Abstract: Silver particles with microspheric structure are directly electrodeposited on carbon fiber cloth (CFC) substrate by square-wave potential electrodeposition method. The electrocatalytic behaviors of the Ag/CFC electrode toward hydrazine oxidation in alkaline solution are examined by cyclic voltammetry and chronoamperometry. An onset oxidation potential of -0.5 V and a peak current density of 30 mA cm −2 are achieved in the solution containing 1.0 mol L −1 KOH and 20.0 mmol L −1 hydrazine. The microspheric structure of the Ag/CFC electrode provides large electroactive surface area, hence, abundant active sites are vacant for hydrazine oxidation. The calculated apparent activation energies at different potentials show that hydrazine electro-oxidation at higher potential has faster kinetics than that at lower potential. In addition, the transfer electron number of hydrazine oxidation reaction on the Ag/CFC electrode is close to four, suggesting hydrazine is almost completely electrooxidized on the electrode and the full use of hydrazine fuel is basically achieved.
Energy Technology Data Exchange (ETDEWEB)
Ezato, Koichiro, E-mail: ezatok.koichiro@jaea.go.jp [Naka Fusion Institute, Japan Atomic Energy Agency, JAEA, Naka, Ibaraki (Japan); Suzuki, Satoshi; Seki, Yohji; Nishi, Hiroshi; Mohri, Kensuke; Enoeda, Mikio [Naka Fusion Institute, Japan Atomic Energy Agency, JAEA, Naka, Ibaraki (Japan)
2012-08-15
Japan Domestic Agency (JADA) carried out R and Ds activities to improve joining CFC monoblocks onto a CuCrZr cooling tube in PFUs to boost the success rate of joint and to confirm load carrying capability of the monoblock attachments to Steel Support Structure (SSS) against tensile force simulating electromagnetic load to pull PFUs from SSS. In joining the CFC monoblocks to the cooling tube, JADA has adopted brazing by using noble-metal-free filler with the following improvements; (1) metalizing joint surface of CFC using Ti-coating with accurate thickness controlling, (2) Changing buffer layer material from soft pure copper to Cu-W alloy. By using the present improved joint, JADA has manufactured three mock-ups with 5 CFC monoblocks and tested against repetitive high heat loads more than 20 MW/m{sup 2}. All of CFC monoblocks of each mockup can survive the high heat loads throughout 1000 cycles with no degradation of heat removal capability. Regarding the load carrying capability of monoblock attachments to SSS, tensile experiments were carried out using the same geometries of CFC and tungsten monoblocks in PFUs and the results show that both geometries and joints meet the ITER requirements, that is, 3 kN and 8 kN, respectively.
Groundwater recharge and flow on Montserrat, West Indies: Insights from groundwater dating
Hemmings, Brioch; Gooddy, Daren; Whitaker, Fiona; George Darling, W.; Jasim, Alia; Gottsmann, Joachim
2015-01-01
Study region Montserrat, Lesser Antilles, Caribbean. Study focus Analysis of δ2H and δ18O isotopes, and chlorofluorocarbon (CFC) anthropogenic tracers in Montserrat groundwater provides insights into the age and provenance of the spring waters. New hydrological insights δ2H and δ18O analysis indicates uniform recharge elevations for groundwaters on Montserrat. CFC-11 and CFC-12 analysis reveals age differences between isotopically similar, high elevation springs and low eleva...
Jia, Zicai; Song, Yu; Tao, Suyuan; Cong, Peixu; Wang, Xiaoxu; Xue, Changhu; Xu, Jie
2016-03-01
To investigate the relationship between structure and activity, three glucocerebroside series (CFC-1, CFC-2 and CFC-3), ceramides (CF-Cer) and long-chain bases (CF-LCB) of sea cucumber Cucumaria frondosa (C. frondosa) were isolated and evaluated in HepG2 cells. The molecular species of CFC-1, CFC-2 and CFC-3 and CF-Cer were identified using reversed-phase liquid chromatography with heated electrospray ionization coupled to high-resolution mass spectrometry (RPLC-HESI-HRMS), and determined on the basis of chemical and spectroscopic evidence: For the three glucocerebroside series, fatty acids (FA) were mainly saturated (18:0 and 22:0), monounsaturated (22:1, 23:1 and 24:1) and 2-hydroxyl FA (2-HFA) (23:1 h and 24:1 h), the structure of long-chain bases (LCB) were dihydroxy (d17:1, d18:1 and d18:2) and trihydroxy (t16:0 and t17:0), and the glycosylation was glucose; For CF-Cer, FA were primarily saturated (17:0) and monounsaturated (16:1 and 19:1), the structure of LCB were dihydroxy (d17:1 and d18:1), and trihydroxy (t16:0). The results of cell experiment indicated that all of three glucocerebroside series, CF-Cer and CF-LCB exhibited an inhibitory effects on cell proliferation. Moreover, CFC-3 was most effective in three glucocerebrosides to HepG-2 cell viability. The inhibition effect of CF-LCB was the strongest, and the inhibition effect of CF-Cer was much stronger than glucocerebrosides.
Lifescience Database Archive (English)
Full Text Available AF (Link to library) AFK258 (Link to dictyBase) - - - Contig-U15883-1 AFK258Z (Link... to Original site) - - AFK258Z 705 - - - - Show AFK258 Library AF (Link to library) Clone ID AFK258 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-C/AFK258Q.Seq.d/ Representative seq. ID AFK25...8Z (Link to Original site) Representative DNA sequence >AFK258 (AFK258Q) /CSM/AF/AFK2-C/AFK258Q.Seq.d/ XXXXX...its) Value CFC754 (CFC754Q) /CSM/CF/CFC7-C/CFC754Q.Seq.d/ 656 0.0 AFM846 (AFM846Q) /CSM/AF/AFM8-B/AFM846Q.Seq.d/ 656 0.0 AFK2
Trends and variability of cloud fraction cover in the Arctic, 1982-2009
Boccolari, Mauro; Parmiggiani, Flavio
2018-05-01
Climatology, trends and variability of cloud fraction cover (CFC) data over the Arctic (north of 70°N), were analysed over the 1982-2009 period. Data, available from the Climate Monitoring Satellite Application Facility (CM SAF), are derived from satellite measurements by AVHRR. Climatological means confirm permanent high CFC values over the Atlantic sector during all the year and during summer over the eastern Arctic Ocean. Lower values are found in the rest of the analysed area especially over Greenland and the Canadian Archipelago, nearly continuously during all the months. These results are confirmed by CFC trends and variability. Statistically significant trends were found during all the months over the Greenland Sea, particularly during the winter season (negative, less than -5 % dec -1) and over the Beaufort Sea in spring (positive, more than +5 % dec -1). CFC variability, investigated by the Empirical Orthogonal Functions, shows a substantial "non-variability" in the Northern Atlantic Ocean. Statistically significant correlations between CFC principal components elements and both the Pacific Decadal Oscillation index and Pacific North America patterns are found.
Familial cardiofaciocutaneous syndrome in a father and a son with a novel MEK2 mutation.
Karaer, Kadri; Lissewski, Christina; Zenker, Martin
2015-02-01
Cardiofaciocutaneous (CFC) syndrome is a rare genetic disorder belonging to the group of RASopathies. It is typically characterized by congenital heart defects, short stature, dysmorphic craniofacial features, intellectual disability, failure to thrive, and ectodermal abnormalities such as hyperkeratosis and sparse, brittle, curly hair. CFC syndrome is caused by dominant mutations in one of the four genes BRAF, MEK1, MEK2, and KRAS. Only three familial cases of CFC syndrome have been reported to date, whereas the vast majorities are sporadic cases due to de novo mutations. We report on a fourth familial case with transmission of CFC syndrome from father to son due to a novel heterozygous sequence change c.376A>G (p.N126D) in exon 3 of MEK2 gene. This observation further documents the possibility of vertical transmission of CFC syndrome, which appears to be associated with rare mutations and relatively mild intellectual disability in affected individual. The hypomorphic effect of specific mutations particularly regarding neurocognitive issues may be related to the variable fertility of affected individuals. © 2014 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
At the end of 1995, a total abolition of the production of the specified freons (CFC) was achieved. In future, it will be important to proceed with the appropriate recovery/destruction of the CFC, etc. which has been used so far, not only for the protection of ozone layer, but for the prevention of global warming. For the international study of facilities (technology) for destruction CFC, etc., the Technical Assessment Committee (TAC) was installed for destruction technology of ozone layer depletion substances (ODS) under the United Nations Environment Programme (UNEP), and the destruction efficiency (DE) of ODS was set up. In Japan, more than 30 facilities are already handling the destruction of CFC on a commercial basis. The number is expected to increase by the promotion of protection of ozone layer and prevention of global warming. This survey indicated quantitatively and qualitatively based on the TAC DE what the facilities for destruction of CFC should be which were considered of domestic laws in Japan, and was made a guide for existing facilities and ones to be newly installed. (NEDO)
Effect of bone marrow depletion on prostaglandin E-producing suppressor macrophages in mouse spleen
International Nuclear Information System (INIS)
Shibata, Y.; Volkman, A.
1985-01-01
The i.p. injection of Corynebacterium parvum (CP) into CBA/J mice effected increases in macrophage colony-forming cells (M-CFC) when spleen cells were cultured with L cell culture filtrate as a source of colony-stimulating factor. Significant increases in phagocytic macrophages (M phi) with Fc receptors for IgG2a and IgG2b immune complexes were additionally noted among the spleen cells in these mice. These M phi effectively inhibited Con A-induced lymphocyte proliferation, probably reflecting a 10-fold increase above normal controls in prostaglandin E to 47 ng/3 X 10(6) spleen cells/ml. To determine whether the suppressor M phi are immediate derivatives of splenic M-CFC, we tried to induce suppressor M phi by the injection of CP into mice depleted of bone marrow M-CFC by the earlier administration of the bone-seeking isotope, 89Sr. This procedure reduced M-CFC in the bone marrow to less than 1% of normal for more than 30 days. Monocytes in the blood fell to 5% of normal by day 10 and were 30% on day 30. Levels of resident peritoneal M phi showed relatively little change in this period. By contrast, splenic M-CFC increased to 20-fold higher than the cold 88Sr controls. CP-induced suppressor M phi activity, however, was sharply reduced in 89Sr marrow-depleted mice on day 10, despite the striking increase in M-CFC. There was a threefold increase in the number of phagocytic M phi binding IgG2a immune complexes, with no significant increase in IgG2b binding M phi. The kinetics of recovery of suppressor M phi activity showed that on days 20, 30, and 50 after 89Sr injection the activities reached 20%, 30%, and 70% of the cold control, respectively, and correlated with the recovery of significant levels of M-CFC in the bone marrow. Taken together, these observations suggest that splenic M-CFC are not an immediate source of PGE-suppressor M phi in vivo
Directory of Open Access Journals (Sweden)
Tao eZhang
2013-04-01
Full Text Available The theta-gamma cross-frequency coupling (CFC in hippocampus was reported to reflect memory process. In this study, we measured the CFC of hippocampal local field potentials (LFPs in a two-vessel occlusion (2VO rat model, combined with both amplitude and phase properties and associated with short and long-term plasticity indicating the memory function. Male Wistar rats were used and a 2VO model was established. STP and LTP were recorded in hippocampal CA3-CA1 pathway after LFPs were collected in both CA3 and CA1. Based on the data of relative power spectra and phase synchronization, it suggested that both the amplitude and phase coupling of either theta or gamma rhythm were involved in modulating the neural network in 2VO rats. In order to determine whether the CFC was also implicated in neural impairment in 2VO rats, the coupling of CA3 theta–CA1 gamma was measured by both phase-phase coupling (n:m phase synchronization and phase-amplitude coupling. The attenuated CFC strength in 2VO rats implied the impaired neural communication in the coordination of theta-gamma entraining process. Moreover, compared with modulation index (MI a novel algorithm named cross frequency conditional mutual information (CF-CMI, was developed to focus on the coupling between theta phase and the phase of gamma amplitude. The results suggest that the reduced CFC strength probably attributed to the disruption of the phase of CA1 gamma envelop. In conclusion, it implied that the phase coupling and CFC of hippocampal theta and gamma played an important role in supporting functions of neural network. Furthermore, synaptic plasticity on CA3-CA1 pathway was reduced in line with the decreased CFC strength from CA3 to CA1. It partly supported our hypothesis that directional CFC indicator might probably be used as a measure of synaptic plasticity.
40 CFR 82.66 - Nonessential Class I products and exceptions.
2010-07-01
... cleaning fluids used for aircraft maintenance, which contain CFC-11 or CFC-113 as a solvent, but which... liquid packaging, solvent wipes, solvent sprays, and gas sprays; and (2) Except for those sold or...
Energy Technology Data Exchange (ETDEWEB)
Beckitt, J.W.; Harris, M.R.; Weissenborn, P.
1993-11-01
In this article an interview with representatives of a world-wide leading producer of refrigerants is given. Already five or six years ago they took the decision - which has already today proven to be correct - to find substituents which have a low toxicity, a low greenhouse potential and which do not deplete the ozone layer. R 134a turned out to be a promising substance. On the part of the producers it was stressed that tight regulations play an important role in the phase-out of CFC as only legal pressure will force the users to act. Also the establishment of an effective recycling system contributes to a better acceptance. (BWI)
Genetics Home Reference: Costello syndrome
... other genetic conditions, cardiofaciocutaneous syndrome (CFC syndrome) and Noonan syndrome . In affected infants, it can be difficult to ... These individuals may actually have CFC syndrome or Noonan syndrome , which are caused by mutations in related genes. ...
International Nuclear Information System (INIS)
Isakson, K.; Vessell, A.L.
1994-07-01
Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ''best alternatives'': Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases
Energy Technology Data Exchange (ETDEWEB)
Fedorocko, P.; Mackova, N.O. [Safarik Univ., Faculty ofSciences, Dept. of Cellular and Molecular Biology, Kosice (Slovakia)
1996-01-01
The effects of the bacterial extract broncho-vaxom (BV; radioprotective immunomodulator; 500 {mu}g/mouse i.p., -24 h) and indomethacin (INDO; inhibitor of prostaglandin production; 2x40 {mu}g/mouse i.m., - 24 h and - 3 h) on the post-irradiation recovery of hemopoietic functions in mice were investigated. Both agents were administered either alone or in combination. Endogenous spleen colony formation was increased in all treatment groups, with combination-treated mice exhibiting the greatest effects. Similarly, 24 h after combined administration of BV and INDO (i.e. at the time of presumed irradiation) to the non-irradiated mice granulocyte-macrophage colony-forming cell (GM-CFC) numbers were greater in the bone marrow and spleen. Also, as determined by hydroxyurea injection, there was an increase in the number of GM-CFC in the S-phase of the cell cycle in the bone marrow. However, GM-CFC in the spleen of combination pretreated mice was not stimulated to significant proliferation as compared to GM-CFC in the spleen of mice injected with BV alone. Combined modality treatment was also more effective than single agent treatments in accelerating bone marrow cellularity and GM-CFC regeneration, but not in accelerating GM-CFC regeneration in the spleen. Combined administration of BV and INDO to mice prior to lethal irradiation exerted and additional radioprotective effect and protected 95% of the C57B1/6 mice. (au) 42 refs.
ORGANIC EMISSIONS FROM PILOT-SCALE INCINERATION OF CFCS
The paper gives results of the characterization of organic emissions resulting from the pilot-scale incineration of trichlorofluoromethane (CFC-11) and dichlorodifluoromethane (CFC-12) under varied feed concentrations. (NOTE: As a result of the Montreal Protocol, an international...
Estimation of carbon fibre composites as ITER divertor armour
Pestchanyi, S.; Safronov, V.; Landman, I.
2004-08-01
Exposure of the carbon fibre composites (CFC) NB31 and NS31 by multiple plasma pulses has been performed at the plasma guns MK-200UG and QSPA. Numerical simulation for the same CFCs under ITER type I ELM typical heat load has been carried out using the code PEGASUS-3D. Comparative analysis of the numerical and experimental results allowed understanding the erosion mechanism of CFC based on the simulation results. A modification of CFC structure has been proposed in order to decrease the armour erosion rate.
Estimation of carbon fibre composites as ITER divertor armour
International Nuclear Information System (INIS)
Pestchanyi, S.; Safronov, V.; Landman, I.
2004-01-01
Exposure of the carbon fibre composites (CFC) NB31 and NS31 by multiple plasma pulses has been performed at the plasma guns MK-200UG and QSPA. Numerical simulation for the same CFCs under ITER type I ELM typical heat load has been carried out using the code PEGASUS-3D. Comparative analysis of the numerical and experimental results allowed understanding the erosion mechanism of CFC based on the simulation results. A modification of CFC structure has been proposed in order to decrease the armour erosion rate
Coherent feedback control of multipartite quantum entanglement for optical fields
Energy Technology Data Exchange (ETDEWEB)
Yan, Zhihui; Jia, Xiaojun; Xie, Changde; Peng, Kunchi [State Key Laboratory of Quantum Optics and Quantum Optics Devices, Institute of Opto-Electronics, Shanxi University, Taiyuan, 030006 (China)
2011-12-15
Coherent feedback control (CFC) of multipartite optical entangled states produced by a nondegenerate optical parametric amplifier is theoretically studied. The features of the quantum correlations of amplitude and phase quadratures among more than two entangled optical modes can be controlled by tuning the transmissivity of the optical beam splitter in the CFC loop. The physical conditions to enhance continuous variable multipartite entanglement of optical fields utilizing the CFC loop are obtained. The numeric calculations based on feasible physical parameters of realistic systems provide direct references for the design of experimental devices.
Ultrasonic test of carbon composite/copper joints in the ITER divertor
International Nuclear Information System (INIS)
Roccella, S.; Cacciotti, E.; Candura, D.; Mancini, A.; Pizzuto, A.; Reale, A.; Tatì, A.; Visca, E.
2013-01-01
Highlights: • ENEA developed and tested a specimen for the simulation of defects at the interface between CFC and copper. • The use of an ultrasonic technique properly set permitted to highlight and size with high accuracy the defects. • The technology developed could be employed successfully in the production of these components for high heat flux applications. -- Abstract: The vertical targets of the ITER divertor consist of high flux units (HFU) actively cooled: CuCrZr tubes armoured by tungsten and carbon/carbon fibre composite (CFC). The armour is obtained with holed parallelepiped blocks, called monoblocks, previously prepared and welded onto the tubes by means diffusion bonding. The monoblock preparation consists in the casting of a layer of copper oxygen free (Cu OFHC) inside the monoblock hole. Each HFU is covered with more than 100 monoblocks that have to be joined simultaneously to the tube. Therefore, it is very important to individuate any defects present in the casting of Cu OFHC or at the interface with the CFC before the monoblocks are installed on the units. This paper discusses the application of non-destructive testing by ultrasound (US) method for the control of the joining interfaces between CFC monoblocks and Cu OFHC, before the brazing on the CrCrZr tube. In ENEA laboratory an ultrasonic technique (UT) suitable for the control of these joints with size and geometry according to the ITER specifications has been developed and widely tested. Real defects in this type of joints are, however, still hardly detected by UT. The CFC surface has to be machined to improve the mechanical strength of the joint. This results in a surface not perpendicular to the ultrasonic wave. Moreover, CFC is characterized by high acoustic attenuation of the ultrasonic wave and then it is not easy to get information regarding the Cu/CFC bonding. Nevertheless, the UT sharpness and simplicity pushes to perform some further study. With this purpose, a sample with
Directory of Open Access Journals (Sweden)
Joohi Jimenez-Shahed
2016-09-01
Full Text Available Background: Deep brain stimulation (DBS is an emerging treatment strategy for severe, medication-refractory Tourette syndrome (TS. Thalamic (Cm-Pf and pallidal (including globus pallidus interna, GPi targets have been the most investigated. While the neurophysiological correlates of Parkinson’s disease (PD in the GPi and subthalamic nucleus (STN are increasingly recognized, these patterns are not well characterized in other disease states. Recent findings indicate that the cross-frequency coupling (CFC between beta band and high frequency oscillations (HFOs within the STN in PD patients is pathologic. Methods: We recorded intraoperative local field potentials (LFPs from the postero-ventrolateral GPi in three adult patients with TS at rest, during voluntary movements, and during tic activity and compared them to the intraoperative GPi-LFP activity recorded from four unmedicated PD patients at rest. Results: In all PD patients, we noted excessive beta band activity (13-30Hz at rest which consistently modulated the amplitude of the co-existent HFOs observed between 200-400Hz, indicating the presence of beta-HFO CFC. In all 3 TS patients at rest, we observed theta band activity (4-7Hz and HFOs. Two patients had beta band activity, though at lower power than theta oscillations. Tic activity was associated with increased high frequency (200-400Hz and gamma band (35-200Hz activity. There was no beta-HFO CFC in TS patients at rest. However, CFC between the phase of 5-10Hz band activity and the amplitude of HFOs was found in two TS patients. During tics, this shifted to CFC between the phase of beta band activity and the amplitude of HFOs in all subjects. Conclusions: To our knowledge this is the first study that shows that beta-HFO CFC exists in the GPi of TS patients during tics and at rest in PD patients, and suggests that this pattern might be specific to pathologic/involuntary movements. Furthermore, our findings suggest that during tics, resting
Ultrasonic test of carbon composite/copper joints in the ITER divertor
Energy Technology Data Exchange (ETDEWEB)
Roccella, S., E-mail: selanna.roccella@enea.it [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy); Cacciotti, E. [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy); Candura, D. [Ansaldo Nucleare S.p.A., C. so F.M. Perrone 25, 16152 Genoa (Italy); Mancini, A.; Pizzuto, A.; Reale, A. [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy); Tatì, A. [Associazione Euratom-ENEA sulla Fusione, C.R. Casaccia, Via Anguillarese 301, 00123 Santa Maria di Galeria, RM (Italy); Visca, E. [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy)
2013-10-15
Highlights: • ENEA developed and tested a specimen for the simulation of defects at the interface between CFC and copper. • The use of an ultrasonic technique properly set permitted to highlight and size with high accuracy the defects. • The technology developed could be employed successfully in the production of these components for high heat flux applications. -- Abstract: The vertical targets of the ITER divertor consist of high flux units (HFU) actively cooled: CuCrZr tubes armoured by tungsten and carbon/carbon fibre composite (CFC). The armour is obtained with holed parallelepiped blocks, called monoblocks, previously prepared and welded onto the tubes by means diffusion bonding. The monoblock preparation consists in the casting of a layer of copper oxygen free (Cu OFHC) inside the monoblock hole. Each HFU is covered with more than 100 monoblocks that have to be joined simultaneously to the tube. Therefore, it is very important to individuate any defects present in the casting of Cu OFHC or at the interface with the CFC before the monoblocks are installed on the units. This paper discusses the application of non-destructive testing by ultrasound (US) method for the control of the joining interfaces between CFC monoblocks and Cu OFHC, before the brazing on the CrCrZr tube. In ENEA laboratory an ultrasonic technique (UT) suitable for the control of these joints with size and geometry according to the ITER specifications has been developed and widely tested. Real defects in this type of joints are, however, still hardly detected by UT. The CFC surface has to be machined to improve the mechanical strength of the joint. This results in a surface not perpendicular to the ultrasonic wave. Moreover, CFC is characterized by high acoustic attenuation of the ultrasonic wave and then it is not easy to get information regarding the Cu/CFC bonding. Nevertheless, the UT sharpness and simplicity pushes to perform some further study. With this purpose, a sample with
Joireman, J.; Shaffer, M. J.; Balliet, D.P.; Strathman, A.
2012-01-01
The authors extended research linking individual differences in consideration of future consequences (CFC) with health behaviors by (a) testing whether individual differences in regulatory focus would mediate that link and (b) highlighting the value of a revised, two-factor CFC-14 scale with
Chang, Chih-Chung; Lai, Cheng-Hsun; Wang, Chieh-Heng; Liu, Ying; Shao, Min; Zhang, Yuanhang; Wang, Jia-Lin
The continued production and consumption of five major chlorocarbons, i.e., CFC-11 (CCl 3F), CFC-12 (CCl 2F 2), CFC-113 (CCl 2FCClF 2), CH 3CCl 3, and CCl 4, as allowed by developing nations including China under the Montreal Protocol, were assessed by a method employing concentration variability. Measurements of the five ozone depleting substances (ODS) were measured in downtown Guangzhou and a rural site in the Pearl River Delta (PRD), China by both in situ and flask measurements. In order to post a contrast to PRD with a referencing environment of minimal emissions, in situ measurements were also conducted in Taipei, Taiwan, where a decade long phase-out of CFCs has been implemented. In general, the variability of chlorocarbons in the PRD sites was significantly greater than that of Taipei. While the abundance of the five ODSs in Taipei was relatively uniform with a relative standard deviation (RSD) varying between 3% and 16%, their variability in PRD with the exception of CFC-113 was significantly more pronounced, clearly indicating the significant usage of ODSs. The variability of CFC-113 in both cities, however, was nearly indiscernible from the instrumental precision, suggesting little usage of CFC-113 in China. Methyl chloroform in Guangzhou exhibited a strong link to solvent evaporation as it showed a tight correlation with ambient toluene. Alarmingly, CCl 4 was the most variable of the five major chlorocarbons in Guangzhou, which should arouse a serious concern for public health due to its carcinogenicity.
Recent trends in the variability of halogenated trace gases over the United States
Hurst, Dale F.; Bakwin, Peter S.; Elkins, James W.
1998-10-01
Recent trends in the atmospheric variability of seven halogenated trace gases are determined from three years (November 1994 through October 1997) of hourly gas chromatographic measurements at a 610 m tower in North Carolina and 17 months (June 1996 through October 1997) of similar measurements at a 450 m tower in Wisconsin. Production of five of these gases, CCl3F (CFC-11), CCl2F2 (CFC-12), CCl2FCClF2 (CFC-113), CH3CCl3 (methyl chloroform), and CCl4 (carbon tetrachloride), is now strictly regulated in the United States and other developed countries under international legislation. C2Cl4 (tetrachloroethene) and SF6 (sulfur hexafluoride) are currently produced without restriction, but requests for voluntary cutbacks in C2Cl4 emissions have been made, at least in the United States. Atmospheric variability of these gases is examined at several sampling heights on the towers, but trends are deduced using only nighttime data at the top sampling level of each tower to minimize variability driven by local emissions and the diurnal cycle of the planetary boundary layer, leaving regional emissions as the main source of day-to-day variability. Significant downward trends are determined for CFC-12, CFC-113, CH3CCl3, and C2Cl4 variability at both towers, reflecting decreased emissions of these gases in two regions of the United States. Trends in CFC-11, CCl4, and SF6 variability at both towers are not significantly different from zero.
Mutation and phenotypic spectrum in patients with cardio-facio-cutaneous and Costello syndrome.
Schulz, A.L.; Albrecht, B.; Arici, C.; Burgt, I. van der; Buske, A.; Gillessen-Kaesbach, G.; Heller, R.; Horn, D.; Hubner, C.A.; Korenke, C.G.; Konig, R.; Kress, W.; Kruger, G.; Meinecke, P.; Mucke, J.; Plecko, B.; Rossier, E.; Schinzel, A.; Schulze, A.; Seemanova, E.; Seidel, H.; Spranger, S.; Tuysuz, B.; Uhrig, S.; Wieczorek, D.; Kutsche, K.; Zenker, M.
2008-01-01
Cardio-facio-cutaneous (CFC) and Costello syndrome (CS) are congenital disorders with a significant clinical overlap. The recent discovery of heterozygous mutations in genes encoding components of the RAS-RAF-MAPK pathway in both CFC and CS suggested a similar underlying pathogenesis of these two
Germline KRAS and BRAF mutations in cardio-facio-cutaneous syndrome
Niihori, Tetsuya; Aoki, Yoko; Narumi, Yoko; Neri, Giovanni; Cavé, Hélène; Verloes, Alain; Okamoto, Nobuhiko; Hennekam, Raoul C. M.; Gillessen-Kaesbach, Gabriele; Wieczorek, Dagmar; Kavamura, Maria Ines; Kurosawa, Kenji; Ohashi, Hirofumi; Wilson, Louise; Heron, Delphine; Bonneau, Dominique; Corona, Giuseppina; Kaname, Tadashi; Naritomi, Kenji; Baumann, Clarisse; Matsumoto, Naomichi; Kato, Kumi; Kure, Shigeo; Matsubara, Yoichi
2006-01-01
Cardio-facio-cutaneous (CFC) syndrome is characterized by a distinctive facial appearance, heart defects and mental retardation. It phenotypically overlaps with Noonan and Costello syndrome, which are caused by mutations in PTPN11 and HRAS, respectively. In 43 individuals with CFC, we identified two
Study of carbon impurity generation by chemical sputtering in JT-60U
International Nuclear Information System (INIS)
Higashijima, S.; Kubo, H.; Sugie, T.; Shimizu, K.; Asakura, N.; Itami, K.; Hosogane, N.; Sakasai, A.; Konoshima, S.; Sakurai, S.; Takenaga, H.
1997-01-01
CD/CH-band intensities emitted from hydrocarbon molecules have been measured in the divertor region of JT-60U and the chemical sputtering yield of methane was estimated as a function of the surface temperature and the deuterium ion flux. The chemical sputtering yield increases with the surface temperature and decreases with increasing ion flux density in the L-mode plasmas. The B 4 C converted CFC tiles are installed in JT-60U and it is found that the chemical sputtering of B 4 C converted CFC tiles is suppressed in comparison to normal CFC tiles. (orig.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
Devices that decompose halogen compounds by use of AlPO{sub 4} are built, and studies are made concerning the collection of basic knowledge and findings, the settlement of problems that accompany scaleup, and the elucidation of mechanism of catalytic function occurrence. Tests are conducted at an intermediate plant, when catalytic performance is observed using a unit accommodating 1 liter of catalyst and chlorofluorocarbon (CFC) 12 is subjected to decomposition for the selection of proper operating conditions. Results similar to those from micro-reactor operation are attained when the reaction tube temperature is controlled. On the basis of the results, a real reactor and reaction system are designed and constructed, and CFC12 containing some CFC115 and CFC22 is made to undergo a decomposition reaction in this real reactor. It is then clarified that CFC catalytic decomposition proceeds at a low cost without generating dioxins and that therefore the process is commercially viable. In the study of catalytic adjustment, it is found that adjustment may be sufficiently effected when baking is conducted at 1,000 degrees C even when the extrusion process which demands low manufacturing cost is employed. Studies are also conducted about the mechanism of co-catalytic function occurrence. (NEDO)
Rapid detection of cancer related DNA nanoparticulate biomarkers and nanoparticles in whole blood
Heller, Michael J.; Krishnan, Raj; Sonnenberg, Avery
2010-08-01
The ability to rapidly detect cell free circulating (cfc) DNA, cfc-RNA, exosomes and other nanoparticulate disease biomarkers as well as drug delivery nanoparticles directly in blood is a major challenge for nanomedicine. We now show that microarray and new high voltage dielectrophoretic (DEP) devices can be used to rapidly isolate and detect cfc-DNA nanoparticulates and nanoparticles directly from whole blood and other high conductance samples (plasma, serum, urine, etc.). At DEP frequencies of 5kHz-10kHz both fluorescent-stained high molecular weight (hmw) DNA, cfc-DNA and fluorescent nanoparticles separate from the blood and become highly concentrated at specific DEP highfield regions over the microelectrodes, while blood cells move to the DEP low field-regions. The blood cells can then be removed by a simple fluidic wash while the DNA and nanoparticles remain highly concentrated. The hmw-DNA could be detected at a level of <260ng/ml and the nanoparticles at <9.5 x 109 particles/ml, detection levels that are well within the range for viable clinical diagnostics and drug nanoparticle monitoring. Disease specific cfc-DNA materials could also be detected directly in blood from patients with Chronic Lymphocytic Leukemia (CLL) and confirmed by PCR genotyping analysis.
Timescales for nitrate contamination of spring waters, northern Florida, USA
Katz, B.G.; Böhlke, J.K.; Hornsby, H.D.
2001-01-01
Residence times of groundwater, discharging from springs in the middle Suwannee River Basin, were estimated using chlorofluorocarbons (CFCs), tritium (3H), and tritium/helium-3 (3H/3He) age-dating methods to assess the chronology of nitrate contamination of spring waters in northern Florida. During base-flow conditions for the Suwannee River in 1997–1999, 17 water samples were collected from 12 first, second, and third magnitude springs discharging groundwater from the Upper Floridan aquifer. Extending age-dating techniques, using transient tracers to spring waters in complex karst systems, required an assessment of several models [piston-flow (PFM), exponential mixing (EMM), and binary-mixing (BMM)] to account for different distributions of groundwater age. Multi-tracer analyses of four springs yielded generally concordant PFM ages of around 20±2 years from CFC-12, CFC-113, 3H, and 3He, with evidence of partial CFC-11 degradation. The EMM gave a reasonable fit to CFC-113, CFC-12, and 3H data, but did not reproduce the observed 3He concentrations or 3H/3He ratios, nor did a combination PFM–EMM. The BMM could reproduce most of the multi-tracer data set only if both endmembers had 3H concentrations not much different from modern values. CFC analyses of 14 additional springs yielded apparent PFM ages from about 10 to 20 years from CFC-113, with evidence of partial CFC-11 degradation and variable CFC-12 contamination. While it is not conclusive, with respect to the age distribution within each spring, the data indicate that the average residence times were in the order of 10–20 years and were roughly proportional to spring magnitude. Applying similar models to recharge and discharge of nitrate based on historical nitrogen loading data yielded contrasting trends for Suwanee County and Lafayette County. In Suwanee County, spring nitrate trends and nitrogen isotope data were consistent with a peak in fertilizer input in the 1970s and a relatively high overall ratio
Results of the examinations of the W7-X pre-series target elements
International Nuclear Information System (INIS)
Boscary, J.; Boeswirth, B.; Greuner, H.; Streibl, B.; Missirlian, M.; Schlosser, J.; Schedler, B.; Scheiber, K.
2006-01-01
The highly heat-loaded area of the target plates of the WENDELSTEIN 7-X (W7-X) divertor is formed by 890 water-cooled target elements (TEs). This surface is designed to sustain a maximum stationary heat flux of 10 MW/m 2 and to remove a maximum power of 100 kW per element. Flat tiles made of CFC Sepcarb(r) NB31 are bonded to a CuCrZr heat sink. This joint is manufactured in two stages. In the first step, an OFHC copper interlayer is cast onto the tile by active metal casting (AMC(r)). At this stage, the joint copper-CFC is inspected by X-ray and lock-in thermography. In the second step, the AMC(r)-NB31 tiles are joined to CuCrZr. Two technologies have been investigated: electron beam welding (EBW) and hot isostatic pressing (HIP). The joint copper-CuCrZr is examined by ultrasonic method. At the end of the fabrication, the bond between the heat sink and the CFC tiles is inspected by thermography methods. The produced CFC NB31 material for W7-X showed a large scatter in the tensile strength in the ex-pitch direction in the range of 50 - 110 MPa. Pre-series TEs have been manufactured to qualify the design, the fabrication, the relevant non-destructive examinations (NDEs) and the delivered CFC for the serial production. The whole manufacturing route is validated if the delivered elements withstand operating conditions similar to those in W7-X in the high heat flux (HHF) test facility GLADIS without degradation of performance and integrity. HHF tests did not show any effect that could be attributed to the CFC grade or to the joining method. The HHF test results exhibited a high percentage of defective tiles, indicated by hot spots at the border of the CFC surface. Visual inspections after HHF tests have mostly correlated these spots to the initiation and /or propagation of cracks at the lateral edge of the tiles in CFC at the interface CFC-copper. The pre-series activities have been extended to reduce the stresses at the critical AMC(r) interface. By means of
Increased greenhouse effect substantiated through measurements
International Nuclear Information System (INIS)
Skartveit, Arvid
2001-01-01
The article presents studies on the greenhouse effect which substantiates the results from satellite measurements during the period 1970 - 1997. These show an increased effect due to increase in the concentration of the climatic gases CO 2 , methane, CFC-11 and CFC-12 in the atmosphere
Westra, Douglas G.
1993-01-01
With the February, 1992 announcement by President Bush to move the deadline for outlawing CFC (chloro-fluoro-carbon) refrigerants from the year 2000 to the year 1996, the refrigeration and air-conditioning industries have been accelerating their efforts to find alternative refrigerants. Many of the alternative refrigerants being evaluated require synthetic lubricants, are less efficient, and have toxicity problems. One option to developing new, alternative refrigerants is to combine existing non-CFC refrigerants to form a nonazeotropic mixture, with the concentration optimized for the given application so that system COP (Coefficient Of Performance) may be maintained or even improved. This paper will discuss the dilemma that industry is facing regarding CFC phase-out and the problems associated with CFC alternatives presently under development. A definition of nonazeotropic mixtures will be provided, and the characteristics and COP benefits of nonazeotropic refrigerant mixtures will be explained using thermodynamic principles. Limitations and disadvantages of nonazeotropic mixtures will be discussed, and example systems using such mixtures will be reviewed.
International Nuclear Information System (INIS)
Kozubik, A.; Hofmanova, J.; Pospisil, M.; Netikova, J.; Hola, J.; Lojek, A.
1994-01-01
Two non-steroidal anti-inflammatory drugs, i.e. indomethacin (INDO), an inhibitor of prostaglandin production, and esculetin (ESCUL), an inhibitor of leukotriene production, were tested for their ability to modify haematopoiesis in three experimental systems: (a) in vitro clonal proliferation of marrow GM-CFC from the irradiated mouse was found to be augmented by addition of INDO at a low concentration, and inhibited by ESCUL in a dose-dependent manner; (b) in the lethally irradiated and bone marrow-transplanted mice treated with the drugs in the postirradiation period, stimulatory effects of INDO on CFU-S and GM-CFC populations and an inhibitory effect of ESCUL on GM-CFC were observed; and (c) when the drugs were administered i.p. to mice 1 h before 5-Gy irradiation, INDO enhanced the postirradiation recovery of haematopoietic indices such the numbers of CFU-S, GM-CFC, peripheral blood granuloctyes, and nucleated bone marrow cells, while ESCUL had no effect or even inhibited the recovery of these indices. (author)
Hot radial pressing: An alternative technique for the manufacturing of plasma-facing components
International Nuclear Information System (INIS)
Visca, E.; Libera, S.; Mancini, A.; Mazzone, G.; Pizzuto, A.; Testani, C.
2005-01-01
The Hot radial pressing (HRP) manufacturing technique is based on the radial diffusion bonding principle performed between the cooling tube and the armour tile. The bonding is achieved by pressurizing the cooling tube while the joining interface is kept at the vacuum and temperature conditions. This technique has been used for the manufacturing of relevant mock-ups of the ITER divertor vertical target. Tungsten monoblock mock-ups were successfully tested to high heat flux thermal fatigue (20 MW/m 2 of absorbed heat flux for 1000 cycles). After these good results the activity is now focused on the developing of a manufacturing process suitable also for the CFC monoblock mock-ups. A FE calculation was performed to investigate the stress involved in the CFC tiles during the process and to avoid the CFC fracture. The results obtained by the FE calculation and by the test performed in air simulating a HRP manufacturing process for a CFC monoblock mock-ups is reported in the paper
Orbell, Sheina; Hagger, Martin
2006-07-01
Reliable individual differences in the extent to which people consider the long- and short-term consequences of their own behaviors are hypothesized to influence the impact of a persuasive communication. In a field experiment, the time frame of occurrence of positive and negative consequences of taking part in a proposed Type 2 diabetes screening program was manipulated in a sample of 210 adults with a mean age of 53 years. Individual differences in consideration of future consequences (CFC; A. Strathman, F. Gleicher, D. S. Boninger, & C. S. Edwards, 1994) moderated (a) the generation of positive and negative thoughts and (b) the persuasive impact of the different communications. Low-CFC individuals were more persuaded when positive consequences were short term and negative consequences were long term. The opposite was true of high-CFC individuals. Path analyses show that net positive thoughts generated mediated the effect of the CFC x Time Frame manipulations on behavioral intentions.
Analysis and design of the beryllium tiles for the JET ITER-like wall project
International Nuclear Information System (INIS)
Thompson, V.; Krivchenkov, Y.; Riccardo, V.; Vizvary, Z.
2007-01-01
Work is in progress to completely replace, in 2008/9, the existing JET CFC tiles with a configuration of plasma facing materials consistent with the ITER design. The ITER-like wall (ILW) will be created with a combination of beryllium (Be), tungsten (W), W-coated CFC and Be-coated inconel tiles, with the material depending on the local anticipated heat flux and geometry. Over 4000 tiles will be replaced and the ILW will accommodate additional heating up to at least 50 MW for 10 s. One of the objectives is to maintain or improve the existing CFC tile power handling performance which has been achieved in most cases by hiding bolt holes, optimising tile size and profile and introducing castellations on plasma facing surfaces. This paper describes the generic problems associated with the Be tiles (power handling capacity and disruption induced eddy currents) and illustrates the solution selected for the inner wall guard limiter (IWGL) where the present CFC tiles will be replaced with Be
International Nuclear Information System (INIS)
Rao, S.V.S.; Lekshmi, R.; Mani, A.G.S.; Sinha, P.K.
2010-01-01
Composite ion-exchange resins were prepared by coating copper-ferrocyanide (CFC) and hydrous manganese oxide (HMO) powders on polyurethane (PU) foam. Polyvinyl acetate/Acetone was used as a binder. The foam was loaded with about five times its weight with CFC and HMO powders. The distribution coefficients of CFC-PU foam and HMO-PU foam for cesium and strontium respectively were estimated. Under similar conditions the HMO-PU foam showed higher capacity as well as better kinetics for removal of strontium than CFC-PU foam for Cs. The pilot plant scale studies were conducted using a mixed composite ion-exchange resin bed. About 1000 bed volumes could be passed before attaining a DF of 10 from an initial value of 60-80. The spent resin was digested in alkaline KMnO 4 and the digested liquid was fixed in cement matrix. The matrices were characterized with respect to compressive strength and leach resistance. (author)
Energy Technology Data Exchange (ETDEWEB)
Kozubik, A.; Hofmanova, J.; Pospisil, M.; Netikova, J.; Hola, J.; Lojek, A. (Ceskoslovenska Akademie Ved, Brno (Czech Republic). Biofysikalni Ustav)
1994-03-01
Two non-steroidal anti-inflammatory drugs, i.e. indomethacin (INDO), an inhibitor of prostaglandin production, and esculetin (ESCUL), an inhibitor of leukotriene production, were tested for their ability to modify haematopoiesis in three experimental systems: (a) in vitro clonal proliferation of marrow GM-CFC from the irradiated mouse was found to be augmented by addition of INDO at a low concentration, and inhibited by ESCUL in a dose-dependent manner; (b) in the lethally irradiated and bone marrow-transplanted mice treated with the drugs in the postirradiation period, stimulatory effects of INDO on CFU-S and GM-CFC populations and an inhibitory effect of ESCUL on GM-CFC were observed; and (c) when the drugs were administered i.p. to mice 1 h before 5-Gy irradiation, INDO enhanced the postirradiation recovery of haematopoietic indices such the numbers of CFU-S, GM-CFC, peripheral blood granuloctyes, and nucleated bone marrow cells, while ESCUL had no effect or even inhibited the recovery of these indices. (author).
Skaugset, Nils Petter; Ellingsen, Dag G; Notø, Hilde; Jordbekken, Lars; Thomassen, Yngvar
2013-10-01
Intersampler field comparison of Respicon(®), 25-mm closed-face 'total dust' cassette (CFC), and IOM inhalable aerosol sampler was conducted in pot rooms at seven aluminium smelters. The aerosol mass and water-soluble fluoride were selected as airborne contaminants for the comparisons. The aerosol masses of 889 sample pairs of IOM and Respicon(®) inhalable aerosol sub-fraction, 165 of IOM and 25-mm CFC, and 194 of CFC and Respicon(®) thoracic aerosol sub-fraction were compared. The number of sample pairs for the comparison of water-soluble fluoride was 906, 170, and 195, respectively. The geometric mean aerosol mass collected with the inhalable Respicon(®) was 2.91 mg m(-3) compared with 3.38 mg m(-3) with the IOM. The overall ratio between IOM and Respicon(®) inhalable sub-fraction was 1.16 [95% confidence interval (CI) = 1.11-1.21] for aerosol mass and 1.13 (95% CI = 1.08-1.18) for water-soluble fluoride. The results indicate that Respicon(®) undersampled the aerosol mass and water-soluble fluoride in the inhalable sub-fraction compared with the IOM. The results indicated undersampling of the Respicon(®) at mass concentrations higher than 1.35 mg m(-3) and oversampling at lower mass concentrations. The overall ratio between aerosol mass collected with IOM and CFC was 4.19 (95% CI = 3.79-4.64) and 1.61 (95% CI = 1.51-1.72) for water-soluble fluoride. Thus, for this industry, a correction factor of 4.2 is suggested for the conversion of CFC to inhalable aerosol masses and a conversion factor of 1.6 for water-soluble fluoride if wall deposits in the CFC are included. CFC and thoracic Respicon(®) collected similar aerosol masses (ratio = 1.04; 95% CI = 0.97-1.12), whereas the ratio was 1.19 (95% CI = 1.11-1.28) for water-soluble fluoride. The variability of the exposure is substantial; thus, large data sets are required in sampler performance field comparisons.
Guan, Y; Hogge, D E
2000-12-01
One possible explanation for the competitive advantage that malignant cells in patients with acute myelogenous leukemia (AML) appear to have over normal hematopoietic elements is that leukemic progenitors proliferate more rapidly than their normal progenitor cell counterparts. To test this hypothesis, an overnight 3H-thymidine (3H-Tdr) suicide assay was used to analyze the proliferative status of malignant progenitors detected in both colony-forming cell (CFC) and long-term culture initiating cell (LTC-IC) assays from the peripheral blood of nine patients with newly diagnosed AML. Culture of AML cells in serum-free medium with 100 ng/ml Steel factor (SF), 20 ng/ml interleukin 3 (IL-3) and 20 ng/ml granulocyte colony-stimulating factor (G-CSF) for 16-24 h maintained the number of AML-CFC and LTC-IC at near input values (mean % input +/- s.d. for CFC and LTC-IC were 78 +/- 33 and 126 +/- 53, respectively). The addition of 20 muCi/ml high specific activity 3H-Tdr to these cultures reduced the numbers of both progenitor cell types from most of the patient samples substantially: mean % kill +/- s.d. for AML-CFC and LTC-IC were 64 +/- 27 and 82 +/- 16, respectively, indicating that a large proportion of both progenitor populations were actively cycling. FISH analysis of colonies from CFC and LTC-IC assays confirmed that most cytogenetically abnormal CFC and LTC-IC were actively cycling (mean % kill +/- s.d.: 68 +/- 26 and 85 +/- 13, respectively). Interestingly, in six patient samples where a significant number of cytogenetically normal LTC-ICs were detected, the % kill of these cells (74 +/- 20) was similar to that of the abnormal progenitors. These data contrast with the predominantly quiescent cell cycle status of CFC and LTC-IC previously observed in steady-state peripheral blood from normal individuals but also provide evidence that a significant proportion of primitive malignant progenitors from AML patients are quiescent and therefore may be resistant to standard
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the periodfrom ...
Cardiofaciocutaneous syndrome: A rare entity
Directory of Open Access Journals (Sweden)
S Pavithra
2012-01-01
Full Text Available The cardiofaciocutaneous (CFC syndrome is a condition of sporadic occurrence, with patients showing multiple congenital anomalies and mental retardation and characteristic dysmorphic features. We, thus, report a rare case of this syndrome in a 1-year-old child who presented with typical features of CFC syndrome.
International Nuclear Information System (INIS)
Plankensteiner, A.; Leuprecht, A.; Schedler, B.; Scheiber, K.-H.; Greuner, H.
2007-01-01
In the divertor of the nuclear fusion experiment WENDELSTEIN 7-X (W7-X) plasma facing high heat flux target elements have to withstand severe loading conditions. The thermally induced mechanical stressing turns out to be most critical with respect to lifetime predictions of the target elements. Therefore, different design variants of those CFC flat tile armoured high heat flux components have been analysed via the finite element package ABAQUS aiming at derivation of an optimized component design under high heat flux conditions. The investigated design variants comprise also promising alterations in the cooling channel design and castellation of the CFC flat tiles which, however, from a system integration and manufacturing standpoint of view, respectively, are evaluated to be critical. Therefore, the numerical study as presented here mainly comprises a reference variant that is comparatively studied with a variant incorporating a bi-layer-type AMC-Cu/OF-Cu interlayer at the CFC/Cu-interface. The thermo-mechanical material characteristics are accounted for in the finite element models with elastic-plastic properties being assigned to the metallic sections CuCrZr, AMC-Cu and OF-Cu, respectively, and orthotropic nonlinear-elastic properties being used for the CFC sections. The calculated temporal and spatial evolution of temperatures, stresses, and strains for the individual design variants are evaluated with special attention being paid to stress measures, plastic strains, and damage parameters indicating the risk of failure of CFC and the CFC/Cu-interface, respectively. This way the finite element analysis allows to numerically derive an optimized design variant within the framework of expected operating conditions in W7-X
von Wagner, Christian; Good, Anna; Smith, Samuel G.; Wardle, Jane
2011-01-01
Abstract Background Colorectal cancer (CRC) screening participation is low despite its effectiveness in reducing CRC mortality. Identifying benefits and barriers requires consideration of specific characteristics of screening modalities. Aims and Research Questions To monitor the impact of providing information about CRC screening via faecal occult blood testing (FOBt) on intentions to participate. To investigate moderation by individual differences in consideration of future consequences (CFC). Design, setting and participants A total of 211 healthy adults (aged 45–59) with no experience of CRC screening were presented with eight consecutive statements about FOBt‐based screening in a web survey. Participants completed measures of i) intention (after each statement), ii) CFC and iii) the importance of screening practicalities (e.g. unpleasantness of completing the test) and benefits (e.g. early detection of cancer). Results An 8 (information) × 2 (CFC) mixed ancova showed that intentions varied across the eight statements. (P < 0.001): increasing after information about FOBt being completed at home (P < 0.001) before subsequently decreasing after information about the requirement to collect faecal samples (P < 0.001) in a plastic tub (P < 0.01) on three occasions (P < 0.01) with the low CFC group generally being less inclined to complete the test (P < 0.01). Two between‐group anovas demonstrated that the low CFC group attributed greater importance to practicalities of screening than the high CFC group while the opposite was found for the importance of benefits (both P’s < 0.001). Conclusion Deconstructing FOBt‐based screening pointed to specific benefits and barriers which can advance research into public preferences of screening and educational materials. PMID:21501350
2000-10-01
performance. A team of military and Multiple gamers and analysts Augmented by Study SMEs •Threats •Service reps •Scenario •Data Typical VIC Team...OPLAN) for the Combined Forces Command (CFC) in Korea . CFC has since requested TRAC to conduct similar analyses on the new OPLANs during 1999-2000
Review of the high heat flux testing as an integrated part of W7-X divertor development
International Nuclear Information System (INIS)
Greuner, H.; Boeswirth, B.; Boscary, J.; Friedrich, T.; Lavergne, C.; Linsmeier, Ch.; Schlosser, J.; Wiltner, A.
2009-01-01
The subject of the development of the WENDELSTEIN 7-X divertor is the manufacturing of approximately 900 plasma facing components (PFCs) that meet all requirements for reliable long pulse and long-term plasma operation. The actively cooled PFCs are made of CFC NB31 as plasma facing material bonded by Active Metal Casting (AMC) copper interlayer onto CuCrZr cooling structure. The pre-series activities integrated extensive high heat flux (HHF) testing to assess the industrial manufacturing. Tests were performed in the GLADIS facility under load conditions similar to those expected during operation of W7-X. The investigations focused on the improvement of fatigue resistance of the CFC/Cu bonding. The results of the last HHF test campaign demonstrated a significant enhancement of the CFC bonding quality due to the introduction of the AMC/Cu bi-layer technology. The results of the micro-chemical analyses (using EDX, AES, XPS and SIMS) of the CFC/Cu interface performed after 5000 cycles at 10 MW/m 2 confirmed its chemical stability. Far beyond the current available data about the expected lifetime of CFC-armoured PFCs, 10,000 cycles at 10 MW/m 2 were applied without any damages at the interface. The present design and manufacturing process of the tested PFCs fulfil all requirements for W7-X operation.
Pierpont, Elizabeth I.; Pierpont, Mary Ella; Mendelsohn, Nancy J.; Roberts, Amy E.; Tworog-Dube, Erica; Rauen, Katherine A.; Seidenberg, Mark S.
2011-01-01
Cardiofaciocutaneous syndrome (CFC) and Noonan syndrome (NS) are two phenotypically overlapping genetic disorders whose underlying molecular etiologies affect a common signaling pathway. Mutations in the BRAF, MEK1 and MEK2 genes cause most cases of CFC and mutations in PTPN11, SOS1, KRAS and RAF1 typically cause NS. Although both syndromes are associated with developmental delays of varying severity, the extent to which the behavioral profiles differ may shed light on the different roles these respective genes play in development of skills necessary for everyday functioning. In this study, profiles of adaptive behavior of individuals with CFC and NS who had confirmed pathogenic mutations in Ras/MAPK pathway genes were investigated. Patterns of strengths and weaknesses, age-related differences, and risk factors for difficulties in adaptive skills were assessed. Although genes acting more downstream in the Ras/MAPK pathway were associated with more difficulties in adaptive functioning than genes more upstream in the pathway, several inconsistencies highlight the wide spectrum of possible developmental courses in CFC and NS. Along with clinical and genetic factors, variables such as chronological age, gestational age at birth and parental education levels accounted for significant variance in adaptive skills. Results indicate that there is wide heterogeneity in adaptive ability in CFC and NS, but that these abilities are correlated to some extent with the specific disease-causing genes. PMID:20186801
Thorstenson, Donald C.; Weeks, Edwin P.; Haas, Herbert; Busenberg, Eurybiades; Plummer, Niel; Peters, Charles A.
1998-01-01
Boreholes open to the unsaturated zone at the crest of Yucca Mountain, Nevada, were variously sampled for CO2 (including 13C and 14C), CH4, N2, O2, Ar, CFC-11, CFC-12, and CFC-113 from 1986 to 1993. Air enters the mountain in outcrops, principally on the eastern slope, is enriched in CO2by mixing with soil gas, and is advected to the mountain crest, where it returns to the atmosphere. The CFC data indicate that travel times of the advecting gas in the shallow Tiva Canyon hydrogeologic unit are ≤5 years. The 14C activities are postbomb to depths of 100 m, indicating little retardation of 14CO2 in the shallow flow systems. The 14C activities from 168 to 404 m in the Topopah Spring hydrogeologic unit are 85–90 pMC at borehole USW-UZ6. The CFC data show that the drilling of USW-UZ6 in 1984 has altered the natural system by providing a conduit through the Paintbrush Nonwelded unit, allowing flow from Topopah Spring outcrops in Solitario Canyon on the west to USW-UZ6, upward in the borehole through the Paintbrush, to the shallow Tiva Canyon flow systems, and out of the mountain.
2010-04-01
... INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES... transactions involving controlled corporations. The purpose of this section is to prevent the avoidance of the.... CFC1 is organized in Country X, which imposes a high rate of tax on the income of CFC1. P also wholly...
75 FR 21207 - Medicare Program; Ambulatory Surgical Centers, Conditions for Coverage
2010-04-23
... physician's referral. In addition, we are proposing some other minor changes to the CfC for patient right... current CfC for patient rights to include an exception that would allow an ASC to provide patients or the patients' representative or surrogate with required patient rights information on the day of the procedure...
26 CFR 4.954-1 - Foreign base company income; taxable years beginning after December 31, 1986.
2010-04-01
...), (e), (f), (g), or 953 and the regulations thereunder, and is foreign source general limitation income... income (consisting entirely of foreign source general limitation income) of CFC by $600 for the prior...) Conclusion. Based on these facts, if CFC elects to exclude all items of income subject to a high foreign tax...
77 FR 11651 - Hybrid III 10-Year-Old Child Test Dummy
2012-02-27
... words, chin-to- chest contact often caused HIC to exceed the injury assessment reference value (HIC 36... bag tests).\\19\\ \\19\\ The computation of HIC applies a higher signal filter class (CFC 1000 vs. CFC 180... Dorel provided a picture of a torn bib assembly, without further discussion, in its response to the Part...
International Nuclear Information System (INIS)
Megie, G.
1994-01-01
The ozone sources, roles and distribution are reviewed, and the atmosphere dynamic effects on ozone circulation are discussed; chlorine and CFC are the two main perturbative agents of the ozone layer and their effects are described and analyzed; impacts of the limitation of the CFC and chlorine utilization are discussed. 5 figs., 9 tabs
Directory of Open Access Journals (Sweden)
Diego Lozano-Soldevilla
2016-08-01
Full Text Available Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (> 40 Hz occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC. However, the CFC patterns be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 mg or 1.5 mg of lorazepam (LZP; GABAergic enhancer in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM, we were able to demonstrate that posterior alpha (8 – 12 Hz phase was coupled to beta-low gamma band (20 – 45 Hz amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD. Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs
Interaction of plasma-facing materials with air and steam
International Nuclear Information System (INIS)
Druyts, F.; Fays, J.; Wu, C.H.
2002-01-01
In the design of ITER-FEAT, several candidate materials are foreseen for plasma-facing components of the divertor (tungsten, carbon fibre-reinforced composites (CFC), molybdenum) and the first wall (beryllium). In the view of accidental scenarios such as a loss of coolant accident or a loss of vacuum accident the reaction between these materials and steam or air remains a safety concern. To provide kinetic data, describing the chemical reactivity of plasma-facing materials in air and steam, we used coupled thermogravimetry/quadrupole mass spectrometry. In this paper we present the results of a screening investigation that compares the oxidation rates of tungsten, molybdenum, CFC and beryllium in the temperature range 300-700 deg. C. From the thermogravimetry and mass spectrometry results we obtained the reaction rates as a function of temperature. For the metals tungsten, molybdenum and beryllium, a transition is observed between protective oxidation at lower temperatures and non-protective oxidation at higher temperatures. This transition temperature lies in the range 500-550 deg. C for tungsten and molybdenum, which is lower than for beryllium. At above temperatures 550 deg. C, the oxides formed on molybdenum and tungsten volatilise. This increases the oxidation rate dramatically and can lead to mobilisation of activation products in a fusion reactor. We also performed experiments on both undoped CFC and CFC doped with 8-10% silicon. The influence of silicon doping on the chemical reactivity of CFC's in air is discussed
Dassen, Fania C M; Houben, Katrijn; Jansen, Anita
2015-08-01
Time orientation could play an important role in eating behavior. The current study investigated whether eating behavior is associated with the Consideration of Future Consequences scale (CFC). Specifically, it was examined whether unhealthy eaters consider the future less and are more concerned with immediate gratification. A related measure of time orientation is delay discounting, a process by which a reinforcer becomes less valuable when considered later in time. Recent research argues that the relation between time orientation and health behaviors is measured best at a behavior-specific level. In the current study, we explored the relationships between CFC and discount rate - both general and food-specific - and their influence on healthy eating. Participants with ages 18 to 60 (N = 152; final sample N = 146) filled in an online questionnaire consisting of the CFC, a food-specific version of the CFC (CFC-food), the Monetary Choice Questionnaire (MCQ) and an adapted MCQ version with snack food as a reinforcer. Self-reported healthy eating was positively related to the future subscale (r = .48, p .05). In order to predict behavior, measurements of time orientation should thus be tailored to the behavior of interest. Based on current results, shifting one's concern from the immediate consequences of eating to a more future-oriented perspective may present an interesting target for future interventions aimed at promoting healthy eating and reducing overweight. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Di Pompeo, Christophe
2017-01-01
The objective of the Montreal protocol, adopted in 1987, was to banish the chlorofluorocarbons (CFC) used as refrigerants since the 1930's, as they are responsible for the impoverishment of the ozone layer. While this objective has been met (the ozone layer is progressively restored), substitutes to CFC have been developed; however some of these substitutes, hydro-fluorocarbons, have been proved to be powerful greenhouse gases. The banishment of HFCs has thus been decided, leading to the Kigali amendment to the Montreal protocol. This report explains the CFC and HFC context and issues in details, and presents its examination by the French Commission of Foreign Affairs. The full text of the report is included (in an annex) at the end of the report
Yu, Pingping; Li, Yingzhi; Yu, Xinyi; Zhao, Xin; Wu, Lihao; Zhang, Qinghua
2013-09-24
A combination of vertical polyaniline (PANI) nanowire arrays and nitrogen plasma etched carbon fiber cloths (eCFC) was fabricated to create 3D nanostructured PANI/eCFC composites. The small size of the highly ordered PANI nanowires can greatly reduce the scale of the diffusion length, allowing for the improved utilization of electrode materials. A two-electrode flexible supercapacitor based on PANI/eCFC demonstrates a high specific capacitance (1035 F g(-1) at a current density of 1 A g(-1)), good rate capability (88% capacity retention at 8 A g(-1)), and long-term cycle life (10% capacity loss after 5000 cycles). The lightweight, low-cost, flexible composites are promising candidates for use in energy storage device applications.
Long-term injury in B-lymphocyte precursor cells in repeatedly-irradiated mice
International Nuclear Information System (INIS)
Hendry, J.H.; Clarke, D.; Testa, N.; Kimber, J.
1984-01-01
Mice irradiated with 4 doses of 4,5 Gy X-rays at 3-week intervals, demonstrated long-term proliferative defects in B lymphocytes. There was a reduced mitogenic response to bacterial polysaccharide (30%), a lower concentration (35%) of B-lymphocyte colony-forming cells (BL-CFC) in agar with an increased proportion of clusters (x2), and a reduced concentration (30%) of plaque-forming cells. Grafts of thymocytes were able to restore the levels of BL-CFC in the short term, but in the long term large grafts of femoral marrow cells were much better in restoring the numbers of BL-CFC. The reduced mitogenesis (25%) of splenocytes by concanavalin A and the diminished number of plaque-forming cells, may suggest persistent injury in T-B cell cooperation
Radiation-induced enlargement of granulocytic and macrophage progenitor cells in mouse bone marrow
Energy Technology Data Exchange (ETDEWEB)
Metcalf, D; Johnson, G R; Wilson, J [Walter and Eliza Hall Inst. of Medical Research, Parkville (Australia)
1977-01-01
The peak sedimentation velocity of C/sub 57/BL mouse bone marrow progenitors of granulocytes and macrophages (GM-colony-forming cells, GM-CFC's) increased from 4.3 mm/h to 7 to 8 mm/h by 2 days after 250 rad whole body irradiation and slowly returned to normal over the next 3 weeks. Preliminary irradiation and/or endotoxin injection did not prevent this radiation-induced change. Some change in sedimentation velocity was seen with as little as 100 rad irradiation. Neither buoyant density nor cell cycle changes could account for the sedimentation velocity data which therefore indicate a major volume increase in the GM-CFC's. This size enlargement affected all subpopulations of GM-CFC's which consequently maintained their size relationship with one another.
Carcavilla, Atilano; García-Miñaúr, Sixto; Pérez-Aytés, Antonio; Vendrell, Teresa; Pinto, Isabel; Guillén-Navarro, Encarna; González-Meneses, Antonio; Aoki, Yoko; Grinberg, Daniel; Ezquieta, Begoña
2015-01-20
To describe 11 patients with cardiofaciocutaneous syndrome (CFC) and compare them with 130 patients with other RAS-MAPK syndromes (111 Noonan syndrome patients [NS] and 19 patients with LEOPARD syndrome). Clinical data from patients submitted for genetic analysis were collected. Bidirectional sequencing analysis of PTPN11, SOS1, RAF1, BRAF, and MAP2K1 focused on exons carrying recurrent mutations, and of all KRAS exons were performed. Six different mutations in BRAF were identified in 9 patients, as well as 2 MAP2K1 mutations. Short stature, developmental delay, language difficulties and ectodermal anomalies were more frequent in CFC patients when compared with other neuro-cardio-faciocutaneous syndromes (P<.05). In at least 2 cases molecular testing helped reconsider the diagnosis. CFC patients showed a rather severe phenotype but at least one patient with BRAF mutation showed no developmental delay, which illustrates the variability of the phenotypic spectrum caused by BRAF mutations. Molecular genetic testing is a valuable tool for differential diagnosis of CFC and NS related disorders. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.
Manufacturing and testing of relevant scale mockup based on monoblock concept
International Nuclear Information System (INIS)
Di Pietro, E.; Orsini, A.; Sacchetti, M.; Libera, S.; Cardella, A.; Vieider, G.
1993-01-01
The results obtained from small-scale mockups manufactured on the monoblock design concept have proven that the solution appears promising for a conventional divertor operating with heat fluxes in the range 10 to 15 MW/m 2 with a thermal fatigue cycle exceeding 1000 cycles at full power. The divertor mock-up consists of six half meter-long armored tubes obtained by brazing CFC to TZM molybdenum alloy. Two types of CFC were used to investigate the advantages of 3-d CFCs with respect to more conventional and cheaper 2-d CFC. The brazing process utilizes three variants of a process developed in laboratory trials and based on selected combinations of active braze filler/CFC surface conditioning procedures. The supporting structure is based on the sliding support concept intended to assure a compromise between the requested thermal stability of the component and the buildup of secondary stresses deriving from mechanical constraints. The FE thermal and thermal mechanical analysis of the divertor mockup structure is reported and the critical areas of sliding support are highlighted for comparison with experimental results. The main results of NDE and experimental high heat flux tests are reported and discussed
Friction correction for model ship resistance and propulsion tests in ice at NRC's OCRE-RC
Directory of Open Access Journals (Sweden)
Michael Lau
2018-05-01
Full Text Available This paper documents the result of a preliminary analysis on the influence of hull-ice friction coefficient on model resistance and power predictions and their correlation to full-scale measurements. The study is based on previous model-scale/full-scale correlations performed on the National Research Council - Ocean, Coastal, and River Engineering Research Center's (NRC/OCRE-RC model test data. There are two objectives for the current study: (1 to validate NRC/OCRE-RC's modeling standards in regarding to its practice of specifying a CFC (Correlation Friction Coefficient of 0.05 for all its ship models; and (2 to develop a correction methodology for its resistance and propulsion predictions when the model is prepared with an ice friction coefficient slightly deviated from the CFC of 0.05. The mean CFC of 0.056 and 0.050 for perfect correlation as computed from the resistance and power analysis, respectively, have justified NRC/OCRE-RC's selection of 0.05 for the CFC of all its models. Furthermore, a procedure for minor friction corrections is developed. Keywords: Model test, Ice resistance, Power, Friction correction, Correlation friction coefficient
Energy Technology Data Exchange (ETDEWEB)
Mizuno, K [National Institute for Resources and Environment, Tsukuba (Japan)
1992-07-25
This paper summarizes the current status and the international activities in the technologies to decompose fleon (CFC) which can cause ozone depletion in the stratosphere and global warming. Discussions have been given in Japan on combustion decomposing method as a fleon decomposing technology, which can use generally available incinerators. A plasma decomposition process uses a high-frequency plasma device with an input of 182 kW which can process CFC-12 of 48 kg/h at a decomposition efficiency of 99.99% or higher. A reported catalyst decomposition method uses zeolites, alumina, TiO2-ZrO2-based oxide mixture, and iron oxide carrying activated carbon as catalysts. A super critical water decomposition process is reported capable of decomposing almost completely CFC-11 and CFC-113 at 400[degree]C and 320 or higher atmospheric pressure. The United Nations Environment Programme arranges international cooperations on the stratospheric ozone/fleon problem, and the committee has established an ozone depleting substance (ODS) decomposing technology authorization act. The currently available capacities of decomposing devices are by far lower than the banked ODS amount to be provided to decomposition. 3 refs., 3 figs., 7 tabs.
A high-capacity carbon prepared from renewable chicken feather biopolymer for supercapacitors
Wang, Qiang; Cao, Qi; Wang, Xianyou; Jing, Bo; Kuang, Hao; Zhou, Ling
2013-03-01
Micropopous chicken feather carbon (CFC) severing as electrode materials for the first time is prepared via the activation with KOH agent to different extents. The structure and electrochemical properties of CFC materials are characterized with N2 adsorption/desorption measurements, X-ray diffraction (XRD), transmission electron microscope (TEM), cyclic voltammetry (CV), galvanostatic charge/discharge cycling and electrochemical impedance spectroscopy (EIS). The obtained results show that CFC activated by KOH with KOH/CFC weight ratio of 4/1 (CFCA4) possesses the specific surface area of 1839 m2 g-1, average micropore diameter of 1.863 nm, and exhibits the highest initial specific capacitance of 302 F g-1 at current density of 1 A g-1 in 1 M H2SO4, and that even after 5000 cycles, CFCA4 specific capacitance is still as high as 253 F g-1. Furthermore, CFCA4 also delivers specific capacitance of 181 F g-1 at current density of 5 A g-1 and 168 F g-1 at current density of 10 A g-1. Accordingly, the microporous activated carbon material derived from chicken feather provides favorable prospect in electrode materials application in supercapacitors.
Results of the examinations of the W7-X pre-series target elements
International Nuclear Information System (INIS)
Boscary, J.; Boeswirth, B.; Greuner, H.; Missirlian, M.; Schedler, B.; Scheiber, K.; Schlosser, J.; Streibl, B.
2007-01-01
The target elements of the WENDELSTEIN 7-X (W7-X) divertor are designed to sustain a stationary heat flux of 10 MW/m 2 and to remove a maximum power of 100 kW. CFC Sepcarb NB31 tiles are bonded to a water-cooled CuCrZr heat sink in two steps: active metal casting (AMC) of an AMC -copper interlayer to CFC tiles, electron beam welding (EBW) or hot isostatic pressing (HIP) of the AMC -NB31 tiles to CuCrZr. The fabrication of the whole amount of CFC NB31 has been completed. The key target of the pre-series phase is the qualification of this bond based on a series of examinations. The introduction of silicon during the AMC process significantly improved the strength of the joint between CFC and AMC -copper. The strength of the bond is preserved after either EBW or HIP processes. High heat flux testing carried out in the ion beam facility GLADIS exhibited a too high percentage of defective tiles. Pre-series activities have been extended to reduce the stress concentration at the interface between tiles and heat sink by optimizing the design
Energy Technology Data Exchange (ETDEWEB)
Christian, J.E.; Courville, G.E.; Desjarlais, A.O.; Graves, R.S.; Linkous, R.L.; McElroy, D.L.; Weaver, F.J.; Wendt, R.L.; Yarbrough, D.W.
1993-06-01
This report is a summary of the cooperative industry/government program to establish the viability of alternative blowing agents to chlorofluorocarbons (CFCs). The project was initiated in 1989 following two workshops that focused on needed research on thermal insulation blown with substitutes for CFC-11 and CFC-12. The project is directed by a steering committee of representatives of the sponsors and of Oak Ridge National Laboratory (ORNL). The purpose of the project is to determine if the performance of polyisocyanurate (PIR) roof insulation foam boards blown with alternate agents differs from the performance of boards blown with CFC-1. This report describes apparent thermal conductivity (k) results obtained from field and laboratory tests from 1989 to 1992 on a set of experimental PIR laminate boardstock produced to evaluate the viability of alternative hydrochlorofluorocarbons (HCFCs) as blowing agents. All boardstock was manufactured from similar formulations that were not optimized for thermal performance. Commercial broadstock made in the future may differ in performance from this set. The PIR boards were prepared with CFC-11, HCFC-123, HCFC-141b, and 50/50 and 65/35 blends of HCFC-123/HCFC-141b.
Quitadamo, Paolo; Coccorullo, Paola; Giannetti, Eleonora; Romano, Claudio; Chiaro, Andrea; Campanozzi, Angelo; Poli, Emanuela; Cucchiara, Salvatore; Di Nardo, Giovanni; Staiano, Annamaria
2012-10-01
To compare the effectiveness of a mixture of acacia fiber, psyllium fiber, and fructose (AFPFF) with polyethylene glycol 3350 combined with electrolytes (PEG+E) in the treatment of children with chronic functional constipation (CFC); and to evaluate the safety and effectiveness of AFPFF in the treatment of children with CFC. This was a randomized, open label, prospective, controlled, parallel-group study involving 100 children (M/F: 38/62; mean age ± SD: 6.5 ± 2.7 years) who were diagnosed with CFC according to the Rome III Criteria. Children were randomly divided into 2 groups: 50 children received AFPFF (16.8 g daily) and 50 children received PEG+E (0.5 g/kg daily) for 8 weeks. Primary outcome measures were frequency of bowel movements, stool consistency, fecal incontinence, and improvement of other associated gastrointestinal symptoms. Safety was assessed with evaluation of clinical adverse effects and growth measurements. Compliance rates were 72% for AFPFF and 96% for PEG+E. A significant improvement of constipation was seen in both groups. After 8 weeks, 77.8% of children treated with AFPFF and 83% of children treated with PEG+E had improved (P = .788). Neither PEG+E nor AFPFF caused any clinically significant side effects during the entire course of the study period. In this randomized study, we did not find any significant difference between the efficacy of AFPFF and PEG+E in the treatment of children with CFC. Both medications were proved to be safe for CFC treatment, but PEG+E was better accepted by children. Copyright © 2012 Mosby, Inc. All rights reserved.
Encoding of contextual fear memory requires de novo proteins in the prelimbic cortex
Rizzo, Valerio; Touzani, Khalid; Raveendra, Bindu L.; Swarnkar, Supriya; Lora, Joan; Kadakkuzha, Beena M.; Liu, Xin-An; Zhang, Chao; Betel, Doron; Stackman, Robert W.; Puthanveettil, Sathyanarayanan V.
2016-01-01
Background Despite our understanding of the significance of the prefrontal cortex in the consolidation of long-term memories (LTM), its role in the encoding of LTM remains elusive. Here we investigated the role of new protein synthesis in the mouse medial prefrontal cortex (mPFC) in encoding contextual fear memory. Methods Because a change in the association of mRNAs to polyribosomes is an indicator of new protein synthesis, we assessed the changes in polyribosome-associated mRNAs in the mPFC following contextual fear conditioning (CFC) in the mouse. Differential gene expression in mPFC was identified by polyribosome profiling (n = 18). The role of new protein synthesis in mPFC was determined by focal inhibition of protein synthesis (n = 131) and by intra-prelimbic cortex manipulation (n = 56) of Homer 3, a candidate identified from polyribosome profiling. Results We identified several mRNAs that are differentially and temporally recruited to polyribosomes in the mPFC following CFC. Inhibition of protein synthesis in the prelimbic (PL), but not in the anterior cingulate cortex (ACC) region of the mPFC immediately after CFC disrupted encoding of contextual fear memory. Intriguingly, inhibition of new protein synthesis in the PL 6 hours after CFC did not impair encoding. Furthermore, expression of Homer 3, an mRNA enriched in polyribosomes following CFC, in the PL constrained encoding of contextual fear memory. Conclusions Our studies identify several molecular substrates of new protein synthesis in the mPFC and establish that encoding of contextual fear memories require new protein synthesis in PL subregion of mPFC. PMID:28503670
Direct Neuronal Glucose Uptake Is Required for Contextual Fear Acquisition in the Dorsal Hippocampus
Directory of Open Access Journals (Sweden)
Liang Kong
2017-11-01
Full Text Available The metabolism of glucose is a nearly exclusive source of energy for maintaining neuronal survival, synaptic transmission and information processing in the brain. Two glucose metabolism pathways have been reported, direct neuronal glucose uptake and the astrocyte-neuron lactate shuttle (ANLS, which can be involved in these functions simultaneously or separately. Although ANLS in the dorsal hippocampus (DH has been proved to be required for memory consolidation, the specific metabolic pathway involved during memory acquisition remains unclear. The DH and amygdala are two key brain regions for acquisition of contextual fear conditioning (CFC. In 2-NBDG experiments, we observed that 2-NBDG-positive neurons were significantly increased during the acquisition of CFC in the DH. However, in the amygdala and cerebellum, 2-NBDG-positive neurons were not changed during CFC training. Strikingly, microinjection of a glucose transporter (GLUT inhibitor into the DH decreased freezing values during CFC training and 1 h later, while injection of a monocarboxylate transporter (MCT inhibitor into the amygdala also reduced freezing values. Therefore, we demonstrated that direct neuronal glucose uptake was the primary means of energy supply in the DH, while ANLS might supply energy in the amygdala during acquisition. Furthermore, knockdown of GLUT3 by a lentivirus in the DH impaired the acquisition of CFC. Taken together, the results indicated that there were two different glucose metabolism pathways in the DH and amygdala during acquisition of contextual fear memory and that direct neuronal glucose uptake in the DH may be regulated by GLUT3.
Simulation of dust production in ITER transient events
Energy Technology Data Exchange (ETDEWEB)
Pestchanyi, S. [Forschungszentrum Karlsruhe (Germany)
2007-07-01
The tritium retention problem is a critical issue for the tokamak ITER performance. Tritium is trapped in redeposited T-C layers and at the surface of carbon dust, where it is retained in form of various hydrocarbons. The area of dust surface and hence, the amount of tritium deposited on the surface depends on the dust amount and of the dust sizes. The carbon dust appears as a result of brittle destruction at the surface of the carbon fibre composite (CFC) which is now the reference armour material for the most loaded part of tokamak divertor. Stationary heat flux on the ITER divertor armour does not cause its brittle destruction and does not produce dust. However, according to the modern understanding of tokamak fusion devices performance, the most attractive regime of ITER operation is the ELMy H mode. This regime is associated with a repetitive short time increase of heat flux at the CFC divertor armour of 2-3 orders of magnitude over its stationary value during edge localized modes (ELMs). Under influence of these severe heat shocks CFC armour can crack due to the thermostress, producing a dust of carbon. Besides, a carbon dust produced during disruptions due to brittle destruction of the armour under influence of thermoshock. Most of the modern tokamaks do not produce the ELMs powerful enough to cause CFC brittle destruction at the divertor surface, except of very special regimes in JET. This is why the CFC erosion and dust production could be investigated now only theoretically and experimentally in plasma guns and electron beam facilities. Simulation of the CFC brittle destruction has been done using the code PEGASUS already developed and tested in FZK for simulation of erosion for ITER candidate materials under the heat shocks. After upgrades the code was used for simulation of the amount of carbon dust particles and of the distribution of their sizes. The code has been tested against available experimental data from the plasma gun MK-200UG and from the
Simulation of dust production in ITER transient events
International Nuclear Information System (INIS)
Pestchanyi, S.
2007-01-01
The tritium retention problem is a critical issue for the tokamak ITER performance. Tritium is trapped in redeposited T-C layers and at the surface of carbon dust, where it is retained in form of various hydrocarbons. The area of dust surface and hence, the amount of tritium deposited on the surface depends on the dust amount and of the dust sizes. The carbon dust appears as a result of brittle destruction at the surface of the carbon fibre composite (CFC) which is now the reference armour material for the most loaded part of tokamak divertor. Stationary heat flux on the ITER divertor armour does not cause its brittle destruction and does not produce dust. However, according to the modern understanding of tokamak fusion devices performance, the most attractive regime of ITER operation is the ELMy H mode. This regime is associated with a repetitive short time increase of heat flux at the CFC divertor armour of 2-3 orders of magnitude over its stationary value during edge localized modes (ELMs). Under influence of these severe heat shocks CFC armour can crack due to the thermostress, producing a dust of carbon. Besides, a carbon dust produced during disruptions due to brittle destruction of the armour under influence of thermoshock. Most of the modern tokamaks do not produce the ELMs powerful enough to cause CFC brittle destruction at the divertor surface, except of very special regimes in JET. This is why the CFC erosion and dust production could be investigated now only theoretically and experimentally in plasma guns and electron beam facilities. Simulation of the CFC brittle destruction has been done using the code PEGASUS already developed and tested in FZK for simulation of erosion for ITER candidate materials under the heat shocks. After upgrades the code was used for simulation of the amount of carbon dust particles and of the distribution of their sizes. The code has been tested against available experimental data from the plasma gun MK-200UG and from the
Finite Element Based Design Optimization of WENDELSTEIN 7-X Divertor Targets
International Nuclear Information System (INIS)
Plankensteiner, A.; Leuprecht, A.; Schedler, B.; Scheiber, K.; Greuner, H.
2006-01-01
In the fusion experiment WENDELSTEIN 7-X divertor plasma facing components have to withstand severe loading conditions. In general thermally induced mechanical stressing turns out to be most critical with respect to life time predictions of the component. In the specific case flat tiles of CFC grade NB31 are joined to the precipitation hardened CuCrZr heat sink by employing an active metal cast (AMC)-Cu as an interlayer between CFC and CuCrZr. Residual stresses resulting from the manufacturing process act as initial stresses in the subsequent operational heat flux loading. For the latter loading regime these stresses intrinsically are generated due to the large contrast in the CTE for CFC and Cu. Different design variants of those CFC flat tile armoured target elements have been analysed via the finite element package ABAQUS aiming at derivation of an optimized component design. The numerical study comprises variants with different degrees of tessellation of the CFC flat tile section, orientation of the CFC, lamellar design of the AMC-interlayer, and different designs of the cooling channels. The thermo-mechanical material characteristics are accounted for the finite element models with elastic-plastic properties being assigned to the metallic sections CuCrZr and AMC-Cu, respectively, and orthotropic nonlinear-elastic properties being used to the CFC section. The latter has been realized in form of a user-defined material subroutine that is used at the integration point level of the finite element model. In particular, twelve scalar-type damage parameters obeying their own evolution equations with respect to the loading history account for specific stress-strain relationships in the three principal material directions and planes with six damage parameters being used for normal loading under tensile and compressive stress states, respectively, and six parameters being used for shear loading. For the aim of model verification calculated surface temperatures, global
DEFF Research Database (Denmark)
Kjeldsen, Peter
extremely slowly during use. Therefore, the insulation material will still contain large quantities of CFC when the buildings reach the endof-life and are demolished. The management of C&D waste in relation to controlling the CFC releases is basically unregulated in contrast to end-of-life refrigerators...... activities and obtaining CFC destruction either through foam waste incineration or by controlled microbial processes in landfills receiving the foam waste. There are still a lot of unknown processes and factors that need to be investigated before cost-efficient strategies and technologies are finally......Large quantities of construction and demolition waste (C&D waste) are produced. Buildings in many countries are thermally insulated by insulation foam containing large amounts of CFCs (chlorofluorocarbons), which are both strong ozone depleting substances and greenhouse gases. The CFCs are released...
Directory of Open Access Journals (Sweden)
Bhattacharya A
2016-06-01
Full Text Available Amal Bhattacharya,1 Salil Bhargava,2 Virendra Singh,3 Deepak Talwar,4 Jagdeep Whig,5 Juliet Rebello,6 Shrinivas Purandare,6 Jaideep Gogtay6 1Department of Medicine, MP Shah Medical College, Jamnager, Gujarat, 2Tuberculosis and Chest Diseases, MGM Medical College, Indore, Madhya Pradesh, 3Pulmonary Division, SMS Hospital, Jaipur, Rajasthan, 4Respiratory Diseases, Metro Hospital and Heart Institute, Noida, Uttar Pradesh, 5Department of Medicine, Dayanand Medical College & Hospital, Ludhiana, Punjab, 6Clinical Research Department, Cipla Ltd, Mumbai, Maharashtra, India Background: The use of chlorofluorocarbons (CFCs has contributed to the depletion of the stratospheric ozone layer resulting in serious health concerns. Ipratropium bromide/salbutamol sulphate CFC-pressurized metered-dose inhalers (IB/SAL-CFC pMDI have been in widespread use for many years without any apparent ill consequences. This combination has now been reformulated using the hydrofluoroalkane (HFA propellant. This study sought to establish the clinical noninferiority of a new HFA-containing IB/SAL pMDI to the conventional IB/SAL-CFC pMDI in subjects with mild/moderate COPD.Methods: This was a randomized, double-blind, parallel-group, multicenter study in two consecutive periods: a 14-day run-in period followed by a 85-day treatment period. Eligible mild-to-moderate stable COPD subjects aged 40-75 years were enrolled into the study and entered the run-in period during which subjects withdrew all the bronchodilators, except for salbutamol as rescue medication. Subjects were randomized to 85 days treatment with either IB/SAL-HFA or IB/SAL-CFC, 20 µg qid.Results: Of the 290 randomized patients, 249 completed the study. The primary efficacy variable was the change in forced expiratory volume in one second from predose to 60 minutes after dosing on day 85. At the end of the treatment period, the adjusted mean change in forced expiratory volume in one second at 60 minutes was 123
Energy Technology Data Exchange (ETDEWEB)
Kirillov, V A; Kuvshinov, G G; Mogilnykh, Yu I [Boreskov Institute of Catalysis, Novosibirsk (Russian Federation); Reller, A [University of Hamburg (Germany); Steinfeld, A; Weidenkaff, A; Meier, A [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1999-08-01
Concentrated solar radiation was used as the clean source of process heat for the production of Catalytic Filamentous Carbon (CFC) by thermal decomposition of gaseous hydrocarbons and by CO disproportionation in the presence of small metal catalyst particles. Depending on the catalyst, two different types of CFC, namely nano tubes and nano fibers, were obtained in solar experiments at the PSI solar furnace. (author) 2 figs., 1 tab., 7 refs.
Climate change and ozone layer protection
International Nuclear Information System (INIS)
Anon.
1991-01-01
This conference is composed of 27 communications of which the following main themes are: general approach to the problems of climatic change, greenhouse effect and ozone layer; France, Cameroon and Switzerland examples of energy conservation and greenhouse gas reduction; energy conservation measures and policies for dwellings, transport, industry, agriculture and food industry with a global aspect of reducing greenhouse gas emissions; CFC utilization effects on environment and alternatives to CFC utilization
Lightning protection design and testing of an all composite wet wing for the Egrett
Burrows, B. J. C.; Haigh, S. J.; Chessum, C.; Dunkley, V. P.
1991-01-01
The Egrett aircraft has an all composite wing comprising CFC(carbon fiber composite)/Nomex sandwich skins, full length CFC main spar caps, and GFRP (glass fiber reinforced plastics) main and auxiliary spar webs. It also has short inboard CFC auxiliary spar caps. It has fine aluminum wires woven into the surface for protection. It has an integral fuel tank using the CFC/Nomex skins as the upper and lower tank walls, and lies between the forward auxiliary spar and the forward of the two main spar webs. The fuel tank is not bagged, i.e., it is in effect a wet wing tank. It has conventional capacitive type fuel gauging. The aircraft was cleared to IFR standards and so required full lightning protection and demonstration that it would survive the lightning environment. The lightning protection was designed for the wing (and also for the remainder of the aircraft). An inner wing test samples (which included a part of the fuel tank) were tested as part of the proving program. The protection design and the testing process are described. The intrinsic structural features are indicated that improve lightning protection design and which therefore minimize the weight and cost of any added lightning protection components.
TRENDS 1991: A compendium of data on global change
Energy Technology Data Exchange (ETDEWEB)
Boden, T.A.; Sepanski, R.J.; Stoss, F.W. (eds.)
1991-12-01
This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO{sub 2}) and methane (CH{sub 4}), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N{sub 2}) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N{sub 2}O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO{sub 2} emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO{sub 2} emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center.
TRENDS 1991: A compendium of data on global change
International Nuclear Information System (INIS)
Boden, T.A.; Sepanski, R.J.; Stoss, F.W.
1991-12-01
This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO 2 ) and methane (CH 4 ), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N 2 ) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N 2 O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO 2 emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO 2 emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center
Mining and global environmental challenges
Energy Technology Data Exchange (ETDEWEB)
Greeff, J C; Bailey-McEwan, M [Chamber of Mines of South Africa, Johannesburg (South Africa)
1992-04-01
At least half of South Africa's gold production is presently dependent on CFC11 an CFC12 as refrigerants in water chilling machines used in cooling the underground workings. The South African Government will ratify the revised Montreal Protocol on substances that deplete the ozone layer which will mean CFCs will have to be phased out probably by 1997. HFC134 or HFC22 are possible replacements for CFC but present costs of converting machines are high. The article goes on to discuss the contribution of CFCs and CO{sub 2} to global warming and model simulations and predictions of climate change. Likely effects of growing concern about global warming on the coal mining industry are the possible limitations on the use of coal and the increased need for clean coal technology. 12 refs., 5 figs., 3 tabs.
Directory of Open Access Journals (Sweden)
Schmidt Peter Koerver
2016-11-01
Full Text Available Recently, the controlled foreign company (CFC rules have gained increased attention; as such, rules play an important role in the ongoing efforts of the OECD/G20 and the European Commission with respect to addressing base erosion and profit shifting (BEPS. In this context, the article revisits the CFC regimes of the Nordic countries in order to assess whether these regimes are in line with the recommendations from the OECD/G20 and to determine whether Sweden, Finland, and Denmark, as EU member states, will have to make amendments if the commission’s proposal for an Anti-Tax Avoidance Directive is adopted in its current form. It is concluded that the Nordic CFC regimes in many ways already are in line with the recommendations as well as the directive, but also that certain amendments have to be made.
The 2015 Transition of Wartime Operational Control: A Threat or Opportunity for the ROK /US Alliance
2014-06-13
CFC’s Roles” (Strategic Studies Institute, US Army War College, May 2003), http://www. isn.ethz.ch/ Digital -Library/Publications/Detail/?ots591... merchandise export market (behind Canada, Mexico, and China) and the fourth-largest source for U.S. merchandise imports (behind China, Canada, and Mexico...Exercises, and the CFC’s Roles” (Strategic Studies Institute, US Army War College, May 2003), 88, http://www.isn.ethz.ch/ Digital -Library/Publications/Detail
Directory of Open Access Journals (Sweden)
J. T. Thomas
2008-01-01
Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 yr, and CFC-11 measurements, give a mean residence time of 8 yr for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 yr and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water with mean age 1.2 yr and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusion below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs and allows
International Nuclear Information System (INIS)
Plummer, L.N.; Busenberg, E.; McConnell, J.B.; Drenkard, S.; Schlosser, P.; Michel, R.L.
1998-01-01
The quality of water in the Upper Floridan aquifer near Valdosta, Georgia is affected locally by discharge of Withlacoochee River water through sinkholes in the river bed. Data on transient tracers and other dissolved substances, including Cl - , 3 H, tritiogenic helium-3 ( 3 He), chlorofluorocarbons (CFC-11, CFC-12, CFC-113), organic C (DOC), O 2 (DO), H 2 S, CH 4 , δ 18 O, δD, and 14 C were investigated as tracers of Withlacoochee River water in the Upper Floridan aquifer. The concentrations of all tracers were affected by dilution and mixing. Dissolved Cl - , δ 18 O, δD, CFC-12, and the quantity ( 3 H+ 3 He) are stable in water from the Upper Floridan aquifer, whereas DOC, DO, H 2 S, CH 4 , 14 C, CFC-11, and CFC-113 are affected by microbial degradation and other geochemical processes occurring within the aquifer. Groundwater mixing fractions were determined by using dissolved Cl - and δ 18 O data, recognizing 3 end-member water types in the groundwater mixtures: (1) Withlacoochee River water (δ 18 O=-2.5±0.3per thousand, Cl - =12.2±2 mg/l), (2) regional infiltration water (δ 18 O=-4.2±0.1per thousand, Cl - =2.3±0.1 mg/l), and (3) regional paleowater resident in the Upper Floridan aquifer (δ 18 O=-3.4±0.1per thousand, Cl - =2.6±0.1 mg/l) (uncertainties are ±1σ). Error simulation procedures were used to define uncertainties in mixing fractions. Fractions of river water in groundwater range from 0 to 72% and average 10%. The influence of river-water discharge on the quality of water in the Upper Floridan aquifer was traced from the sinkhole area on the Withlacoochee River 25 km SE in the direction of regional groundwater flow. Infiltration of water is most significant to the N and NW of Valdosta, but becomes negligible to the S and SE in the direction of general thickening of post-Eocene confining beds overlying the Upper Floridan aquifer. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)
Energy Technology Data Exchange (ETDEWEB)
Plummer, L.N.; Busenberg, E. [U.S. Geological Survey, 432 National Center, Reston, VA (United States); McConnell, J.B. [U.S. Geological Survey, 3039 Amwiler Rd., Atlanta, GA (United States); Drenkard, S.; Schlosser, P. [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9W, Palisades, NY (United States); Michel, R.L. [U.S. Geological Survey, Mail Stop 434, 345 Middlefield Road, Menlo Park, CA (United States)
1998-11-01
he quality of water in the Upper Floridan aquifer near Valdosta, Georgia is affected locally by discharge of Withlacoochee River water through sinkholes in the river bed. Data on transient tracers and other dissolved substances, including Cl{sup -}, {sup 3}H, tritiogenic helium-3 ({sup 3}He), chlorofluorocarbons (CFC-11, CFC-12, CFC-113), organic C (DOC), O{sub 2} (DO), H{sub 2}S, CH{sub 4}, {delta}{sup 18}O, {delta}D, and {sup 14}C were investigated as tracers of Withlacoochee River water in the Upper Floridan aquifer. The concentrations of all tracers were affected by dilution and mixing. Dissolved Cl{sup -}, {delta}{sup 18}O, {delta}D, CFC-12, and the quantity ({sup 3}H+{sup 3}He) are stable in water from the Upper Floridan aquifer, whereas DOC, DO, H{sub 2}S, CH{sub 4}, {sup 14}C, CFC-11, and CFC-113 are affected by microbial degradation and other geochemical processes occurring within the aquifer. Groundwater mixing fractions were determined by using dissolved Cl{sup -} and {delta}{sup 18}O data, recognizing 3 end-member water types in the groundwater mixtures: (1) Withlacoochee River water ({delta}{sup 18}O=-2.5{+-}0.3per thousand, Cl{sup -}=12.2{+-}2 mg/l), (2) regional infiltration water ({delta}{sup 18}O=-4.2{+-}0.1per thousand, Cl{sup -}=2.3{+-}0.1 mg/l), and (3) regional paleowater resident in the Upper Floridan aquifer ({delta}{sup 18}O=-3.4{+-}0.1per thousand, Cl{sup -}=2.6{+-}0.1 mg/l) (uncertainties are {+-}1{sigma}). Error simulation procedures were used to define uncertainties in mixing fractions. Fractions of river water in groundwater range from 0 to 72% and average 10%. The influence of river-water discharge on the quality of water in the Upper Floridan aquifer was traced from the sinkhole area on the Withlacoochee River 25 km SE in the direction of regional groundwater flow. Infiltration of water is most significant to theN and NW of Valdosta, but becomes negligible to the S and SE in the direction of general thickening of post-Eocene confining
Association between time perspective and organic food consumption in a large sample of adults.
Bénard, Marc; Baudry, Julia; Méjean, Caroline; Lairon, Denis; Giudici, Kelly Virecoulon; Etilé, Fabrice; Reach, Gérard; Hercberg, Serge; Kesse-Guyot, Emmanuelle; Péneau, Sandrine
2018-01-05
Organic food intake has risen in many countries during the past decades. Even though motivations associated with such choice have been studied, psychological traits preceding these motivations have rarely been explored. Consideration of future consequences (CFC) represents the extent to which individuals consider future versus immediate consequences of their current behaviors. Consequently, a future oriented personality may be an important characteristic of organic food consumers. The objective was to analyze the association between CFC and organic food consumption in a large sample of the adult general population. In 2014, a sample of 27,634 participants from the NutriNet-Santé cohort study completed the CFC questionnaire and an Organic-Food Frequency questionnaire. For each food group (17 groups), non-organic food consumers were compared to organic food consumers across quartiles of the CFC using multiple logistic regressions. Moreover, adjusted means of proportions of organic food intakes out of total food intakes were compared between quartiles of the CFC. Analyses were adjusted for socio-demographic, lifestyle and dietary characteristics. Participants with higher CFC were more likely to consume organic food (OR quartile 4 (Q4) vs. Q1 = 1.88, 95% CI: 1.62, 2.20). Overall, future oriented participants were more likely to consume 14 food groups. The strongest associations were observed for starchy refined foods (OR = 1.78, 95% CI: 1.63, 1.94), and fruits and vegetables (OR = 1.74, 95% CI: 1.58, 1.92). The contribution of organic food intake out of total food intake was 33% higher in the Q4 compared to Q1. More precisely, the contribution of organic food consumed was higher in the Q4 for 16 food groups. The highest relative differences between Q4 and Q1 were observed for starchy refined foods (22%) and non-alcoholic beverages (21%). Seafood was the only food group without a significant difference. This study provides information on the personality of
Souza, Alyson Gomes de; Sousa, Wellington Dantas de; Nascimento, João Carlos Hipólito Bernardes do; Bernardes, Juliana Reis
2017-01-01
The present study sought to analyze adherence to CFC Resolution No. 1429/13 in elaboration and disclosure of Financial Statements by Brazilian clubs. Through a checklist inspired by Raschka, Wallner and Costa (2008), we analyzed this adherence in 2013. We observed that the specific criteria and procedures for the evaluation, accounting records and structuring of the Financial Statements of professional soccer entities 53.04% of the items recommended by CFC Resolution No. 1429/2013. The result...
Make a Difference in 2015 through the Combined Federal Campaign | Poster
By Andrea Frydl, Contributing Writer With the holiday season comes the generous holiday giving spirit. All federal employees are encouraged to give to the Combined Federal Campaign (CFC), the only authorized solicitation of federal employees in their workplace on behalf of approved charitable organizations. The CFC coordinates the fund-raising efforts of various charitable organizations so that federal employees are solicited in the workplace just once a year and have the opportunity to make contributions through payroll deduction.
Erosion of ITER divertor armour and contamination of sol after transient events erosion products
International Nuclear Information System (INIS)
Bazylev, B.N.; Landman, I.S.; Pestchanyi, S.E.
2005-01-01
Plasma impact to the divertor expected in the tokamak ITER during ELMs or disruptions can result in a significant surface damage to CFC- and tungsten armours (brittle destruction and melting respectively) as well as in contamination of SOL by evaporated impurities. Numerical investigations for tungsten and CFC targets provide important details of the material erosion process. The simulations carried out in FZK on the material damage, carbon plasma expansion and the radiation fluxes from the carbon impurity are surveyed
Lehnert, S J; Helou, L; Pitcher, T E; Heath, J W; Heath, D D
2018-01-01
Post-copulatory sexual selection processes, including sperm competition and cryptic female choice (CFC), can operate based on major histocompatibility (MH) genes. We investigated sperm competition between male alternative reproductive tactics [jack (sneaker) and hooknose (guard)] of Chinook salmon (Oncorhynchus tshawytscha). Using a full factorial design, we examined in vitro competitive fertilization success of paired jack and hooknose males at three time points after sperm activation (0, 15 and 60 s) to test for male competition, CFC and time effects on male fertilization success. We also examined egg-mediated CFC at two MH genes by examining both the relationship between competitive fertilization success and MH divergence as well as inheritance patterns of MH alleles in resulting offspring. We found that jacks sired more offspring than hooknose males at 0 s post-activation; however, jack fertilization success declined over time post-activation, suggesting a trade-off between sperm speed and longevity. Enhanced fertilization success of jacks (presumably via higher sperm quality) may serve to increase sneaker tactic competitiveness relative to dominant hooknose males. We also found evidence of egg-mediated CFC (i.e. female × male interaction) influencing competitive fertilization success; however, CFC was not acting on the MH genes as we found no relationship between fertilization success and MH II β 1 or MH I α 1 divergence and we found no deviations from Mendelian inheritance of MH alleles in the offspring. Our study provides insight into evolutionary mechanisms influencing variation in male mating success within alternative reproductive tactics, thus underscoring different strategies that males can adopt to attain success. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.
High RF power test of a lower hybrid module mock-up in Carbon Fiber Composite
International Nuclear Information System (INIS)
Maebara, Sunao; Kiyono, Kimihiro; Seki, Masami
1997-11-01
A mock-up module of a Lower Hybrid Current Drive antenna module of a Carbon Fiber Composite (CFC) was fabricated for the development of heat resistive front facing the plasma. This module is made from CFC plates and rods which are copper coated to reduce the RF losses. The withstand-voltage, the RF properties and outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m 2 were performed with no breakdowns. During these tests, the module temperature was increasing from 100-200degC to 400-500degC. It was also checked that high power density, up to 150 MW/m 2 , could be transmitted when the waveguides are filled with H 2 at a pressure of 5 x 10 -2 Pa. No significant change in the reflection coefficient is measured after the long pulse operation. During a long pulse, the power reflection increases during the pulse typically from 0.8 % to 1.3 %. It is concluded that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of Dispersion Strengthened Copper (DSC) module at the module temperature of 300degC. No significant increase of the global outgassing of the CFC module was measured after hydrogen prefilling. After the test, visual inspection revealed that peeling of the copper coating occurred at one end of the module only on a very small area (0.2 cm 2 ). It is assessed that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)
High RF power test of a lower hybrid module mock-up in carbon fiber composite
International Nuclear Information System (INIS)
Goniche, M.; Bibet, P.; Brossaud, J.; Cano, V.; Froissard, P.; Kazarian, F.; Rey, G.; Maebara, S.; Kiyono, K.; Seki, M.; Suganuma, K.; Ikeda, Y.; Imai, T.
1999-02-01
A mock-up module of a Lower Hybrid Current Drive antenna module of a Carbon Fiber Composite (CFC) was fabricated for the development of heat resistive front facing the plasma. This module is made from CFC plates and rods which are copper coated to reduce the RF losses. The withstand-voltage, the RF properties and outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m 2 were performed with no breakdowns. During these tests, the module temperature was increasing from 100-200 deg. C to 400-500 deg. C. It was also checked that high power density, up to 150 MW/m 2 , could be transmitted when the waveguides are filled with H 2 at a pressure of 5 x 10 -2 Pa. No significant change in the reflection coefficient is measured after the long pulse operation. During a long pulse, the power reflection increases during the pulse typically from 0.8% to 1.3%. It is concluded that the outgassing rate of Cu-plated CFC is about 6 times larger than of Dispersion Strengthened Copper (DSC) module at the module temperature of 300 deg. C. No significant increase of the global outgassing of the CFC module was measured after hydrogen pre-filling. After the test, visual inspection revealed that peeling of the copper coating occurred at one end of the module only on a very small area (0.2 cm 2 ). It is assessed that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (authors)
Directory of Open Access Journals (Sweden)
Su-Hyun Kim
Full Text Available Cav1.3 has been suggested to mediate hippocampal neurogenesis of adult mice and contribute to hippocampal-dependent learning and memory processes. However, the mechanism of Cav1.3 contribution in these processes is unclear. Here, roles of Cav1.3 of mouse dorsal hippocampus during newborn cell development were examined. We find that knock-out (KO of Cav1.3 resulted in the reduction of survival of newborn neurons at 28 days old after mitosis. The retroviral eGFP expression showed that both dendritic complexity and the number and length of mossy fiber bouton (MFB filopodia of newborn neurons at ≥ 14 days old were significantly reduced in KO mice. Both contextual fear conditioning (CFC and object-location recognition tasks were impaired in recent (1 day memory test while passive avoidance task was impaired only in remote (≥ 20 days memory in KO mice. Results using adeno-associated virus (AAV-mediated Cav1.3 knock-down (KD or retrovirus-mediated KD in dorsal hippocampal DG area showed that the recent memory of CFC was impaired in both KD mice but the remote memory was impaired only in AAV KD mice, suggesting that Cav1.3 of mature neurons play important roles in both recent and remote CFC memory while Cav1.3 in newborn neurons is selectively involved in the recent CFC memory process. Meanwhile, AAV KD of Cav1.3 in ventral hippocampal area has no effect on the recent CFC memory. In conclusion, the results suggest that Cav1.3 in newborn neurons of dorsal hippocampus is involved in the survival of newborn neurons while mediating developments of dendritic and axonal processes of newborn cells and plays a role in the memory process differentially depending on the stage of maturation and the type of learning task.
Kim, Su-Hyun; Park, Ye-Ryoung; Lee, Boyoung; Choi, Byungil; Kim, Hyun; Kim, Chong-Hyun
2017-01-01
Cav1.3 has been suggested to mediate hippocampal neurogenesis of adult mice and contribute to hippocampal-dependent learning and memory processes. However, the mechanism of Cav1.3 contribution in these processes is unclear. Here, roles of Cav1.3 of mouse dorsal hippocampus during newborn cell development were examined. We find that knock-out (KO) of Cav1.3 resulted in the reduction of survival of newborn neurons at 28 days old after mitosis. The retroviral eGFP expression showed that both dendritic complexity and the number and length of mossy fiber bouton (MFB) filopodia of newborn neurons at ≥ 14 days old were significantly reduced in KO mice. Both contextual fear conditioning (CFC) and object-location recognition tasks were impaired in recent (1 day) memory test while passive avoidance task was impaired only in remote (≥ 20 days) memory in KO mice. Results using adeno-associated virus (AAV)-mediated Cav1.3 knock-down (KD) or retrovirus-mediated KD in dorsal hippocampal DG area showed that the recent memory of CFC was impaired in both KD mice but the remote memory was impaired only in AAV KD mice, suggesting that Cav1.3 of mature neurons play important roles in both recent and remote CFC memory while Cav1.3 in newborn neurons is selectively involved in the recent CFC memory process. Meanwhile, AAV KD of Cav1.3 in ventral hippocampal area has no effect on the recent CFC memory. In conclusion, the results suggest that Cav1.3 in newborn neurons of dorsal hippocampus is involved in the survival of newborn neurons while mediating developments of dendritic and axonal processes of newborn cells and plays a role in the memory process differentially depending on the stage of maturation and the type of learning task.
International Nuclear Information System (INIS)
Oriya, Asami; Takahashi, Kenji; Kashiwakura, Ikuo; Inanami, Osamu; Kuwabara, Mikinori; Miura, Toshiaki; Abe, Yoshinao
2008-01-01
The aim of this study is to evaluate the individual differences in radiosensitivity of lineage-committed myeloid hematopoietic progenitors, colony-forming cells (CFC), detected in steady-state human peripheral blood (PB). Mononuclear cells were prepared from the buffy-coat of 30 individuals PB, and were assayed for CFC by semi-solid culture supplemented with cytokines. X irradiation was performed in the range of 0.5-4 Gy at a dose rate of about 80 cGy/min. The mean number of hematopoietic progenitor cells is 5866±3408 in 1 ml of buffy-coat, suggesting that the erythroid progenitor cells are the major population. The total CFC radiosensitivity parameter D 0 and n value are 1.18±0.24 and 1.89±0.98, respectively. Using a linear regression analysis, a statistically significant correlation is observed between the D 0 value and the surviving fraction at 4 Gy (r=0.611 p 0 parameter and the level of antioxidants, plasma uric acid, plasma bilirubin, and intracellular glutathione. The present study demonstrates that there are large individual differences in the radiosensitivity of hematopoietic progenitor cells as detected in steady-state human PB. These differences demonstrate almost no correlation with plasma or intracellular antioxidants. The prediction of individual differences in radiosensitivity of CFC can only be measured by 4 Gy irradiation. (author)
Continual low-level MEK inhibition ameliorates cardio-facio-cutaneous phenotypes in zebrafish
Directory of Open Access Journals (Sweden)
Corina Anastasaki
2012-07-01
Cardio-facio-cutaneous (CFC syndrome is caused by germline mutations in KRAS, BRAF and MEK1/2. The highly selective and potent MEK inhibitors that have been developed as anti-cancer agents hold potential as therapeutics for CFC syndrome. We have previously shown that the effects of CFC mutations on zebrafish gastrulation can be prevented by a 1-hour treatment with MEK inhibitors within a specific developmental time-window. However, MEK activity is essential for normal development and PD0325901 treatment outside this treatment window leads to additional developmental defects in MEK-dependent tissues. We now test ten different doses of PD0325901 at six developmental time points and assess the effects on body axis length, heart development and craniofacial structures in zebrafish embryos. Notably, we find that a continuous low-level dose of PD0325901 that has only minor inhibition of MEK activity can prevent the action of both the common CFC BRAFQ257R kinase-active allele and the BRAFG596V kinase-impaired mutant allele through the first 5 days of development. These results provide a detailed study of the effects of PD0325901 in development and show that, unlike in cancer, which requires robust inhibition of MAPK signalling, a partial reduction in phospho-ERK1/2 activity is sufficient to moderate the developmental effects of BRAFCFC mutations.
Zhang, Tianchang; Kim, Christine H J; Cheng, Yingwen; Ma, Yanwen; Zhang, Hongbo; Liu, Jie
2015-02-21
A "top-down" and scalable approach for processing carbon fiber cloth (CFC) into flexible and all-carbon electrodes with remarkable areal capacity and cyclic stability was developed. CFC is commercially available in large quantities but its use as an electrode material in supercapacitors is not satisfactory. The approach demonstrated in this work is based on the sequential treatment of CFC with KOH activation and high temperature annealing that can effectively improve its specific surface area to a remarkable 2780 m(2) g(-1) while at the same time achieving a good electrical conductivity of 320 S m(-1) without sacrificing its intrinsic mechanical strength and flexibility. The processed CFC can be directly used as an electrode for supercapacitors without any binders, conductive additives and current collectors while avoiding elaborate electrode processing steps to deliver a specific capacitance of ∼0.5 F cm(-2) and ∼197 F g(-1) with remarkable rate performance and excellent cyclic stability. The properties of these processed CFCs are comparable or better than graphene and carbon nanotube based electrodes. We further demonstrate symmetric solid-state supercapacitors based on these processed CFCs with very good flexibility. This "top-down" and scalable approach can be readily applied to other types of commercially available carbon materials and therefore can have a substantial significance for high performance supercapacitor devices.
Effects of irradiation and storage on granulocytes harvested by continuous-flow centrifugation
International Nuclear Information System (INIS)
Patrone, F.; Dallegri, F.; Brema, F.; Sacchetti, C.
1979-01-01
Five normal subjects were subjected to leukapheresis by continuous-flow-centrifugation (CFC) in the Aminco Celltrifuge. Granulocyte functional capacities were evaluated on the venous blood samples drawn before apheresis and on the cellrich plasma collected by CFC, immediately after collection and after short-term storage at 4degC with or without previous irradiation (1500 rad, 50 rad/min). The CFC technique has been shown to provide cells without functional damage. Irradiation did not appear to influence granulocyte function, as evaluated by in vitro studies. The data demonstrate that granulocytes maintain, even after irradiation, functional activities similar to those found immediately after collection for up to 24 hours of storage at 4degC and exhibit only a moderate loss of function after 48 h. Chemotaxis appears to be the most sensitive detector of cellular damage of stored granulocytes, either irradiated or non-irradiated; this technique may be the most useful for assessment of granulocyte function before transfusion. (author)
Effects of protein-calorie malnutrition and refeeding on fluorouracil toxicity
Energy Technology Data Exchange (ETDEWEB)
Gamelli, R.L.; Foster, R.S. Jr.
1983-10-01
Mice were used to study the effects of protein-calorie malnutrition and its reversal on granulocyte-macrophage production and fluorouracil's toxic effect on bone marrow. An in vitro quantitative clonal culture technique for bone marrow granulocyte-macrophage progenitor cells (GM-CFC) was used. Animals on a protein-free but otherwise complete diet for ten days had a significant contraction in total marrow cellularity and GM-CFC numbers paralleling the animal's weight loss. The acute toxic effect of fluorouracil on bone marrow was not increased in protein-deprived animals. On refeeding, there was a biphasic response in the degree of toxic effect on marrow. Animals refed for one day had significantly increased fluorouracil-related marrow abnormalities. However, animals refed for four days, when marrows were repleted, were partially protected from the drug's cytotoxic effects. The increased sensitivity in mice refed for one day was related to more GM-CFC in active DNA synthesis.
de Carvalho Myskiw, Jociane; Furini, Cristiane Regina Guerino; Schmidt, Bianca; Ferreira, Flávia; Izquierdo, Ivan
2015-01-13
In the present study we test the hypothesis that extinction is not a consequence of retrieval in unreinforced conditioned stimulus (CS) presentation but the mere perception of the CS in the absence of a conditioned response. Animals with cannulae implanted in the CA1 region of hippocampus were subjected to extinction of contextual fear conditioning. Muscimol infused intra-CA1 before an extinction training session of contextual fear conditioning (CFC) blocks retrieval but not consolidation of extinction measured 24 h later. Additionally, this inhibition of retrieval does not affect early persistence of extinction when tested 7 d later or its spontaneous recovery after 2 wk. Furthermore, both anisomycin, an inhibitor of ribosomal protein synthesis, and rapamycin, an inhibitor of extraribosomal protein synthesis, given into the CA1, impair extinction of CFC regardless of whether its retrieval was blocked by muscimol. Therefore, retrieval performance in the first unreinforced session is not necessary for the installation, maintenance, or spontaneous recovery of extinction of CFC.
International Nuclear Information System (INIS)
Socolof, M.L.; McCold, L.N.; Saylor, R.E.
1997-01-01
Three gaseous diffusion plants (GDPs) for enriching uranium maintain a large inventory of chlorofluorocarbon-114 (CFC-114) as a coolant. To address the continued use of CFC-114, an ozone-depleting substance, the US Department of Energy (DOE) considered introducing perfluorocarbons (PFCs) by the end of 1995. These PFCs would not contribute to stratospheric ozone depletion but would be larger contributors to global warming than would CFC-114. The paper reports the results of an assessment of the global impacts of four alternatives for modifying GDP coolant system operations over a three-year period beginning in 1996. The overall contribution of GDP coolant releases to impacts on ozone depletion and global warming were quantified by parameters referred to as ozone-depletion impact and global-warming impact. The analysis showed that these parameters could be used as surrogates for predicting global impacts to all resources and could provide a framework for assessing environmental impacts of a permanent coolant replacement, eliminating the need for subsequent resource-specific analyses
Rhythmic Working Memory Activation in the Human Hippocampus
Directory of Open Access Journals (Sweden)
Marcin Leszczyński
2015-11-01
Full Text Available Working memory (WM maintenance is assumed to rely on a single sustained process throughout the entire maintenance period. This assumption, although fundamental, has never been tested. We used intracranial electroencephalography (EEG recordings from the human hippocampus in two independent experiments to investigate the neural dynamics underlying WM maintenance. We observed periodic fluctuations between two different oscillatory regimes: Periods of “memory activation” were reflected by load-dependent alpha power reductions and lower levels of cross-frequency coupling (CFC. They occurred interleaved with periods characterized by load-independent high levels of alpha power and CFC. During memory activation periods, a relevant CFC parameter (load-dependent changes of the peak modulated frequency correlated with individual WM capacity. Fluctuations between these two periods predicted successful performance and were locked to the phase of endogenous delta oscillations. These results show that hippocampal maintenance is a dynamic rather than constant process and depends critically on a hierarchy of oscillations.
Directory of Open Access Journals (Sweden)
M. Shao
2011-05-01
Full Text Available Using a GC/FID/MS system, we analyzed the mixing ratio of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD region of southern China. The results revealed that there are elevated mixing ratios for most of halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE, CH2Cl2 (dichloromethane, DCM, CH3 Br (bromomethane, HCFC-22, CHCl3 (trichloromethane, CCl4 (tetrachloromethane, Cl2C = CCl2 (perchloroethylene, PCE, CH3CCl3 (methyl chloroform, MCF, and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in mixing ratios (relative standard deviation ranged from 9.31 % to 96.55 % of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO was examined, and then the emission of each halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg, CH3CCl3 (6.7 Gg, and Cl2C = CCl2 (2.3 Gg accounted for about 62.9 % of total halocarbon emissions, it suggested a significant contribution from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg, an alternative refrigerant to chlorofluorocarbons (CFCs, were about 2.3 times greater than those of CFC-12 (1.6 Gg. CFC-12 and HCFC-22 accounted for 21.5 % of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of CFCs, such as CFC-11, and the emission of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl
76 FR 55424 - CFC-50 Commission
2011-09-07
... conclude its work in approximately six months. 11. Termination. March 31, 2012. 12. Membership and... administrators of the campaign, participating charities and watchdog groups. These members will consist of both... Agency's approval, are responsible for directing the work of the Commission, including the creation of...
New possibilities for non-CFC refrigeration
International Nuclear Information System (INIS)
Lorentzen, G.; Pettersen, J.
1992-01-01
There is a widespread belief that the only viable refrigerants in most applications are new fluorocarbon chemicals. This trend will eventually result in emissions of several hundred thousand tons of new chemicals to the atmosphere each year, involving potential risk of unforeseen environmental effects. A number of other options exist, or may be developed. By using substances which already have a natural role in our ecosystems, some uncertainty related to the critical issue of our future environment can be avoided. By development and practical testing of a laboratory prototype it has been documented that carbon dioxide is a viable refrigerant in automobile air conditioners, completely solving all environmental problems associated with such systems. General use of CO 2 as a refrigerant may provide a number of advantages in the present situation, both from an environmental and practical point of view. It is our considered opinion that the old carbon dioxide offers a key to the complete solution of the environmental problems in many areas of refrigeration usage. 19 refs., 8 figs., 5 tabs
Cook, Peter; Dogramaci, Shawan; McCallum, James; Hedley, Joanne
2017-01-01
Determining groundwater ages from environmental tracer concentrations measured on samples obtained from open bores or long-screened intervals is fraught with difficulty because the sampled water represents a variety of ages. A multi-tracer technique (Cl, 14C, 3H, CFC-11, CFC-12, CFC-113 and SF6) was used to decipher the groundwater ages sampled from long-screened production bores in a regional aquifer around an open pit mine in the Pilbara region of northwest Australia. The changes in tracer concentrations due to continuous dewatering over 7 years (2008-2014) were examined, and the tracer methods were compared. Tracer concentrations suggest that groundwater samples are a mixture of young and old water; the former is inferred to represent localised recharge from an adjacent creek, and the latter to be diffuse recharge. An increase in 14C activity with time in wells closest to the creek suggests that dewatering of the open pit to achieve dry mining conditions has resulted in change in flow direction, so that localised recharge from the creek now forms a larger proportion of the pumped groundwater. The recharge rate prior to development, calculated from a steady-state Cl mass balance, is 6 mm/y, and is consistent with calculations based on the 14C activity. Changes in CFC-12 concentrations with time may be related to the change in water-table position relative to the depth of the well screen.
Activated Braf induces esophageal dilation and gastric epithelial hyperplasia in mice.
Inoue, Shin-Ichi; Takahara, Shingo; Yoshikawa, Takeo; Niihori, Tetsuya; Yanai, Kazuhiko; Matsubara, Yoichi; Aoki, Yoko
2017-12-01
Germline mutations in BRAF are a major cause of cardio-facio-cutaneous (CFC) syndrome, which is characterized by heart defects, characteristic craniofacial dysmorphology and dermatologic abnormalities. Patients with CFC syndrome also commonly show gastrointestinal dysfunction, including feeding and swallowing difficulties and gastroesophageal reflux. We have previously found that knock-in mice expressing a Braf Q241R mutation exhibit CFC syndrome-related phenotypes, such as growth retardation, craniofacial dysmorphisms, congenital heart defects and learning deficits. However, it remains unclear whether BrafQ241R/+ mice exhibit gastrointestinal dysfunction. Here, we report that BrafQ241R/+ mice have neonatal feeding difficulties and esophageal dilation. The esophagus tissues from BrafQ241R/+ mice displayed incomplete replacement of smooth muscle with skeletal muscle and decreased contraction. Furthermore, the BrafQ241R/+ mice showed hyperkeratosis and a thickened muscle layer in the forestomach. Treatment with MEK inhibitors ameliorated the growth retardation, esophageal dilation, hyperkeratosis and thickened muscle layer in the forestomach in BrafQ241R/+ mice. The esophageal dilation with aberrant skeletal-smooth muscle boundary in BrafQ241R/+ mice were recovered after treatment with the histone H3K27 demethylase inhibitor GSK-J4. Our results provide clues to elucidate the pathogenesis and possible treatment of gastrointestinal dysfunction and failure to thrive in patients with CFC syndrome. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
International Nuclear Information System (INIS)
Zhao Xiangyang; Duan Huabo; Li Jinhui
2011-01-01
Chlorofluorocarbons (CFCs) contained in household refrigerators consist mainly of CFC-11 and CFC-12, which will be eventually released into the environment. Consequentially, environmental releases of these refrigerants will lead to ozone depletion and contribute significantly to the greenhouse effect, if waste refrigerators are not disposed of properly. In the present paper, the potential release of residual CFCs and their substitutes from obsolete household refrigerators in China is examined, and their contributions to ozone depletion and greenhouse effect are compared with those of other recognized ozone-depleting substances (ODS) and greenhouse gases (GHGs). The results imply that annual potential amounts of released residual CFC-11 and CFC-12 will reach their maximums at 4600 and 2300 tons, respectively in 2011, and then decrease gradually to zero until 2020. Meanwhile, the amounts of their most widely used substitutes HCFC-141b and HFC-134a will keep increasing. Subsequently, the contribution ratio of these CFCs and their substitutes to ozone depletion will remain at 25% through 2011, and reach its peak value of 34% by 2018. The contribution to greenhouse effect will reach its peak value of 0.57% by 2010. Moreover, the contribution ratio of these CFCs to the total global release of CFCs will steadily increase, reaching its peak of 15% by 2018. Thus, this period from 2010 to 2018 is a crucial time during which residual CFCs and their substitutes from obsolete household refrigerators in China will contribute significantly to ozone depletion.
Baseline Estimation and Outlier Identification for Halocarbons
Wang, D.; Schuck, T.; Engel, A.; Gallman, F.
2017-12-01
The aim of this paper is to build a baseline model for halocarbons and to statistically identify the outliers under specific conditions. In this paper, time series of regional CFC-11 and Chloromethane measurements was discussed, which taken over the last 4 years at two locations, including a monitoring station at northwest of Frankfurt am Main (Germany) and Mace Head station (Ireland). In addition to analyzing time series of CFC-11 and Chloromethane, more importantly, a statistical approach of outlier identification is also introduced in this paper in order to make a better estimation of baseline. A second-order polynomial plus harmonics are fitted to CFC-11 and chloromethane mixing ratios data. Measurements with large distance to the fitting curve are regard as outliers and flagged. Under specific requirement, the routine is iteratively adopted without the flagged measurements until no additional outliers are found. Both model fitting and the proposed outlier identification method are realized with the help of a programming language, Python. During the period, CFC-11 shows a gradual downward trend. And there is a slightly upward trend in the mixing ratios of Chloromethane. The concentration of chloromethane also has a strong seasonal variation, mostly due to the seasonal cycle of OH. The usage of this statistical method has a considerable effect on the results. This method efficiently identifies a series of outliers according to the standard deviation requirements. After removing the outliers, the fitting curves and trend estimates are more reliable.
Mek1Y130C mice recapitulate aspects of human cardio-facio-cutaneous syndrome
Aoidi, Rifdat; Houde, Nicolas; Landry-Truchon, Kim; Holter, Michael; Jacquet, Kevin; Charron, Louis; Yu, Benjamin D.; Rauen, Katherine A.; Bisson, Nicolas; Newbern, Jason
2018-01-01
ABSTRACT The RAS/MAPK signaling pathway is one of the most investigated pathways, owing to its established role in numerous cellular processes and implication in cancer. Germline mutations in genes encoding members of the RAS/MAPK pathway also cause severe developmental syndromes collectively known as RASopathies. These syndromes share overlapping characteristics, including craniofacial dysmorphology, cardiac malformations, cutaneous abnormalities and developmental delay. Cardio-facio-cutaneous syndrome (CFC) is a rare RASopathy associated with mutations in BRAF, KRAS, MEK1 (MAP2K1) and MEK2 (MAP2K2). MEK1 and MEK2 mutations are found in ∼25% of the CFC patients and the MEK1Y130C substitution is the most common one. However, little is known about the origins and mechanisms responsible for the development of CFC. To our knowledge, no mouse model carrying RASopathy-linked Mek1 or Mek2 gene mutations has been reported. To investigate the molecular and developmental consequences of the Mek1Y130C mutation, we generated a mouse line carrying this mutation. Analysis of mice from a Mek1 allelic series revealed that the Mek1Y130C allele expresses both wild-type and Y130C mutant forms of MEK1. However, despite reduced levels of MEK1 protein and the lower abundance of MEK1 Y130C protein than wild type, Mek1Y130C mutants showed increased ERK (MAPK) protein activation in response to growth factors, supporting a role for MEK1 Y130C in hyperactivation of the RAS/MAPK pathway, leading to CFC. Mek1Y130C mutant mice exhibited pulmonary artery stenosis, cranial dysmorphia and neurological anomalies, including increased numbers of GFAP+ astrocytes and Olig2+ oligodendrocytes in regions of the cerebral cortex. These data indicate that the Mek1Y130C mutation recapitulates major aspects of CFC, providing a new animal model to investigate the physiopathology of this RASopathy. This article has an associated First Person interview with the first author of the paper. PMID:29590634
Climate control of decadal-scale increases in apparent ages of eogenetic karst spring water
Martin, Jonathan B.; Kurz, Marie J.; Khadka, Mitra B.
2016-09-01
Water quantity and quality in karst aquifers may depend on decadal-scale variations in recharge or withdrawal, which we hypothesize could be assessed through time-series measurements of apparent ages of spring water. We tested this hypothesis with analyses of various age tracers (3H/3He, SF6, CFC-11, CFC-12, CFC-113) and selected solute concentrations [dissolved oxygen (DO), NO3, Mg, and SO4] from 6 springs in a single spring complex (Ichetucknee springs) in northern Florida over a 16-yr period. These springs fall into two groups that reflect shallow short (Group 1) and deep long (Group 2) flow paths. Some tracer concentrations are altered, with CFC-12 and CFC-113 concentrations yielding the most robust apparent ages. These tracers show a 10-20-yr monotonic increase in apparent age from 1997 to 2013, including the flood recession that followed Tropical Storm Debby in mid-2012. This increase in age indicates most water discharged during the study period recharged the aquifer within a few years of 1973 for Group 2 springs and 1980 for Group 1 springs. Inverse correlations between apparent age and DO and NO3 concentrations reflect reduced redox state in older water. Positive correlations between apparent age and Mg and SO4 concentrations reflect increased water-rock reactions. Concentrated recharge in the decade around 1975 resulted from nearly 2 m of rain in excess of the monthly average that fell between 1960 and 2014, followed by a nearly 4 m deficit to 2014. This excess rain coincided with two major El Niño events during the maximum cool phase in the Atlantic Multidecadal Oscillation. Although regional water withdrawal increased nearly 5-fold between 1980 and 2005, withdrawals represent only 2-5% of Ichetucknee River flow and are less important than decadal-long variations in precipitation. These results suggest that groundwater management should consider climate cycles as predictive tools for future water resources.
Directory of Open Access Journals (Sweden)
C. Servais
2008-10-01
Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and -12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10% above 20 km altitude, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences
Halon-1301, a new Groundwater Age Tracer
Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna
2015-04-01
Groundwater dating is an important tool to assess groundwater resources in regards to direction and time scale of groundwater flow and recharge and to assess contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However ambiguous age interpretations are often faced, due to a limited set of available tracers and limitations of each tracer method when applied alone. There is a need for additional, complementary groundwater age tracers. We recently discovered that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate [Beyer et al, 2014]. Halon-1301 can be determined along with SF6, SF5CF3 and CFC-12 in groundwater using a gas chromatography setup with attached electron capture detector developed by Busenberg and Plummer [2008]. Halon-1301 has not been assessed in groundwater. This study assesses the behaviour of Halon-1301 in water and its suitability as a groundwater age tracer. We determined Halon-1301 in 17 groundwater and various modern (river) waters sites located in 3 different groundwater systems in the Wellington Region, New Zealand. These waters have been previously dated with tritium, CFC-12, CFC-11 and SF6 with mean residence times ranging from 0.5 to over 100 years. The waters range from oxic to anoxic and some show evidence of CFC contamination or degradation. This allows us to assess the different properties affecting the suitability of Halon-1301 as groundwater age tracer, such as its conservativeness in water and local contamination potential. The samples are analysed for Halon-1301 and SF6simultaneously, which allows identification of issues commonly faced when using gaseous tracers such as contamination with modern air during sampling. Overall we found in the assessed groundwater samples Halon-1301 is a feasible new groundwater tracer. No sample indicated significantly elevated
Ceramic composites for near term reactor application - HTR2008-58050
International Nuclear Information System (INIS)
Snead, L. L.; Katoh, Y.; Windes, W. E.; Shinavski, R. J.; Burchell, T. D.
2008-01-01
Currently, two composites types are being developed for in-core application: carbon fiber carbon composite (CFC), and silicon carbide fiber composite (SiC/SiC.) Irradiation effects studies have been carried out over the past few decades yielding radiation-tolerant CFC's and a composite of SiC/SiC with no apparent degradation in mechanical properties to very high neutron exposure. While CFC's can be engineered with significantly higher thermal conductivity, and a slight advantage in manufacturability than SiC/SiC, they do have a neutron irradiation-limited lifetime. The SiC composite, while possessing lower thermal conductivity (especially following irradiation), appears to have mechanical properties insensitive to irradiation. Both materials are currently being produced to sizes much larger than that considered for nuclear application. In addition to materials aspects, results of programs focusing on practical aspects of deploying composites for near-term reactors will be discussed. In particular, significant progress has been made in the fabrication, testing, and qualification of composite gas-cooled reactor control rod sheaths and the ASTM standardization required for eventual qualification. (authors)
Thermal response of plasma sprayed tungsten coating to high heat flux
International Nuclear Information System (INIS)
Liu, X.; Yang, L.; Tamura, S.; Tokunaga, K.; Yoshida, N.; Noda, N.; Xu, Z.
2004-01-01
In order to investigate the thermal response of tungsten coating on carbon and copper substrates by vacuum plasma spray (VPS) or inert gas plasma spray (IPS), annealing and cyclic heat load experiments of these coatings were conducted. It is indicated that the multi-layered tungsten and rhenium interface of VPS-W/CFC failed to act as a diffusion barrier at elevated temperature and tungsten carbides were developed after 1 h incubation time when annealing temperature was higher than 1600 deg. C. IPS-W/Cu and W/C without an intermediate bonding layer were failed by the detachment of the tungsten coating at 900 and 1200 deg. C annealing for several hours, respectively. Cyclic heat load of electron beam with 35 MW/m 2 and 3-s pulse duration indicated that IPS-W/Cu samples failed with local detachment of the tungsten coating within 200 cycles and IPS-W/C showed local cracks by 300 cycles, but VPS-W/CFC withstood 1000 cycles without visible damages. However, crack creation and propagation in VPS-W/CFC were also observed under higher heat load
International Nuclear Information System (INIS)
Demuynck, H.; Dexter, T.M.; Testa, N.G.; Pettengell, R.; Campos, E. de
1992-01-01
After treatment of patients with intermediate or high grade non-Hodgkin lymphoma with chemotherapy plus G-CSF the numbers of haemopoietic progenitor cells in the circulation increased to a mean of 226-fold for mixed CFC (Mix-CFC), 278-fold for GM-CFC and 29-fold for erythroid burst forming unit (BFU-E). The mean increase was modest (7-12-fold) for patients treated with chemotherapy alone. Peripheral blood mononuclear cells harvested at the time of the peak in the numbers of progenitors, or 2-4 days before the peak, seeded onto irradiated marrow stroma in vitro, repopulated the stroma and generated active haemopoiesis at least as effectively as bone marrow cells on a cell per cell basis. This is in contrast to the poor repopulating capacity of pretreatment blood. The results indicate that not only the progenitor cells, but also the repopulating stem cells migrated into the blood after chemotherapy plus G-CSF in sufficient numbers to allow harvesting and successful grafting without the possible complication of late haemopoietic failure. (author)
Seffner, Fernando; Garcia, Jonathan; Muñoz-Laboy, Miguel; Parker, Richard
2011-01-01
The Casa Fonte Colombo (CFC) is a religious organisation that assists people living with HIV/AIDS (PLWHA). The funding for its activities comes from public sources such as the Brazilian National STD/AIDS Program as well as the Catholic Church. Capuchin (Franciscan) priests run the CFC, and it has an extensive group of volunteers made up mostly of women. Between 2006 and 2009, we observed daily life at the Casa Fonte Colombo and interviewed priests, volunteers, employees, service providers, and clients. We also attended meetings, group sessions, and celebrations. Everyday actions carried out by the CFC reveal the efforts to resolve the tension between the position of the Catholic Church and the Brazilian state in the politics of AIDS. These efforts affirm that the Casa Fonte Colombo presents itself as a space where the position of the Catholic Church, as much as the politics of public health, are re-worked, giving way to a progressive act of Catholic prevention and assistance for AIDS, that we call “theology of prevention.” PMID:21834734
Pambo, Kennedy O; Okello, Julius J; Mbeche, Robert M; Kinyuru, John N; Alemu, Mohammed H
2018-04-01
Studies suggest that consumer' acceptance of edible insects can be enhanced by processing and blending them with familiar food products. This is however, expected to result in changes in some sensory attributes. In this study, we investigated how consumers evaluate the appropriateness of sensory attributes of a common bakery product (buns) that was blended with cricket-flour i.e., cricket-flour-containing (CFC) buns. We also tested whether provision of information can modulate the sensory evaluations, personal involvement and emotions. The study is based on a field experiment involving 432 participants drawn from rural communities in Kenya. Participants were randomly assigned to 3 information treatment groups: i) Control group - received only general information, ii) Treatment 1 - received general information and information about the benefits (i.e., positive attributes), iii) Treatment 2 - received general information and information about the potential drawbacks (i.e., negative attributes). Participants evaluated the CFC buns before and after tasting using Just-About-Right (JAR) scale. Results indicate that providing product information affected sensory evaluation of the product's sensory attributes. They also indicate that actual tasting of the CFC buns improved the convergence of sensory evaluation of the attributes towards the ideal level. Results further show that CFC buns elicited more positive feelings with little differences in the emotional profiles between the information treatments, which suggests general interest in the buns. These results provide useful insights on how to enhance consumer acceptance of insect-based foods. We discuss the implications of the findings. Copyright © 2018 Elsevier Ltd. All rights reserved.
Narrowing the uncertainty for deep-ocean injection efficiency
Energy Technology Data Exchange (ETDEWEB)
Orr, J.C.; Aumont, O. [Laboratoire des Sciences du Climat et de l' Environnement, CEA-CNRS, Gif-sur-Yvette (France); Yool, A. [Southampton Oceanography Centre, Southampton (United Kingdom); Plattner, G.K.; Joos, F. [Bern Univ., Bern (Switzerland). Physics Inst.; Maier-Reimer, E. [Max Planck Inst. fuer Meteorologie, Hamburg (Germany); Weirig, M.F.; Schlitzer, R. [Alfred Wegener Inst. for Polar and Marine Research, Bremerhaven (Germany); Caldeira, K.; Wickett, M.E. [Lawrence Livermore National Laboratory, CA (United States); Matear, R.J. [Australian Commonwealth Scientific and Research Organization, Hobart (Australia); Mignone, B.K.; Sarmiento, J.L. [Princeton Univ., Princeton, NJ (United States). AOS Program
2005-07-01
Ten ocean general circulation models (OCGMs) were compared as part of an international study investigating the ocean's ability to efficiently sequester carbon dioxide (CO{sub 2}). The models were selected for their ability to simulate radiocarbon and CFC-11. All of the model simulations neglected the influence of marine biota, and the simulations used only dissolved inorganic carbon (DIC) as a tracer in order to conserve computing resources. The models were integrated using standard ocean carbon-cycle model intercomparison project (OCMIP) formulations for gas exchange boundary conditions to obtain pre-industrial conditions. All models used the same predefined atmospheric CO{sub 2} records compiled from 1765 to 2000, as well as future scenarios in which atmospheric CO{sub 2} was stabilized at 650 ppm. Injections occurred over a period of 100 years. Results of the study showed that global budgets for CFC-11 and radiocarbon were correlated with global efficiencies for a 3000 m injection simulation. The 3000 m injection efficiency was then correlated with the global mean for deep natural radiocarbon. Results showed that simultaneously accounting for constraints from both CFC-11 and natural radiocarbon narrowed the range for a 3000 m injection efficiency in the year 2500 by a factor of 4. The study showed that models must be able to simulate global inventories for CFC-11 as well as global means for radiocarbon in deep ocean scenarios in order to be credible. It was concluded that models using both constraints will more accurately simulate global injection efficiencies.
Poppelaars, Eefje S; Harrewijn, Anita; Westenberg, P Michiel; van der Molen, Melle J W
2018-05-17
Cross-frequency coupling (CFC) between frontal delta (1-4 Hz) and beta (14-30 Hz) oscillations has been suggested as a candidate neural correlate of social anxiety disorder, a disorder characterized by fear and avoidance of social and performance situations. Prior studies have used amplitude-amplitude correlation (AAC) as a CFC measure and hypothesized it as a candidate neural mechanism of affective control. However, using this metric has yielded inconsistent results regarding the direction of CFC, and the functional significance of coupling strength is uncertain. To offer a better understanding of CFC in social anxiety, we compared frontal delta-beta AAC with phase-amplitude coupling (PAC) - a mechanism for information transfer through neural circuits. Twenty high socially anxious (HSA) and 32 low socially anxious (LSA) female undergraduates participated in a social performance task (SPT). Delta-beta PAC and AAC were estimated during the resting state, as well as the anticipation and recovery conditions. Results showed significantly more AAC in LSA than HSA participants during early anticipation, as well as significant values during all conditions in LSA participants only. PAC did not distinguish between LSA and HSA participants, and instead was found to correlate with state nervousness during early anticipation, but in LSA participants only. Together, these findings are interpreted to suggest that delta-beta AAC is a plausible neurobiological index of adaptive stress regulation and can distinguish between trait high and low social anxiety during stress, while delta-beta PAC might be sensitive enough to reflect mild state anxiety in LSA participants.
DEFF Research Database (Denmark)
Schmidt, Peter Koerver
2016-01-01
Recently, the controlled foreign company (CFC) rules have gained increased attention; as such, rules play an important role in the ongoing efforts of the OECD/G20 and the European Commission with respect to addressing base erosion and profit shifting (BEPS). In this context, the article revisits...... the CFC regimes of the Nordic countries in order to assess whether these regimes are in line with the recommendations from the OECD/G20 and to determine whether Sweden, Finland, and Denmark, as EU member states, will have to make amendments if the commission’s proposal for an Anti-Tax Avoidance Directive...
Tungsten and beryllium armour development for the JET ITER-like wall project
International Nuclear Information System (INIS)
Maier, H.; Hirai, T.; Rubel, M.; Neu, R.; Mertens, Ph.; Greuner, H.; Hopf, Ch.; Matthews, G.F.; Neubauer, O.; Piazza, G.; Gauthier, E.; Likonen, J.; Mitteau, R.; Maddaluno, G.; Riccardi, B.; Philipps, V.; Ruset, C.; Lungu, C.P.; Uytdenhouwen, I.
2007-01-01
For the ITER-like wall project at JET the present main chamber CFC tiles will be exchanged with Be tiles and in parallel a fully tungsten-clad divertor will be prepared. Therefore three R and D programmes were initiated: Be coatings on Inconel as well as Be erosion markers were developed for the first wall of the main chamber. High heat flux screening and cyclic loading tests carried out on the Be coatings on Inconel showed excellent performance, above the required power and energy density. For the divertor a conceptual design for a bulk W horizontal target plate was investigated, with the emphasis on minimizing electromagnetic forces. The design consisted of stacks of W lamellae of 6 mm width that were insulated in the toroidal direction. High heat flux tests of a test module were performed with an electron beam at an absorbed power density up to 9 MW m -2 for more than 150 pulses and finally with increasing power loads leading to surface temperatures in excess of 3000 0 C. No macroscopic failure occurred during the test while SEM showed the development of micro-cracks on the loaded surface. For all other divertor parts R and D was performed to provide the technology to coat the 2-directional CFC material used at JET with thin tungsten coatings. The W-coated CFC tiles were subjected to heat loads with power densities ranging up to 23.5 MW m -2 and exposed to cyclic heat loading for 200 pulses at 10.5 MW m -2 . All coatings developed cracks perpendicular to the CFC fibres due to the stronger contraction of the coating upon cool-down after the heat pulses
New Delivery Systems and Propellants
Directory of Open Access Journals (Sweden)
Myrna Dolovich
1999-01-01
Full Text Available The removal of chlorofluorocarbon (CFC propellants from industrial and household products has been agreed to by over 165 countires of which more than 135 are developing countries. The timetable for this process is outlined in the Montreal Protocol on Substances that Deplete the Ozone Layer document and in several subsequent amendments. Pressured metered dose inhalers (pMDIs for medical use have been granted temporary exemptions until replacement formulations, providing the same medication via the same route, and with the same efficacy and safety profiles, are approved for human use. Hydrofluoroalkanes (HFAs are the alternative propellants for CFCs-12 and -114. Their potential for damage to the ozone layer is nonexistent, and while they are greenhouse gases, their global warming potential is a fraction (one-tenth of that of CFCs. Replacement formulations for almost all inhalant respiratory medications have been or are being produced and tested; in Canada, it is anticipated that the transition to these HFA or CFC-free pMDIs will be complete by the year 2005. Initially, an HFA pMDI was to be equivalent to the CFC pMDI being replaced, in terms of aerosol properties and effective clinical dose. However, this will not necessarily be the situation, particularly for some corticosteroid products. Currently, only one CFC-free formulation is available in Canada – Airomir, a HFA salbutamol pMDI. This paper discusses the in vitro aerosol characteristics, in vivo deposition and clinical data for several HFA pMDIs for which there are data available in the literature. Alternative delivery systems to the pMDI, namely, dry powder inhalers and nebulizers, are briefly reviewed.
Fang, Ton; Kasbi, Kamillia; Rothe, Stephanie; Aziz, Wajeeha; Giese, K Peter
2017-09-01
The hippocampus and amygdala are essential brain regions responsible for contextual fear conditioning (CFC). The autophosphorylation of alpha calcium-calmodulin kinase II (αCaMKII) at threonine-286 (T286) is a critical step implicated in long-term potentiation (LTP), learning and memory. However, the changes in αCaMKII levels with aging and training in associated brain regions are not fully understood. Here, we studied how aging and training affect the levels of phosphorylated (T286) and proportion of phosphorylated:total αCaMKII in the hippocampus and amygdala. Young and aged mice, naïve (untrained) and trained in CFC, were analysed by immunohistochemistry for the levels of total and phosphorylated αCaMKII in the hippocampus and amygdala. We found that two hours after CFC training, young mice exhibited a higher level of phosphorylated and increased ratio of phosphorylated:total αCaMKII in hippocampal CA3 stratum radiatum. Furthermore, aged untrained mice showed a higher ratio of phosphorylated:total αCaMKII in the CA3 region of the hippocampus when compared to the young untrained group. No effect of training or aging were seen in the central, lateral and basolateral amygdala regions, for both phosphorylated and ratio of phosphorylated:total αCaMKII. These results show that aging impairs the training-induced upregulation of autophosphorylated (T286) αCaMKII in the CA3 stratum radiatum of the hippocampus. This indicates that distinct age-related mechanisms underlie CFC that may rely more heavily on NMDA receptor-dependent plasticity in young age. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.
Tungsten and beryllium armour development for the JET ITER-like wall project
Maier, H.; Hirai, T.; Rubel, M.; Neu, R.; Mertens, Ph.; Greuner, H.; Hopf, Ch.; Matthews, G. F.; Neubauer, O.; Piazza, G.; Gauthier, E.; Likonen, J.; Mitteau, R.; Maddaluno, G.; Riccardi, B.; Philipps, V.; Ruset, C.; Lungu, C. P.; Uytdenhouwen, I.; EFDA contributors, JET
2007-03-01
For the ITER-like wall project at JET the present main chamber CFC tiles will be exchanged with Be tiles and in parallel a fully tungsten-clad divertor will be prepared. Therefore three R&D programmes were initiated: Be coatings on Inconel as well as Be erosion markers were developed for the first wall of the main chamber. High heat flux screening and cyclic loading tests carried out on the Be coatings on Inconel showed excellent performance, above the required power and energy density. For the divertor a conceptual design for a bulk W horizontal target plate was investigated, with the emphasis on minimizing electromagnetic forces. The design consisted of stacks of W lamellae of 6 mm width that were insulated in the toroidal direction. High heat flux tests of a test module were performed with an electron beam at an absorbed power density up to 9 MW m-2 for more than 150 pulses and finally with increasing power loads leading to surface temperatures in excess of 3000 °C. No macroscopic failure occurred during the test while SEM showed the development of micro-cracks on the loaded surface. For all other divertor parts R&D was performed to provide the technology to coat the 2-directional CFC material used at JET with thin tungsten coatings. The W-coated CFC tiles were subjected to heat loads with power densities ranging up to 23.5 MW m-2 and exposed to cyclic heat loading for 200 pulses at 10.5 MW m-2. All coatings developed cracks perpendicular to the CFC fibres due to the stronger contraction of the coating upon cool-down after the heat pulses.
Cardio-facio-cutaneous syndrome: does genotype predict phenotype?
Allanson, Judith E; Annerén, Göran; Aoki, Yoki; Armour, Christine M; Bondeson, Marie-Louise; Cave, Helene; Gripp, Karen W; Kerr, Bronwyn; Nystrom, Anna-Maja; Sol-Church, Katia; Verloes, Alain; Zenker, Martin
2011-05-15
Cardio-facio-cutaneous (CFC) syndrome is a sporadic multiple congenital anomalies/mental retardation condition principally caused by mutations in BRAF, MEK1, and MEK2. Mutations in KRAS and SHOC2 lead to a phenotype with overlapping features. In approximately 10–30% of individuals with a clinical diagnosis of CFC, a mutation in one of these causative genes is not found. Cardinal features of CFC include congenital heart defects, a characteristic facial appearance, and ectodermal abnormalities. Additional features include failure to thrive with severe feeding problems, moderate to severe intellectual disability and short stature with relative macrocephaly. First described in 1986, more than 100 affected individuals are reported. Following the discovery of the causative genes, more information has emerged on the breadth of clinical features. Little, however, has been published on genotype–phenotype correlations. This clinical study of 186 children and young adults with mutation-proven CFC syndrome is the largest reported to date. BRAF mutations are documented in 140 individuals (approximately 75%), while 46 (approximately 25%) have a mutation in MEK 1 or MEK 2. The age range is 6 months to 32 years, the oldest individual being a female from the original report [Reynolds et al. (1986); Am J Med Genet 25:413–427]. While some clinical data on 136 are in the literature, 50 are not previously published. We provide new details of the breadth of phenotype and discuss the frequency of particular features in each genotypic group. Pulmonary stenosis is the only anomaly that demonstrates a statistically significant genotype–phenotype correlation, being more common in individuals with a BRAF mutation.
Sinclair, Sarina K; Bell, Spencer; Epperson, Richard Tyler; Bloebaum, Roy D
2013-05-01
To gain an understanding of the vertebral cortical endplate and factors that may affect the ability to achieve skeletal attachment to intervertebral implants and fusion, this study aimed to characterize the hypermineralized tissue on the cortical endplate of the vertebral body on a commonly used animal model. Skeletally mature sheep were injected with tetracycline prior to euthanasia and the C2-C3, T5-T6, and L2-L3 spinal motion segments were excised and prepared. Vertebral tissues were imaged using backscatter electron (BSE) imaging, histology, and tetracycline labeling was used to assess bone remodeling within different tissue layers. It was determined that the hypermineralized tissue layer was calcified fibrocartilage (CFC). No tetracycline labels were identified in the CFC layer, in contrast to single and double labels that were present in the underlying bone, indicating the CFC present on the cortical endplate was not being actively remodeled. The average thickness of the CFC layer was 146.3 ± 70.53 µm in the cervical region, 98.2 ± 40.29 µm in the thoracic region, and 150.89 ± 69.25 µm in the lumbar region. This difference in thickness may be attributed to the regional biomechanical properties of the spine. Results from this investigation indicate the presence of a nonremodeling tissue on the cortical endplate of the vertebral body in sheep spines, which attaches the intervertebral disc to the vertebrae. This tissue, if not removed, would likely prevent successful bony attachment to an intervertebral device in spinal fusion studies and total disc replacement surgeries. Copyright © 2013 Wiley Periodicals, Inc.
Test of 1D carbon-carbon composite prototype tiles for the SPIDER diagnostic calorimeter
Serianni, G.; Pimazzoni, A.; Canton, A.; Palma, M. Dalla; Delogu, R.; Fasolo, D.; Franchin, L.; Pasqualotto, R.; Tollin, M.
2017-08-01
Additional heating will be provided to the thermonuclear fusion experiment ITER by injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction at Consorzio RFX in Padova (Italy), the production of negative ions will be studied and optimised. To this purpose the STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) diagnostic will be used to characterise the SPIDER beam during short operation (several seconds) and to verify if the beam meets the ITER requirement regarding the maximum allowed beam non-uniformity (below ±10%). The most important measurements performed by STRIKE are beam uniformity, beamlet divergence and stripping losses. The major components of STRIKE are 16 1D-CFC (Carbon matrix-Carbon Fibre reinforced Composite) tiles, observed at the rear side by a thermal camera. The requirements of the 1D CFC material include a large thermal conductivity along the tile thickness (at least 10 times larger than in the other directions); low specific heat and density; uniform parameters over the tile surface; capability to withstand localised heat loads resulting in steep temperature gradients. So 1D CFC is a very anisotropic and delicate material, not commercially available, and prototypes are being specifically realised. This contribution gives an overview of the tests performed on the CFC prototype tiles, aimed at verifying their thermal behaviour. The spatial uniformity of the parameters and the ratio between the thermal conductivities are assessed by means of a power laser at Consorzio RFX. Dedicated linear and non-linear simulations are carried out to interpret the experiments and to estimate the thermal conductivities; these simulations are described and a comparison of the experimental data with the simulation results is presented.
Final report on CCQM-P151: Halocarbons in dry whole air
Rhoderick, George; Guenther, Franklin; Duewer, David; Lee, Jeongsoon; Seog Kim, Jin; Hall, Bradley; Weiss, Ray; Harth, Christina; Reimann, Stefan; Vollmer, Martin
2014-01-01
The growing awareness of climate change/global warming and continuing concerns regarding stratospheric ozone depletion will require future measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track and control the emissions of these species globally in the atmosphere, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. This report describes the results of a pilot study between National Metrology Institutes and atmospheric research laboratories for several of the more important halocarbons at atmospheric concentration levels. The comparison includes the chlorofluorocarbons (CFCs) dichlorodifluoromethane (CFC 12), trichlorofluoromethane (CFC 11), and 1,1,2-trichlorotrifluoroethane (CFC 113); the hydrochlorofluorocarbons (HCFCs) chlorodifluoromethane (HCFC 22) and 1-chloro-1,1-difluoroethane (HCFC 142b); and the hydrofluorocarbon (HFC) 1,1,1,2-tetrafluoroethane (HFC 134a), all in a dried whole air sample. The objective of this key comparison is to compare the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. Main text. To reach the main text of this paper, click on Final Report. The final report has been peer-reviewed and approved for publication by the CCQM.
Energy Technology Data Exchange (ETDEWEB)
Hashimoto, K.; Hasegawa, H.; Saikawa, M.; Iwatsubo, T.; Mimaki, T. [Central Research Institute of Electric Power Industry, Tokyo (Japan)
1996-03-01
Performance of two-stage compression and cascade heating heat pump cycle was evaluated in the case using alternative refrigerant, HFC-134a, instead of CFC-12 through calculations and experiments. Heat source and heat load temperature conditions of CFC-12, HFC-134a, and HCFC-22 were calculated. As a result, this cycle provided equivalent coefficient of performance to use of CFC-12 and HCFC-22. Especially for HFC-134a, discharge gas temperature from compressor was much lower than that of the others, which prevented the heat decomposition of refrigerant. It was found that HFC-134a was suitable refrigerant for high temperature output equipment like this cycle. To grasp the possibility of hot water supply at 65 {degree}C and behavior of lubricating oil which can not be obtained only from calculations, applicability of HFC-134a was investigated. Experiments were conducted using a small test apparatus with electric input of 2 kW. As a result, satisfactory performance was obtained for each evaluation item. Applicability of HFC-134a to the two-stage compression cycle was confirmed. 9 refs., 21 figs., 16 tabs.
Impact of cryopreservation on tetramer, cytokine flow cytometry, and ELISPOT
Directory of Open Access Journals (Sweden)
Morse Michael A
2005-07-01
Full Text Available Abstract Background Cryopreservation of PBMC and/or overnight shipping of samples are required for many clinical trials, despite their potentially adverse effects upon immune monitoring assays such as MHC-peptide tetramer staining, cytokine flow cytometry (CFC, and ELISPOT. In this study, we compared the performance of these assays on leukapheresed PBMC shipped overnight in medium versus cryopreserved PBMC from matched donors. Results Using CMV pp65 peptide pool stimulation or pp65 HLA-A2 tetramer staining, there was significant correlation between shipped and cryopreserved samples for each assay (p ≤ 0.001. The differences in response magnitude between cryopreserved and shipped PBMC specimens were not significant for most antigens and assays. There was significant correlation between CFC and ELISPOT assay using pp65 peptide pool stimulation, in both shipped and cryopreserved samples (p ≤ 0.001. Strong correlation was observed between CFC (using HLA-A2-restricted pp65 peptide stimulation and tetramer staining (p Conclusion We conclude that all three assays show concordant results on shipped versus cryopreserved specimens, when using a peptide-based readout. The assays are also concordant with each other in pair wise comparisons using equivalent antigen systems.
Design of the inboard passive stabilizer for TPX
International Nuclear Information System (INIS)
Hoffmann, E.; Boonstra, R.; Baxi, C.B.; Chin, E.; Drees, L.; Lee, W.; Redler, K.L.; Reis, E.E.; Bialek, J.
1995-01-01
The Inboard Passive Stabilizer (IPS) is part of the plasma stabilizing system built into the TPX. Its purpose is to provide passive stabilization of the plasma vertical instability on short time scales. With carbon fiber composite (CFC) armor tiles it serves as a startup limiter, protects the vacuum vessel from radiation heat load during steady state operation and also functions as Neutral Beam armor. The inboard passive stabilizer is a saddle coil, constructed of a ring of copper plates, armored with CFC tiles, that surrounds the inner vacuum vessel at the midplane. The design of the plates, the support structure, cooling lines, CFC tiles and tile attach method is described. Tiles that experience only the normal heat load of 0.4 MW/m 2 are attached with mechanical fasteners. Tiles in the neutral beam shine through area are exposed to as much as 1.7 MW/m 2 and are brazed to the IPS. Significant forces are generated in the plates by the stabilization currents as well as during the frequent bakeout cycles. These plates are required to be fully remotely handled, including tile replacement, and the influence of this requirement on the design is discussed
Thermodynamic comparision of R744/R600a and R744/R600 used in mid-high temperature heat pump system
Directory of Open Access Journals (Sweden)
Fan Xiao-Wei
2014-01-01
Full Text Available The mid-high temperature heat pump provides hot water at a relatively high temperature using some industrial waste heat as its source. Now, the main refrigerants in this application are CFC114, HCFC123, and HCFC142b, etc., which are scheduled to be phased out due to their high ozone depletion potential and global warmth potential. Some studies have been conducted to find an eco-friendly alternative. In this paper, the natural non-azeotropic mixtures R744/R600a and R744/R600 are analyzed as alternatives. The performance of the heat pump system using new mixture is discussed and compared with those with CFC114, HCFC123, and HCFC142b. Under the given operating conditions, the maximum heating COP should occur at the mass fractions of 18/82 for R744/R600a and 10/90 for R744/R600. Both of their COP are higher than those with the refrigerants of CFC114, HCFC123, and HCFC142b. The COP and volumetric heating capacity of the system with R744/R600a are superior to those with R744/R600.
International Nuclear Information System (INIS)
Nudo, L.
1993-01-01
Methyl chloroform and CFC-113 ascended in the cleaning hierarchy as versatile, aggressive, yet safe parts cleaners. Now the U.S. Environmental Protection Agency and its global equivalents want these choice solvents to step down. Saddled with an ozone depletion potential higher than anybody cares to talk about, regulators put methyl chloroform (MCF or 1,1,1-trichloroethane) and CFC-113 (trichlorotrifluoroethane) on a list of chlorofluorocarbons (CFCs) slated for phase-out by Jan. 1, 1996. The phase-out bans production and imports of the blacklisted parts cleaners. But as production declines, the cost of cleaning components with an ozone-depleter gets prohibitive. The steep federal excise tax, shorten shelf-life of CFCs and new labeling rule are reason enough to stop using MCF and CFC-113 and start looking at alternative cleaning processes. The labeling rule mandates warning labels on any component ''manufactured with or containing'' an ozone-depleter as of May 15, 1993. There are no acceptable ''drop-in'' alternatives. Even trichloroethylene (TCE), perchloroethylene (PERC) and methylene chloride (MC) require some equipment modifications. There are plenty of other cleaning alternatives vying for the parts-cleaning throne
Armour, C M; Allanson, J E
2008-04-01
Cardio-facio-cutaneous syndrome (CFC) is a multiple congenital anomaly/mental retardation syndrome named because of a characteristic facies, cardiac anomalies, and ectodermal abnormalities. While considerable literature describes the main features, few studies have documented the frequencies of less common features allowing a greater appreciation of the full phenotype. We have analysed clinical data on 38 individuals with CFC and a confirmed mutation in one of the genes known to cause the condition. We provide data on well-established features, and those that are less often described. Polyhydramnios (77%) and prematurity (49%) were common perinatal issues. 71% of individuals had a cardiac anomaly, the most common being pulmonary valve stenosis (42%), hypertrophic cardiomyopathy (39%), and atrial septal defect (28%). Hair anomalies were also typical: 92% had curly hair, 84% sparse hair, and 86% absent or sparse eyebrows. The most frequent cutaneous features were keratosis pilaris (73%), hyperkeratosis (61%) and nevi (76%). Significant and long lived gastrointestinal dysmotility (71%), seizures (49%), optic nerve hypoplasia (30%) and renal anomalies, chiefly hydronephrosis (20%), were among the less well known issues reported. This study reports a broad range of clinical issues in a large cohort of individuals with molecular confirmation of CFC.
Development of plasma facing components for fusion experimental reactors
Energy Technology Data Exchange (ETDEWEB)
Onozuka, M.; Fujiya, Y.; Inoue, M.; Morimoto, M. [Mitsubishi Heavy Industries, Ltd., Yokohama (Japan)
1995-12-31
The divertor structure and fabrication process have been investigated, including the structures of the divertor elements and support, fundamental brazing techniques, brazing of large divertor tiles and fabrication method of large divertor modules. Using direct brazing, a partial divertor module with large CFC tiles was fabricated and tested. It was shown that the model had sufficient structural integrity against thermal shocks of {approximately}17MW/m{sup 2} {times} 4 sec for up to 1,600 times. A fabrication technique for large and complex-shaped divertor module has been developed and successfully applied to a 1m-long linear and 0.8m-long curved divertor modules. In addition, preliminary investigation of direct brazing of beryllium to the copper substrate has been conducted. It was found that the bending strength of the bonded materials was around 40 MPa. Furthermore, boron coating on the CFC and Mo has been examined. Using the boron ion implantation technique, boron ions were implanted to the CFC and Mo plates prior to the boron atoms deposition. The samples fabricated with this method were found to have a sufficient thermal shock resistance.
International Nuclear Information System (INIS)
Clough, S.A.
1993-01-01
In the present study we are studying the effects of including carbon dioxide, ozone, methane, and the halocarbons in addition to water vapor in the radiating atmosphere. The study has focused on two principal issues: the effect on the spectral fluxes and cooling rates of carbon dioxide, ozone and the halocarbons at 1990 concentration levels and the change in fluxes and cooling rates as a consequence of the anticipated ten year change in the profiles of these species. For the latter study the water vapor profiles have been taken as invariant in time. The radiative line-by-line calculations using LBLRTM (Line-By-Line Radiative Transfer Model) have been performed for tropical (TRP), mid-latitude winter (MLW) and mid-latitude summer (MLS) model atmospheres. The halocarbons considered in the present study are CCl 4 , CFC-11, CFC-12 and CFC-22. In addition to considering the radiative effects of carbon dioxide at 355 ppM, the assumed current level, we have also obtained results for doubled carbon dioxide at 710 ppM. An important focus of the current research effort is the effect of the ozone depletion profile on atmospheric radiative effects
Replacement Technologies for Precision Cleaning of Aerospace Hardware for Propellant Service
Beeson, Harold; Kirsch, Mike; Hornung, Steven; Biesinger, Paul
1997-01-01
The NASA White Sands Test Facility (WSTF) is developing cleaning and verification processes to replace currently used chlorofluorocarbon-l13- (CFC-113-) based processes. The processes being evaluated include both aqueous- and solvent-based techniques. Replacement technologies are being investigated for aerospace hardware and for gauges and instrumentation. This paper includes the findings of investigations of aqueous cleaning and verification of aerospace hardware using known contaminants, such as hydraulic fluid and commonly used oils. The results correlate nonvolatile residue with CFC 113. The studies also include enhancements to aqueous sampling for organic and particulate contamination. Although aqueous alternatives have been identified for several processes, a need still exists for nonaqueous solvent cleaning, such as the cleaning and cleanliness verification of gauges used for oxygen service. The cleaning effectiveness of tetrachloroethylene (PCE), trichloroethylene (TCE), ethanol, hydrochlorofluorocarbon 225 (HCFC 225), HCFC 141b, HFE 7100(R), and Vertrel MCA(R) was evaluated using aerospace gauges and precision instruments and then compared to the cleaning effectiveness of CFC 113. Solvents considered for use in oxygen systems were also tested for oxygen compatibility using high-pressure oxygen autogenous ignition and liquid oxygen mechanical impact testing.
Simulation of dust production in ITER transient events
International Nuclear Information System (INIS)
Pestchanyi, S.E.; Landman, I.S.
2008-01-01
Dust production from the divertor armour during edge-localised modes (ELMs) has been investigated. Analysis of available experimental data on the dust particle production and the particles distribution on size for the MPG-8 graphite and for NB31 carbon fibre composite (CFC) under the disruption-like surface heat load allowed revealing the unknown mechanical parameters of the NB31 CFC. Using these data the code PEGASUS-3D has been fitted and verified for simulation of the dust production by ELMs. First simulation of the dust production for the ELM of 1 MJ/m 2 heat load and 0.5 ms time duration has been calculated
Simulation of dust production in ITER transient events
Energy Technology Data Exchange (ETDEWEB)
Pestchanyi, S.E. [Forschungszentrum Karlsruhe, Institute for Pulsed Power and Microwave Technology, P.B. 3640, D-76021 Karlsruhe (Germany)], E-mail: sergey.pestchanyi@ihm.fzk.de; Landman, I.S. [Forschungszentrum Karlsruhe, Institute for Pulsed Power and Microwave Technology, P.B. 3640, D-76021 Karlsruhe (Germany)
2008-12-15
Dust production from the divertor armour during edge-localised modes (ELMs) has been investigated. Analysis of available experimental data on the dust particle production and the particles distribution on size for the MPG-8 graphite and for NB31 carbon fibre composite (CFC) under the disruption-like surface heat load allowed revealing the unknown mechanical parameters of the NB31 CFC. Using these data the code PEGASUS-3D has been fitted and verified for simulation of the dust production by ELMs. First simulation of the dust production for the ELM of 1 MJ/m{sup 2} heat load and 0.5 ms time duration has been calculated.
Pilot retrofit test of refrigerant R-134a for GDSCC
Albus, J.; Brown, B.; Dungao, M.; Spencer, G.
1994-01-01
NASA has issued an interim policy requiring all of its Centers to eliminate consumption (purchase) of stratospheric ozone-depleting substances, including chlorofluorocarbons (CFC's), by 1995. Also, plans must be outlined for the eventual phase out of their usage. The greatest source of CFC consumption and usage at the Goldstone Deep Space Communications Complex is refrigerant R-12, which is used in many of the facility's air-conditioning systems. A pilot retrofit test shows that retrofitting R-12 air-conditioning systems with hydrofluorocarbon R-13a would be a workable means to comply with the R-12 portion of NASA's policy. Results indicate acceptable cost levels and nearly equivalent system performance.
Shapiro, S.D.; Busenberg, E.; Focazio, M.J.; Plummer, Niel
2004-01-01
Analyses of samples of untreated ground water from 413 community-, non-community- (such as restaurants), and domestic-supply wells throughout the US were used to determine the frequency of detection of halogenated volatile organic compounds (VOCs) in drinking-water sources. The VOC data were compiled from archived chromatograms of samples analyzed originally for chlorofluorocarbons (CFCs) by purge-and-trap gas chromatography with an electron-capture detector (GC-ECD). Concentrations of the VOCs could not be ascertained because standards were not routinely analyzed for VOCs other than trichloromonofluoromethane (CFC-11), dichlorodifluoromethane (CFC-12) and 1,1,2-trichloro-1,2,2-trifluoroethane (CFC-113). Nevertheless, the peak areas associated with the elution times of other VOCs on the chromatograms can be classified qualitatively to assess concentrations at a detection limit on the order of parts per quadrillion. Three or more VOCs were detected in 100% (percent) of the chromatograms, and 77.2% of the samples contained 10 or more VOCs. The maximum number of VOCs detected in any sample was 24. Modeled ground-water residence times, determined from concentrations of CFC-12, were used to assess historical trends in the cumulative occurrence of all VOCs detected in this analysis, as well as the occurrence of individual VOCs, such as CFC-11, carbon tetrachloride (CCl4), chloroform and tetrachloroethene (PCE). The detection frequency for all of the VOCs detected has remained relatively constant from approximately 1940 to 2000; however, the magnitude of the peak areas on the chromatograms for the VOCs in the water samples has increased from 1940 to 2000. For CFC-11, CCl4, chloroform and PCE, small peaks decrease from 1940 to 2000, and large peaks increase from 1940 to 2000. The increase in peak areas on the chromatograms from analyses of more recently recharged water is consistent with reported increases in atmospheric concentrations of the VOCs. Approximately 44% and 6
Energy Technology Data Exchange (ETDEWEB)
Zuercher, O.; Favrat, D.; Thome, J. R.; Kattan, N.; Nidegger, E. [Ecole polytechnique federale, Lab. d` energetique industrielle, Lausanne (Switzerland)
1996-11-15
The substitution of CFC refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, requires good methods for predicting heat transfer of substitute fluids. The measurements in the LENI test facility (concentric tubes with water flowing in a counter-current flow) with HFC 407C, HFC 134a, HCFC 123, HFC 404a and HFC/HCFC 402A provide a new data bank for new refrigerants, and allow a coherent comparison with old refrigerants CFC 11, CFC 12, CFC/HCFC 502 and with existing correlations. The existing correlations were found to be inadequate. Because of this work, an improved flow pattern map and flow boiling model were developed, which resulted in a substantial progress in the accurate predict of heat transfer in plain, horizontal tubes for refrigerants without oil. The Kattan et al. correlation was programmed to calculate and compare predicted heat transfer coefficients to the new HFC 407C test data. The flow pattern map proposed by Kattan et al. was also programmed and compared to flow regimes observed for HFC 407C. It predicted the HFC 407C flow pattern data quite accurately. The original objective of the HFC 407C measurements was the validation of the Kattan et al. correlation applied to a zeotropic refrigerant blend. Local flow boiling heat transfer coefficients were measured for HFC 407C evaporating inside a microfin and a plain tube. In addition, microfin heat transfer augmentation relative to a plain tube was investigated. The presence of oil in the evaporator had a complex effect on heat transfer coefficients. Local flow boiling heat transfer coefficients were measured for refrigerant HFC 407C ester oil mixtures (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of zeotropic refrigerant blends and lubricating oils was also developed. (author) figs., tabs., 14 refs.
Overview of co-deposition and fuel inventory in castellated divertor structures at JET
International Nuclear Information System (INIS)
Rubel, M.J.; Coad, J.P.; Pitts, R.A.
2007-01-01
The main focus of this work is fuel retention in plasma components of the JET water-cooled Mk-I divertors operated with small tiles, first with carbon fibre composite (CFC) and then with castellated beryllium. Until recently these have been the only large-scale structures of this type used in fusion experiments. Three issues regarding fuel retention and material migration are addressed: (i) accumulation in gaps separating tiles and in the grooves of castellation; (ii) comparison of deposition on carbon and beryllium; (iii) in-depth migration of deuterium into the bulk of CFC. The essential results are summarised as follows: (i) co-deposition occurs up to a few cm deep in the gaps between the Mk-I tiles; (ii) fuel inventory in the CFC tile gaps exceeds that on plasma-facing surfaces by up to a factor of 2; (iii) in gaps between the beryllium tiles from the inner divertor corner the fuel content reaches 30% of that on plasma-facing surfaces, whereas in the grooves of castellation in Be the fuel content is less than 3.0% of that found on the top surface; (iv) fuel inventory on the Be tiles is strongly associated with the carbon co-deposition; (v) the D content measured in the bulk (1.5 mm below the surface) on cleaved CFC tiles exceeds 1 x 10 15 cm -2 . Implications of these results for a next-step device are addressed and the transport mechanism into the gaps is briefly discussed. The results presented here suggest that in a machine with non-carbon walls in the main chamber (as foreseen for ITER) the material transport and subsequent fuel inventory in the castellation would be reduced
Sampling efficiency of modified 37-mm sampling cassettes using computational fluid dynamics.
Anthony, T Renée; Sleeth, Darrah; Volckens, John
2016-01-01
In the U.S., most industrial hygiene practitioners continue to rely on the closed-face cassette (CFC) to assess worker exposures to hazardous dusts, primarily because ease of use, cost, and familiarity. However, mass concentrations measured with this classic sampler underestimate exposures to larger particles throughout the inhalable particulate mass (IPM) size range (up to aerodynamic diameters of 100 μm). To investigate whether the current 37-mm inlet cap can be redesigned to better meet the IPM sampling criterion, computational fluid dynamics (CFD) models were developed, and particle sampling efficiencies associated with various modifications to the CFC inlet cap were determined. Simulations of fluid flow (standard k-epsilon turbulent model) and particle transport (laminar trajectories, 1-116 μm) were conducted using sampling flow rates of 10 L min(-1) in slow moving air (0.2 m s(-1)) in the facing-the-wind orientation. Combinations of seven inlet shapes and three inlet diameters were evaluated as candidates to replace the current 37-mm inlet cap. For a given inlet geometry, differences in sampler efficiency between inlet diameters averaged less than 1% for particles through 100 μm, but the largest opening was found to increase the efficiency for the 116 μm particles by 14% for the flat inlet cap. A substantial reduction in sampler efficiency was identified for sampler inlets with side walls extending beyond the dimension of the external lip of the current 37-mm CFC. The inlet cap based on the 37-mm CFC dimensions with an expanded 15-mm entry provided the best agreement with facing-the-wind human aspiration efficiency. The sampler efficiency was increased with a flat entry or with a thin central lip adjacent to the new enlarged entry. This work provides a substantial body of sampling efficiency estimates as a function of particle size and inlet geometry for personal aerosol samplers.
International Nuclear Information System (INIS)
Bierkens, J.G.; Hendry, J.H.; Testa, N.G.
1991-01-01
Injury inflicted upon the bone marrow stroma following whole-body irradiation and its repair over a 1-year period has been assessed in murine long-term bone marrow cultures established at increasing time intervals after irradiation. Different doses at different dose rates (10 Gy at 0.05 cGy/min, 4.5 Gy and 10 Gy at 1.6 cGy/min, and 4 x 4.5 Gy [3 weeks between doses] at 60 cGy/min) were chosen so as to maximize differences in effect in the stroma. The cellularity of the adherent layer in long-term cultures established 1 month after irradiation was reduced by 40%-90% depending on the dose and dose rate. Simultaneous with the poor ability of the marrow to form adherent layers, the cumulative spleen colony-forming unit (CFU-S) and granulocyte-macrophage colony-forming cell (GM-CFC) production over a 7-week period was reduced to 0% and 30% of control cultures, respectively. The slow recovery of the adherent layer was paralleled by an increase in the numbers of CFU-S and GM-CFC in the supernatant. Cultures established from repeatedly irradiated mice performed poorly over the entire 1-year period. Whereas the regeneration of the stroma was near complete 1 year after irradiation, the CFU-S and GM-CFC levels reached only between 50% and 80% of control cultures, respectively. Also, the concentration of CFU-S and GM-CFC in the supernatant remained persistently lower in cultures established from irradiated mice as compared to control cultures. The levels of sulfated glycosaminoglycans, which have been implicated in the establishment of the functional integrity of the microenvironment, were not reduced in the adherent layers at any time after irradiation. These results indicate that the regeneration of the stroma is accompanied by an incomplete recovery of active hemopoiesis in vitro
Directory of Open Access Journals (Sweden)
Stavros I Dimitriadis
2015-10-01
Full Text Available The detection of mild cognitive impairment (MCI, the transitional stage between normal cognitive changes of aging and the cognitive decline caused by AD, is of paramount clinical importance, since MCI patients are at increased risk of progressing into AD. Electroencephalographic (EEG alterations in the spectral content of brainwaves and connectivity at resting state have been associated with early-stage AD. Recently, cognitive event-related potentials (ERPs have entered into the picture as an easy to perform screening test. Motivated by the recent findings about the role of cross-frequency coupling (CFC in cognition, we introduce a relevant methodological approach for detecting MCI based on cognitive responses from a standard auditory oddball paradigm. By using the single trial signals recorded at Pz sensor and comparing the responses to target and non-target stimuli, we first demonstrate that increased CFC is associated with the cognitive task. Then, considering the dynamic character of CFC, we identify instances during which the coupling between particular pairs of brainwave frequencies carries sufficient information for discriminating between normal subjects and patients with MCI. In this way, we form a multiparametric signature of impaired cognition. The new composite biomarker was tested using data from a cohort that consists of 25 amnestic MCI patients and 15 age-matched controls. Standard machine-learning algorithms were employed so as to implement the binary classification task. Based on leave-one-out cross-validation, the measured classification rate was found reaching very high levels (95%. Our approach compares favorably with the traditional alternative of using the morphology of averaged ERP response to make the diagnosis and the usage of features from spectro-temporal analysis of single-trial response. This further indicates that task-related CFC measurements can provide invaluable analytics in AD diagnosis and prognosis.
International Nuclear Information System (INIS)
Amenomori, Tatsuhiko; Honda, Takeo; Matsuo, Tatsuki; Otake, Masanori; Hazama, Ryuji; Tomonaga, Yu; Tomonaga, Masao; Ichimaru, Michito.
1986-07-01
The effects of atomic bomb radiation on hemopoietic stem cells were studied cytogenetically and from the aspect of differentiation and proliferation, using single colonies derived from human hemopoietic stem cells. The subjects studied were A-bomb survivors in the high dose exposure group (T65D 100 + rad) with a high incidence (10 % or more) of radiation-induced chromosome abnormalities in their peripheral lymphocytes, and their controls. Examinations were performed on 21 A-bomb survivors (10 males and 11 females) and 11 controls (5 males and 6 females). Colony formation of hemopoietic stem cells (granulocyte/monocyte-colony-forming cells, GM-CFC and burst-forming unit-erythrocytes, BFU-E) was made by the methylcellulose method patterned after the methods of Iscove et al and Ogawa et al using 5 - 10 ml of peripheral blood. Chromosome specimens were prepared from single colonies by the micromethod which we have reported elsewhere. The total number of colonies analyzed in the exposed group was 131 GM-CFC and 75 BFU-E. Chromosome abnormalities were observed in 15 (11.5 %) and 9 (12.0 %) colonies, respectively. In the control group, the total number of colonies analyzed was 61 GM-CFC and 41 BFU-E, but none of the colonies showed chromosome abnormalities. A highly significant difference in chromosome abnormalities was demonstrated by an exact test with a probability of 0.3 % for GM-CFC and 1.7 % for BFU-E. The karyotypes of chromosome abnormalities obtained from the colonies of hemopoietic stem cells in the exposed group were mostly translocations, but deletion and marker chromosomes were also observed. In two individuals, such karyotypic abnormalities as observed in the peripheral lymphocytes were seen also in the hemopoietic precursor cells. This finding suggests that radiation may produce an effect even on relatively undifferentiated hemopoietic stem cells. (author)
Effect of solvent alcohol on degradation of chlorinated hydrocarbons by γ-irradiation
International Nuclear Information System (INIS)
Nakagawa, Seiko
2002-01-01
1,1,2-Trichloro-trifluoroethane (CFC113) was dissolved in alkaline 1-butanol, 2-butanol, iso-butyl alcohol, and phenyl ethyl alcohol and irradiated with 60 Co gamma rays after being purged with pure nitrogen gas. In all these solvents, the concentration of CFC113 and hydroxide ion decreased and that of chloride ion increased with a dose observed in 2-propanol solution. The reaction efficiency increases in the following order: 1-butanol < iso-butyl alcohol < phenyl ethyl alcohol < 2-butanol < 2-propanol. The solvent effect will depend on the binding energy of the αC-H of the alcohol molecule and electron affinity and dipole moment of the ketones or aldehydes produced from the alcohols. (author)
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, A. [Nippon Steel Corp., Tokyo (Japan)
1999-09-05
Abolishing flon in which the reuse by pollution and degradation is difficult by recovery flon and recovery and recycling process which do not rotate for the middle reuse that the recovery system is constructed is arising. And, the specific flon recovery quantity increases with the progress of development of the recent CFC substitute and renewal to the CFC substitute correspondence machine. Specific flon collapse technique using rf plasma introduced in this paper cultivated the basic technology in Agency of Industrial Science and Technology, resources environment integrated research place. The demonstrated operation research was carried out under Ministry of International Trade and Industry, New Energy and Industrial Technology Development Organization since December 1994. (NEDO)
Examination of high heat flux components for the ITER divertor after thermal fatigue testing
International Nuclear Information System (INIS)
Missirlian, M.; Escourbiac, F.; Schmidt, A.; Riccardi, B.; Bobin-Vastra, I.
2011-01-01
An extensive development programme has been carried out in the EU on high heat flux components within the ITER project. In this framework, a full-scale vertical target (VTFS) prototype was manufactured with all the main features of the corresponding ITER divertor design. The fatigue cycling campaign on CFC and W armoured regions, proved the capability of such a component to meet the ITER requirements in terms of heat flux performances for the vertical target. This paper discusses metallographic observations performed on both CFC and W part after this intensive thermal fatigue testing campaign for a better understanding of thermally induced mechanical stress within the component, especially close to the armour-heat sink interface.
International Nuclear Information System (INIS)
Schlosser, J.; Chappuis, P.; Chatelier, M.; Durocher, A.; Guilheim, D.; Lipa, M.; Mitteau, R.; Tonon, G.; Tsitrone, E.
1998-01-01
Actively cooled plasma facing components (PFC) have been developed and used in Tore Supra since 1985. One of the main technological problem is due to the expansion mismatch between graphite armour and metallic heat sink material. A first technology used graphite tiles with or without a reinforcement and a compliant layer, brazed with titanium copper-silver (TiCuAg) alloy. The next technology used carbon fiber material (CFC) tiles with a 2 mm pure copper compliant layer, since the good mechanical strength of the CFC allowed the reinforcement layer to be suppressed. No destructive inspection during the manufacturing procedure was found to be essential to insure a good reliability of the elements. (orig.)
Examination of high heat flux components for the ITER divertor after thermal fatigue testing
Energy Technology Data Exchange (ETDEWEB)
Missirlian, M., E-mail: marc.missirlian@cea.fr [CEA, IRFM, F-13108 Saint Paul lez Durance (France); Escourbiac, F., E-mail: frederic.escourbiac@cea.fr [CEA, IRFM, F-13108 Saint Paul lez Durance (France); Schmidt, A., E-mail: a.schmidt@fz-juelich.de [Forschungszentrum Juelich, IFE-2 (Germany); Riccardi, B., E-mail: Bruno.Riccardi@f4e.europa.eu [Fusion For Energy, E-08019 Barcelona (Spain); Bobin-Vastra, I., E-mail: isabelle.bobinvastra@areva.com [AREVA-NP, 71200 Le Creusot (France)
2011-10-01
An extensive development programme has been carried out in the EU on high heat flux components within the ITER project. In this framework, a full-scale vertical target (VTFS) prototype was manufactured with all the main features of the corresponding ITER divertor design. The fatigue cycling campaign on CFC and W armoured regions, proved the capability of such a component to meet the ITER requirements in terms of heat flux performances for the vertical target. This paper discusses metallographic observations performed on both CFC and W part after this intensive thermal fatigue testing campaign for a better understanding of thermally induced mechanical stress within the component, especially close to the armour-heat sink interface.
Dynamic modulation of epileptic high frequency oscillations by the phase of slower cortical rhythms.
Ibrahim, George M; Wong, Simeon M; Anderson, Ryan A; Singh-Cadieux, Gabrielle; Akiyama, Tomoyuki; Ochi, Ayako; Otsubo, Hiroshi; Okanishi, Tohru; Valiante, Taufik A; Donner, Elizabeth; Rutka, James T; Snead, O Carter; Doesburg, Sam M
2014-01-01
Pathological high frequency oscillations (pHFOs) have been proposed to be robust markers of epileptic cortex. Oscillatory activity below this frequency range has been shown to be modulated by phase of lower frequency oscillations. Here, we tested the hypothesis that dynamic cross-frequency interactions involving pHFOs are concentrated within the epileptogenic cortex. Intracranial electroencephalographic recordings from 17 children with medically-intractable epilepsy secondary to focal cortical dysplasia were obtained. A time-resolved analysis was performed to determine topographic concentrations and dynamic changes in cross-frequency amplitude-to-phase coupling (CFC). CFC between pHFOs and the phase of theta and alpha rhythms was found to be significantly elevated in the seizure-onset zone compared to non-epileptic regions (pfrequency oscillations at which pHFO amplitudes were maximal was inconsistent at seizure initiation, yet consistently at the trough of the low frequency rhythm at seizure termination. Amplitudes of pHFOs were most significantly modulated by the phase of alpha-band oscillations (p<0.01). These results suggest that increased CFC between pHFO amplitude and alpha phase may constitute a marker of epileptogenic brain areas and may be relevant for understanding seizure dynamics. Copyright © 2013 Elsevier Inc. All rights reserved.
Kenyon, Jonathan; Nickel-Meester, Gabrielle; Qing, Yulan; Santos-Guasch, Gabriela; Drake, Ellen; PingfuFu; Sun, Shuying; Bai, Xiaodong; Wald, David; Arts, Eric; Gerson, Stanton L
Normal human hematopoietic stem and progenitor cells (HPC) lose expression of MLH1 , an important mismatch repair (MMR) pathway gene, with age. Loss of MMR leads to replication dependent mutational events and microsatellite instability observed in secondary acute myelogenous leukemia and other hematologic malignancies. Epigenetic CpG methylation upstream of the MLH1 promoter is a contributing factor to acquired loss of MLH1 expression in tumors of the epithelia and proximal mucosa. Using single molecule high-throughput bisulfite sequencing we have characterized the CpG methylation landscape from -938 to -337 bp upstream of the MLH1 transcriptional start site (position +0), from 30 hematopoietic colony forming cell clones (CFC) either expressing or not expressing MLH1 . We identify a correlation between MLH1 promoter methylation and loss of MLH1 expression. Additionally, using the CpG site methylation frequencies obtained in this study we were able to generate a classification algorithm capable of sorting the expressing and non-expressing CFC. Thus, as has been previously described for many tumor cell types, we report for the first time a correlation between the loss of MLH1 expression and increased MLH1 promoter methylation in CFC derived from CD34 + selected hematopoietic stem and progenitor cells.
Jiang, Yuanzhi; Zhang, Lijuan; Zhang, Hang; Zhang, Cui; Liu, Shuangxi
2016-10-01
Hierarchical Ni0.54Co0.46O2 architectures composed by nanowires or nanosheets were successfully grown on bio-mass carbon fiber cloth (CFC) by hydrothermal method. The morphology of Ni0.54Co0.46O2 can be effectively controlled by using different precipitators. The structural effects of the two kinds of morphologies were researched. the results suggest that the Ni0.54Co0.46O2 nanosheet arrays grown on CFC (NCO-NSs/CFC) shows a higher Faradaic areal capacity of 438 μAh cm-2 (238.1 mAh g-1) at a current density of 1 mA cm-2 and still about 90.3% initial capacity retention even at the high current density of 50 mA cm-2. Moreover, an all-solid-state flexible symmetric supercapacitor device has been successfully assembled. The optimized device delivers superior electrochemical performance with an outstanding energy density of 92.4 Wh kg-1 at a power density of 207.2 W kg-1. Such hierarchical nanostructure composed by well-aligned uniform Ni0.54Co0.46O2 nanosheet arrays grown on bio-mass carbon fiber cloth might hold great promise as battery-type electrode material for high-performance supercapacitor.
Effect of hydroxyurea and vinblastine on the proliferation of the pluripotential stem cells
International Nuclear Information System (INIS)
Necas, E.; Neuwirt, J.
1977-01-01
The population of the pluripotential hemopoietic stem cells in mice, i.e., cells forming colonies in the spleens of lethally irradiated mice (colony forming cells CFc) proliferates relatively slowly. After partial damage the population regenerates which is achieved by an increased proliferation rate. The effect of damage caused by different doses of hydroxyurea or vinblastine to the proliferation of the CFc was investigated. CFc population was measured in femur bone marrow after the grafting of a bone marrow sample into lethally irradiated mice recipients (spleen colony method). The proliferation rate was estimated either according to the magnitude of the fraction of cells synthesizing DNA in the S phase of the cell cycle, or according to the sensitivity of the population to repeated injections of vinblastine. Data showed that even after very minute damage by hydroxyurea the stem cells started to proliferate intensively. The effect was dose dependent. The comparable damage caused by vinblastine had a significantly weaker effect on the proliferation of the stem cells. It is concluded from the results that the proliferation response of the pluripotential stem cells depends on two factors: the extent of the damage caused to the hemopoietic tissue and the position of the killed cells in the cell cycle. (author)
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
Described herein are the recent trends of the ozone layer protection and global warming prevention measures. Latest international information has been collected by attending the 10th Meeting of the Party of Montreal Protocol, and the 17th and 18th Open Ended Working Group. The important decisions made so far are investigation on the novel ozone layer destruction substances, requirement of studying on decommissioning Halon facilities, collection of information of HFC and PFC, and reporting to IPCC. Information regarding regulation trends of HFC, PFC and SF{sub 6} are collected by attending the COP-4 meeting and the preparatory meetings therefor. The report on these 3 substances will be completed in July or so, 1999. The trends of technical development in HCFC alternatives in refrigeration and blowing sectors were investigated. HFC-245fa and HFC-365mfc are introduced. Also introduced is latest information regarding the emission estimation and control measures of HFC in USA and UK, emission control measures of SF{sub 6} in USA and Japan, and techniques for destruction of CFC and the like, which could be the basic techniques for controlling diffusion of HFC. The CFC phase-out programs of China, the biggest ozone layer destruction substance (e.g., CFC) consuming country, are also outlined. (NEDO)
Pollutants from the Gulf War serve as water mass tracer in the Arabian Sea
Plähn, Olaf; Rhein, Monika; Fine, Rana A.; Sullivan, Kevin F.
In 1995, concentrations of the chlorofluorocarbon compound CFC-12 in the outflow water from the Persian Gulf were 8-40 fold higher than normally caused by air-sea gas exchange. At that time, the anomaly was restricted to the Gulf of Oman north of 20°N, while in 1998 the signal had spread southwestward to 12°N. The sources of this CFC-12 input of about 6400 kg are most likely the fire extinguishers and solvents used during and after the Gulf War in 1991. This CFC-12 signal is a new feature of the Persian Gulf Water (PGW) which can be used to track and quantify the spreading and dilution of PGW in the northern Indian Ocean. The contaminated PGW spreads southward with a mean velocity of 0.02-0.025 m s-1. At 20°N, the anomaly is diluted by a factor of more than two, and east of the island Socotra by a factor of four. A mean transport of less than 0.5·106 m³ s-1 is calculated for PGW assuming a mean dilution rate of 30% from the source signal in the Gulf of Oman to the western Arabian Sea.
Gallagher, Glenn; Zhan, Tao; Hsu, Ying-Kuang; Gupta, Pamela; Pederson, James; Croes, Bart; Blake, Donald R; Barletta, Barbara; Meinardi, Simone; Ashford, Paul; Vetter, Arnie; Saba, Sabine; Slim, Rayan; Palandre, Lionel; Clodic, Denis; Mathis, Pamela; Wagner, Mark; Forgie, Julia; Dwyer, Harry; Wolf, Katy
2014-01-21
To provide information for greenhouse gas reduction policies, the California Air Resources Board (CARB) inventories annual emissions of high-global-warming potential (GWP) fluorinated gases, the fastest growing sector of greenhouse gas (GHG) emissions globally. Baseline 2008 F-gas emissions estimates for selected chlorofluorocarbons (CFC-12), hydrochlorofluorocarbons (HCFC-22), and hydrofluorocarbons (HFC-134a) made with an inventory-based methodology were compared to emissions estimates made by ambient-based measurements. Significant discrepancies were found, with the inventory-based emissions methodology resulting in a systematic 42% under-estimation of CFC-12 emissions from older refrigeration equipment and older vehicles, and a systematic 114% overestimation of emissions for HFC-134a, a refrigerant substitute for phased-out CFCs. Initial, inventory-based estimates for all F-gas emissions had assumed that equipment is no longer in service once it reaches its average lifetime of use. Revised emission estimates using improved models for equipment age at end-of-life, inventories, and leak rates specific to California resulted in F-gas emissions estimates in closer agreement to ambient-based measurements. The discrepancies between inventory-based estimates and ambient-based measurements were reduced from -42% to -6% for CFC-12, and from +114% to +9% for HFC-134a.
A manual for a Laboratory Information Management System (LIMS) for light stable isotopes
Coplen, Tyler B.
1998-01-01
The reliability and accuracy of isotopic data can be improved by utilizing database software to (i) store information about samples, (ii) store the results of mass spectrometric isotope-ratio analyses of samples, (iii) calculate analytical results using standardized algorithms stored in a database, (iv) normalize stable isotopic data to international scales using isotopic reference materials, and (v) generate multi-sheet paper templates for convenient sample loading of automated mass-spectrometer sample preparation manifolds. Such a database program is presented herein. Major benefits of this system include (i) an increase in laboratory efficiency, (ii) reduction in the use of paper, (iii) reduction in workload due to the elimination or reduction of retyping of data by laboratory personnel, and (iv) decreased errors in data reported to sample submitters. Such a database provides a complete record of when and how often laboratory reference materials have been analyzed and provides a record of what correction factors have been used through time. It provides an audit trail for stable isotope laboratories. Since the original publication of the manual for LIMS for Light Stable Isotopes, the isotopes 3 H, 3 He, and 14 C, and the chlorofluorocarbons (CFCs), CFC-11, CFC-12, and CFC-113, have been added to this program.
Increased Arctic Deposition of Persistent Compounds as a Result of the Montreal Protocol
Young, C.; Pickard, H. M.; De Silva, A. O.; Spencer, C.; Criscitiello, A. S.; Muir, D.; Sharp, M. J.
2017-12-01
Perfluorocarboxylic acids (PFCAs) are among the diverse groups of compounds characterized as persistent organic pollutants. They are toxic, resistant to environmental degradation, and adversely impact human and environmental health. PFCAs with four or fewer carbons, short-chain PFCAs (scPFCAs), are of particular interest because of their increasing levels in the environment, toxicity to plants, and potential for accumulation in some aquatic ecosystems, making them an emerging environmental concern. A minor source of scPFCAs to the Arctic has been shown to be atmospheric transformation of fluoropolymer precursors, followed by deposition. Additional potential sources of scPFCAs to the Arctic are chlorofluorocarbon (CFC)-replacement compounds. Through analysis of an ice core from the Canadian High Arctic, we show that Montreal Protocol-mandated introduction of CFC-replacement compounds for the heat-transfer industry has led to increasing inputs of these scPFCAs to the remote environment. Flux measurements for scPFCAs as a class of contaminants have only been reported in a couple studies to date. Here, we provide the first multi-decadal temporal record of scPFCA deposition, demonstrating a dramatic increase in deposition resulting from emission of CFC-replacements. These results bring to the forefront a need for a holistic approach to environmental risk assessment that considers impacts of replacement substances and degradation products.
International Nuclear Information System (INIS)
Buffet, J.
1994-01-01
The main benefit of electric cars is to reduce air pollution in cities that is thus desirable to equip them with non polluting air conditioning units and this rules out frigorific compressors operating with CFC. The planned replacement of CFC by HFC is at best an interim solution. The best solution is certainly to use thermoelectric air conditioning units, which are inherently pollution-free. However, these have a fairly low COPF when compared to traditional compressor units. We study the relationship between the cooling of the interior of urban electric cars and the merit factor of the thermoelectric material in their Peltier unit. This should help provide concrete target properties of future T E materials. copyright 1995 American Institute of Physics
Freon Fra Fjernvarmerør – En Overset Risiko For Indeklima Og Grundvand?
DEFF Research Database (Denmark)
Kjeldsen, Peter; Mogensen, Susanne B.; Langeland, Majbrith
2011-01-01
Isoleringsskum i fjernvarmerør er fremstillet med brug af fluorerede og klorerede flygtige stoffer (CFC-11 og 1,1,1-TCA), som langsomt frigives til jorden under brug. Den videre skæbne for de flygtige stoffer efter at de frigives til jorden er ukendt, men fordampning til atmosfæren, nedbrydning, og...... at man også bør interessere sig for risikoen for påvirkning af indeklimaet i nærliggende bygninger, specielt i områder hvor 1,1,1-TCA har været benyttet. Det konkluderes at problemet bør belyses yderligere bl.a. ved måling af tilstedeværelse af 1,1,1-TCA, CFC-11, samt potentielle nedbrydningsprodukter i...
Recent changes in the ventilation of the southern oceans.
Waugh, Darryn W; Primeau, Francois; Devries, Tim; Holzer, Mark
2013-02-01
Surface westerly winds in the Southern Hemisphere have intensified over the past few decades, primarily in response to the formation of the Antarctic ozone hole, and there is intense debate on the impact of this on the ocean's circulation and uptake and redistribution of atmospheric gases. We used measurements of chlorofluorocarbon-12 (CFC-12) made in the southern oceans in the early 1990s and mid- to late 2000s to examine changes in ocean ventilation. Our analysis of the CFC-12 data reveals a decrease in the age of subtropical subantarctic mode waters and an increase in the age of circumpolar deep waters, suggesting that the formation of the Antarctic ozone hole has caused large-scale coherent changes in the ventilation of the southern oceans.
International Nuclear Information System (INIS)
Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.
1999-01-01
This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity[measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2
Energy Technology Data Exchange (ETDEWEB)
Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.
1999-08-01
This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.
Final report on international comparison CCQM-K83: Halocarbons in dry whole air
Rhoderick, George; Guenther, Franklin; Duewer, David; Lee, Jeongsoon; Moon, Dongmin; Lee, Jinbok; Lim, Jeongsik; Seog Kim, Jin
2014-01-01
The growing awareness of climate change/global warming and continuing concerns regarding stratospheric ozone depletion will require future measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track and control the emissions of these species globally in the atmosphere, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. This report describes the results of a key comparison for several of the more important halocarbons at atmospheric concentration levels. The comparison includes the chlorofluorocarbons (CFCs) dichlorodifluoromethane (CFC 12), trichlorofluoromethane (CFC 11), and 1,1,2 trichlorotrifluoroethane (CFC 113); the hydrochlorofluorocarbons (HCFCs) chlorodifluoromethane (HCFC 22) and 1-chloro-1,1-difluoroethane (HCFC 142b); and the hydrofluorocarbon (HFC) 1,1,1,2 tetrafluoroethane (HFC 134a), all in a dried whole air sample. The objective of this key comparison is to compare the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCQM, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).
Chen, Xiao-Rong; Sun, Shi-Cheng; Teng, Shuai-Wen; Li, Liang; Bie, Yi-Fan; Yu, Hui; Li, Da-Li; Chen, Zhe-Yu; Wang, Yue
2018-03-01
Ubiquitin-like with PHD and ring finger domains 2 (Uhrf2) is distributed in many brain regions, including the cortex and hippocampus. Decreased Uhrf2 expression is involved in neurodegenerative disease. A recent study showed Uhrf2 deletion impaired spatial memory; however, the mechanism remains elusive. In our study, we determined that Uhrf2 +/- and Uhrf2 -/- mice had significant learning and memory deficiencies in contextual fear conditioning (CFC) and the novel place recognition test but not in the novel object recognition test. Interestingly, there were no changes in the Uhrf2 protein levels in the hippocampus of C57BL6 mice after CFC training, which suggests Uhrf2 in adult mice may not be related to the formation of CFC long-term memory. Based on Nissl staining, Uhrf2 deletion caused neuropathological changes specifically in the crest of the dentate gyrus (DG), such as cell swelling, a vague outline and confused boundary; however, no changes were identified in the medial prefrontal cortex (mPFC). Transmission electron microscope assay further indicated a series of abnormal ultrastructure changes in neurons and glia in the DG crest. These results suggested that Uhrf2 deletion selectively blocked the development of the DG crest and impaired hippocampus-dependent learning and memory. Our study will facilitate a better understanding of the role of Uhrf2 protein in the central nervous system.
Groundwater flow system under a rapidly urbanizing coastal city as determined by hydrogeochemistry
Kagabu, Makoto; Shimada, Jun; Delinom, Robert; Tsujimura, Maki; Taniguchi, Makoto
2011-01-01
In the Jakarta area (Indonesia), excessive groundwater pumping due to the rapidly increasing population has caused groundwater-related problems such as brackish water contamination in coastal areas and land subsidence. In this study, we adopted multiple hydrogeochemical techniques to demonstrate the groundwater flow system in the Jakarta area. Although almost all groundwater existing in the Jakarta basin is recharged at similar elevations, the water quality and residence time demonstrates a clear difference between the shallow and deep aquifers. Due to the rapid decrease in the groundwater potential in urban areas, we found that the seawater intrusion and the shallow and deep groundwaters are mixing, a conclusion confirmed by major ions, Br -:Cl - ratios, and chlorofluorocarbon (CFC)-12 analysis. Spring water and groundwater samples collected from the southern mountainside area show younger age characteristics with high concentrations of 14C and Ca-HCO 3 type water chemistry. We estimated the residence times of these groundwaters within 45 years under piston flow conditions by tritium analysis. Also, these groundwater ages can be limited to 20-30 years with piston flow evaluated by CFCs. Moreover, due to the magnitude of the CFC-12 concentration, we can use a pseudo age indicator in this field study, because we found a positive correlation between the major type of water chemistry and the CFC-12 concentration.
International Nuclear Information System (INIS)
Sabahi, Kamel; Teshnehlab, Mohammad; Shoorhedeli, Mahdi Aliyari
2009-01-01
In this study, a new adaptive controller based on modified feedback error learning (FEL) approaches is proposed for load frequency control (LFC) problem. The FEL strategy consists of intelligent and conventional controllers in feedforward and feedback paths, respectively. In this strategy, a conventional feedback controller (CFC), i.e. proportional, integral and derivative (PID) controller, is essential to guarantee global asymptotic stability of the overall system; and an intelligent feedforward controller (INFC) is adopted to learn the inverse of the controlled system. Therefore, when the INFC learns the inverse of controlled system, the tracking of reference signal is done properly. Generally, the CFC is designed at nominal operating conditions of the system and, therefore, fails to provide the best control performance as well as global stability over a wide range of changes in the operating conditions of the system. So, in this study a supervised controller (SC), a lookup table based controller, is addressed for tuning of the CFC. During abrupt changes of the power system parameters, the SC adjusts the PID parameters according to these operating conditions. Moreover, for improving the performance of overall system, a recurrent fuzzy neural network (RFNN) is adopted in INFC instead of the conventional neural network, which was used in past studies. The proposed FEL controller has been compared with the conventional feedback error learning controller (CFEL) and the PID controller through some performance indices
Thermal fatigue tests with actively cooled divertor mock-ups for ITER
International Nuclear Information System (INIS)
Roedig, M.; Duwe, R.; Linke, J.; Schuster, A.; Wiechers, B.; Ibbott, C.; Jacobson, D.; Le Marois, G.; Lind, A.; Lorenzetto, P.; Vieider, G.; Peacock, A.; Ploechl, L.; Severi, Y.; Visca, E.
1998-01-01
Mock-ups for high heat flux components with beryllium and CFC armour materials have been tested by means of the electron beam facility JUDITH. The experiments concerned screening tests to evaluate heat removal efficiency and thermal fatigue tests. CFC monoblocks attached to DS-Cu (Glidcop Al25) and CuCrZr tubes by active metal casting and Ti brazing showed the best thermal fatigue behaviour. They survived more than 1000 cycles at heat loads up to 25 MW m -2 without any indication of failure. Operational limits are given only by the surface temperature on the CFC tiles. Most of the beryllium mock-ups were of the flat tile type. Joining techniques were brazing, hot isostatic pressing (HIP) and diffusion bonding. HIPed and diffusion bonded Be/Cu modules have not yet reached the standards for application in high heat flux components. The limit of this production method is reached for heat loads of approximately 5 MW m -2 . Brazing with and without silver seems to be a more robust solution. A flat tile mock-up with CuMnSnCe braze was loaded at 5.4 MW m -2 for 1000 cycles without damage The first test with a beryllium monoblock joined to a CuCrZr tube by means of Incusil brazing shows promising results; it survived 1000 cycles at 4.5 MW m -2 without failure. (orig.)
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
The research and development were reported on new refrigerants for compression type heat pumps. From 64 kinds of newly composed ether, CF3CF2OCH3 was developed as candidate compound substituting for CFC-11, and CF3CF2CF2OCH3 and (CF3)2CFOCH3 as those substituting for CFC-11. However, COP of the refrigeration has not been optimized. Global warming potentials were obtained by high-accuracy estimate guidelines. The new refrigerants have no chlorine and therefore no effects on the ozonosphere. Global warming effects also satisfied the present allowable values. There was no problem on human body toxicity in the short-term experiment. Costs of commercially production of the candidate compounds were trially calculated from reaction paths and chemical constitution formulae. Assuming that the raw materials are circulating on the market, plant/equipment investment, production volume, and production cost became 5 billion yen, 1000 tons/year, and 3500-6500 yen/kg in 3 persons/shift and 4 shifts, respectively. This is close to the allowable level which is ten times the CFC-12 price, 5000 yen/KG. The new refrigerants are expected to be fully commercialized in consideration of progress of the composition method and improvement of physical properties in the future. 115 refs., 37 figs., 102 tabs.
Impact of confinement housing on study end-points in the calf model of cryptosporidiosis.
Graef, Geneva; Hurst, Natalie J; Kidder, Lance; Sy, Tracy L; Goodman, Laura B; Preston, Whitney D; Arnold, Samuel L M; Zambriski, Jennifer A
2018-04-01
Diarrhea is the second leading cause of death in children confinement housing, and Interval Collection (IC), which permits use of box stalls. CFC mimics human challenge model methodology but it is unknown if confinement housing impacts study end-points and if data gathered via this method is suitable for generalization to human populations. Using a modified crossover study design we compared CFC and IC and evaluated the impact of housing on study end-points. At birth, calves were randomly assigned to confinement (n = 14) or box stall housing (n = 9), or were challenged with 5 x 107 C. parvum oocysts, and followed for 10 days. Study end-points included fecal oocyst shedding, severity of diarrhea, degree of dehydration, and plasma cortisol. Calves in confinement had no significant differences in mean log oocysts enumerated per gram of fecal dry matter between CFC and IC samples (P = 0.6), nor were there diurnal variations in oocyst shedding (P = 0.1). Confinement housed calves shed significantly more oocysts (P = 0.05), had higher plasma cortisol (P = 0.001), and required more supportive care (P = 0.0009) than calves in box stalls. Housing method confounds study end-points in the calf model of cryptosporidiosis. Due to increased stress data collected from calves in confinement housing may not accurately estimate the efficacy of chemotherapeutics targeting C. parvum.
ITER divertor, design issues and research and development
International Nuclear Information System (INIS)
Tivey, R.; Ando, T.; Antipenkov, A.; Barabash, V.; Chiocchio, S.; Federici, G.; Ibbott, C.; Jakeman, R.; Janeschitz, G.; Raffray, R.; Mazul, I.; Pacher, H.; Ulrickson, M.; Vieider, G.
1999-01-01
Over the period of the ITER Engineering Design Activity (EDA) the results from physics experiments, modelling, engineering analyses and R and D, have been brought together to provide a design for an ITER divertor. The design satisfies all necessary requirements for steady state and transient heat flux, nuclear shielding, pumping, tritium inventory, impurity control, armour lifetime, electromagnetic loads, diagnostics, and remote maintenance. The design consists of 60 cassettes each comprising a cassette body onto which the plasma facing components (PFCs) are mounted. Each cassette is supported by toroidal rails which are attached to the vacuum vessel. For the PFCs the final armour choice is carbon-fibre-composite (CfC) for the strike point regions and tungsten in all remaining areas. R and D has demonstrated that CfC monoblocks can routinely withstand heat loads up to 20 MW m -2 10 MW m -2 . Analysis and experiment show that a CfC armour thickness of ∝20 mm will provide sufficient lifetime for at least 1000 full power pulses. The thickness of the cassette body is sufficient to shield the vacuum vessel, so that, if necessary, rewelding is possible, and also provides sufficient stiffness against electromagnetically generated loads. The cassette design provides efficient and proven remote maintenance which should allow exchange of a complete divertor within ∝6 months. (orig.)
ITER divertor, design issues and research and development
Energy Technology Data Exchange (ETDEWEB)
Tivey, R.; Ando, T.; Antipenkov, A.; Barabash, V.; Chiocchio, S.; Federici, G.; Ibbott, C.; Jakeman, R.; Janeschitz, G.; Raffray, R. [ITER Joint Central Team, Garching (Germany). Joint Central Work Site; Akiba, M. [Japan Atomic Energy Research Institute, Naka-machi, Ibaraki-ken (Japan); Mazul, I. [Efremov Institute, St Petersburg (Russian Federation); Pacher, H. [NET Team, Boltzmannstr. 2, D-85748, Garching (Germany); Ulrickson, M. [Sandia National Laboratories, Albuquerque, NM (United States); Vieider, G. [NET Team, Boltzmannstr. 2, D-85748, Garching (Germany)
1999-11-01
Over the period of the ITER Engineering Design Activity (EDA) the results from physics experiments, modelling, engineering analyses and R and D, have been brought together to provide a design for an ITER divertor. The design satisfies all necessary requirements for steady state and transient heat flux, nuclear shielding, pumping, tritium inventory, impurity control, armour lifetime, electromagnetic loads, diagnostics, and remote maintenance. The design consists of 60 cassettes each comprising a cassette body onto which the plasma facing components (PFCs) are mounted. Each cassette is supported by toroidal rails which are attached to the vacuum vessel. For the PFCs the final armour choice is carbon-fibre-composite (CfC) for the strike point regions and tungsten in all remaining areas. R and D has demonstrated that CfC monoblocks can routinely withstand heat loads up to 20 MW m{sup -2}10 MW m{sup -2}. Analysis and experiment show that a CfC armour thickness of {proportional_to}20 mm will provide sufficient lifetime for at least 1000 full power pulses. The thickness of the cassette body is sufficient to shield the vacuum vessel, so that, if necessary, rewelding is possible, and also provides sufficient stiffness against electromagnetically generated loads. The cassette design provides efficient and proven remote maintenance which should allow exchange of a complete divertor within {proportional_to}6 months. (orig.)
Lifescience Database Archive (English)
Full Text Available AETNKKLERLLISLNLLGGLIGGTNGPPIAASINTQNEPDNRQNAPIAQNFQQYQQNQPI PNQNQISNQNQISNQNQNQNQNQNQ--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxixkxxxkxxxxx...xxiignxxixvxxxkkxv xxhwxfxxxwkxxxmkxikrnlmnlxqf*mrfqifqf...ikikfqikikfqikikikikiki--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxnxxxl*gxxxxxxnxxkxxf xcigxsxxigkxxx
Lifescience Database Archive (English)
Full Text Available equences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...nts: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott
EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING CFC INCINERATION
The report gives results of experiments to assess: (1) the effect of residual copper retained in an incineration facility on polychlorinated dibenzo-p-dioxin and dibenzofuran (PCDD/PCDF) formation during incineration of non-copper-containing chlorofluorocarbons (CFCs); and (2) th...
High-temperature brazing for reliable tungsten-CFC joints
International Nuclear Information System (INIS)
Koppitz, Th; Pintsuk, G; Reisgen, U; Remmel, J; Hirai, T; Sievering, R; Rojas, Y; Casalegno, V
2007-01-01
The joining of tungsten and carbon-based materials is demanding due to the incompatibility of their chemical and thermophysical properties. Direct joining is unfeasible by the reason of brittle tungsten carbide formation. High-temperature brazing has been investigated in order to find a suitable brazing filler metal (BFM) which successfully acts as an intermediary between the incompatible properties of the base materials. So far only low Cr-alloyed Cu-based BFMs provide the preferential combination of good wetting action on both materials, tolerable interface reactions, and a precipitation free braze joint. Attempts to implement a higher melting metal (e.g. Pd, Ti, Zr) as a BFM have failed up to now, because the formation of brittle precipitations and pores in the seam were inevitable. But the wide metallurgical complexity of this issue is regarded to offer further joining potential
Lifescience Database Archive (English)
Full Text Available ACTAGTAATTTAAAAAAAAAAAAA CCAAAAAAAAAAXXXXXXXXXXAATGTCCAAATTTCCATANATGTGTTTAAAAACG...89Z.Seq ----------AATGTCCAAATTTCCATANATGTGTTTAAAAACGTGGNGGNATNTTAAGN TNNGAATTTNANCCCCCNANACAACCNANATCCCTTGAT...AATTAAAAAAAG TTAAAATTAAATTTGTAAAATCAATTTGTAACAAAAACTAGTAATTTAAAAAAAAAAAAA CCAAAAAAAAAA----------AATGTCCAAATTTCCATANA
Lifescience Database Archive (English)
Full Text Available 67470-3108875 strain AX4, complete sequence. 38 1.4 11 AJ537965 |AJ537965.1 Timarcha balearica EST, clone Timarcha...5F6. 44 2.1 1 AJ537906 |AJ537906.1 Timarcha balearica EST, clone Timarcha4H
Lifescience Database Archive (English)
Full Text Available c*nsxw*npspwkskvvitlxmskpkxktkkvfxqin kvsfsxvnn*xxavlxxittskxnplsx*fsd*kvvckxl*kpxlvxpsxwkxkvxitxk msxpkfxtk...tiffck***liiif*ilyffkhikiffflcilfffpfxhin*lckfllklslvkps hwklkvxttlkmsxlkfktkkvfh
Lifescience Database Archive (English)
Full Text Available TAAAATCTTCTGGGAATGCAATTGACCCATT sequence update 2001. 6. 1 Translated Amino Acid sequence naglgsgnl*ssdafear... rk*xgxsmxnlixxixtxsxxi*tieifxthftexnttexfstvflisk*kxtcl*fli* ftlnisfnxxkifwecn*pi Frame B: naglgsgnl*ssdafear
Lifescience Database Archive (English)
Full Text Available HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHQAQAAHQVQAQAVLAQAV LVQGRKXI*xi* Frame C: ---ixiiiiiiixmxxxxiixkxxxiiixkxmmxxiimxxxxxxxxmxxxxxxxxx...lxxxlxxxxxxxxxllxxxxlxxxxxxiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii...iiii xkxxmxiimxxxmmxkxxxxxxxxxxxxxxmxxxxmxxxxxxxxxxlxxxqxxxxlxxxq xxxxxxxxlxxxqxxxx
Lifescience Database Archive (English)
Full Text Available mmxxxkxxxkxxixkxxxxxxxxi iiixkxxxiiimxxixxkkxxlfixxxxxxxxxxxxxxmxxxxlxxxxxlxxxxlxxxlx xxxxxxqxxxxlxxxqxxxxlxxxlxxxxxxxxxllxxxxllxxxxx...iiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Unity of Command in Afghanistan: A Forsaken Principle of War
National Research Council Canada - National Science Library
Hope, Ian
2008-01-01
... in the evolution of military command for Afghanistan. It examines how there was an unprecedented departure from the principle of unity of command in Afghanistan in 2006, when Combined Forces Command-Afghanistan (CFC...
Directory of Open Access Journals (Sweden)
Hiroshi Tanaka
2006-01-01
Conclusions: It was speculated that inhaled CFC-BDP and DP-FP might deposit mainly in large airways and fail to fully reach small airways, consequently allowing eosinophilic inflammation to continue in small airways.
Schmidt, S D; Furini, C R G; Zinn, C G; Cavalcante, L E; Ferreira, F F; Behling, J A K; Myskiw, J C; Izquierdo, I
2017-07-01
The process of memory formation is complex and highly dynamic. During learning, the newly acquired information is found in a fragile and labile state. Through a process known as consolidation, which requires specific mechanisms such as protein synthesis, the memory trace is stored and stabilized. It is known that when a consolidated memory is recalled, it again becomes labile and sensitive to disruption. To be maintained, this memory must undergo an additional process of restabilization called reconsolidation, which requires another phase of protein synthesis. Memory consolidation has been studied for more than a century, while the molecular mechanisms underlying the memory reconsolidation are starting to be elucidated. For this, is essential compare the participation of important neurotransmitters and its receptors in both processes in brain regions that play a central role in the fear response learning. With focus on serotonin (5-HT), a well characterized neurotransmitter that has been strongly implicated in learning and memory, we investigated, in the CA1 region of the dorsal hippocampus, whether the latest discovered serotonergic receptors, 5-HT 5A , 5-HT 6 and 5-HT 7 , are involved in the consolidation and reconsolidation of contextual fear conditioning (CFC) memory. For this, male rats with cannulae implanted in the CA1 region received immediately after the training or reactivation session, or 3h post-reactivation of the CFC, infusions of agonists or antagonists of the 5-HT 5A , 5-HT 6 and 5-HT 7 receptors. After 24h, animals were subjected to a 3-min retention test. The results indicated that in the CA1 region of the hippocampus the 5-HT 5A , 5-HT 6 and 5-HT 7 serotonin receptors participate in the reconsolidation of the CFC memory 3h post-reactivation. Additionally, the results suggest that the 5-HT 6 and 5-HT 7 receptors also participate in the consolidation of the CFC memory. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Saito N
2016-03-01
Full Text Available Noboru Saito, Yuhei Mori, Sayaka Uchiyama Terumo Corporation R&D Center, Inokuchi, Nakai-machi, Ashigarakami-gun, Kanagawa, Japan Abstract: The purpose of this study was to determine the effect of a nonuniform coating, abluminal-gradient coating (AGC, which leaves the abluminal surface of the curves and links parts of the stent free from the drug coating, on the diffusion direction of the drug and the biological responses of the artery to drug-eluting stent (DES by comparing the AGC-sirolimus stent and the conventional full-surface coating (CFC sirolimus stent. The study aimed to verify whether the AGC approach was appropriate for the development of a safer DES, minimizing the risks of stent thrombosis due to delayed endothelialization by the drug and distal embolization due to cracking of the coating layer on the hinge parts of the DES on stent expansion. In the in vitro local drug diffusion study, we used rhodamine B as a model drug, and rhodamine B released from the AGC stent diffused predominantly into the abluminal side of the alginate artery model. Conversely, rhodamine B released from the CFC stent quickly spread to the luminal side of the artery model, where endothelial cell regeneration is required. In the biological responses study, the luminal surface of the iliac artery implanted with the AGC-sirolimus stent in a rabbit iliac artery for 2 weeks was completely covered with endothelial-like cells. On the other hand, the luminal surface of the iliac artery implanted with the CFC-sirolimus stent for 2 weeks only showed partial coverage with endothelial-like cells. While thrombosis was observed in two of the three CFC-sirolimus stents, it was observed in only one of the three AGC-sirolimus stents. Taken together, these findings indicate that the designed nonuniform coating (AGC is an appropriate approach to ensure a safer DES. However, the number of studies is limited and a larger study should be conducted to reach a statistically
Application of energy conservation policies and strategies: their effects on environment protection
International Nuclear Information System (INIS)
Chartier, P.
1991-01-01
The french energy policy settled after the oil crisis was aimed at reducing fossil energy consumption; statistics show that it was a success, particularly in industry but of lower importance for automobiles as traffic problems around cities increased. Some examples are given (steel, sugar and cement, new buildings, and cars). Rational use of energy and nuclear energy utilization induced a decrease in carbon dioxide emission, one of the most important greenhouse effect gases; the various causes of greenhouse gas emissions are evaluated and compared : energy (residential and commercial buildings, industry, transport), agriculture, putrefying wastes, deforestation, CFC. Cost and emission abatement potential of various policies are compared: fossil energy conservation, high-efficiency wood combustion, substitution of CFC, reforestation, catalytic converters, renewable energies, etc. Potentials of renewable energies are assessed
Conceptual design of a high heat flux toroidal pumped limiter for Tore Supra
International Nuclear Information System (INIS)
Doceul, L.; Schlosser, J.; Chappuis, Ph.; Chatelier, M.; Cocat, J.P.; Deck, C.; Faisse, F.; Grosman, A.; Mitteau, R.; Tonon, G.
1994-01-01
In the frame of the Tore-Supra upgrade, where it is planned to inject up to 25 MW during a time up to 1000 s, a complete toroidal pumped limiter covered of CFC (Carbon Fiber Composite) tiles is being designed. The design is based on the important experience gained from the operation on Tore Supra of actively cooled plasma facing components and pumped limiters. This toroidal limiter covers 7.5 m 2 of the bottom part of the inner vessel and is composed of 576 elementary components. Each element is built from dispersion strengthened copper (DSCu) protected by brazed CFC flat tiles and cooled by pressurised water at 150 deg C. This limiter is designed to sustain 15 MW of convective power. (author) 7 refs.; 5 figs., 3 tabs
Addition of 1, 2 and 3% in mass of sodium alginate in calcium phosphate cement
International Nuclear Information System (INIS)
Coelho, W.T.; Fernandes, J.M.; Vieira, R.S.; Thurmer, M.B.; Santos, L.A.
2011-01-01
The calcium phosphate cement (CFC) are bone substitutes with great potential for use in orthopedics, traumatology and dentistry because of their biocompatibility, bioactivity, osteoconductivity and osteotransdutivity, and a paste that can be easily molded and placed into the surgical site. However, CFCs have low mechanical strength, which equals the maximum mechanical strength of trabecular bone. Aiming to evaluate the strength and time to handle a CFC phase composed mainly of alpha were added to sodium alginate (1%, 2% and 3% wt) and an accelerator handle in an aqueous medium. The cement powder was mixed with liquid takes 2 minutes and resigned in specimens and assessed for apparent density and porosity by the Archimedes method, X-ray diffraction and mechanical strength. We noticed a significant increase in mechanical properties of cement added sodium alginate. (author)
Treatment of chlorofluorocarbons in alcohol solutions by γ-irradiation
International Nuclear Information System (INIS)
Shimokawa, Toshinari; Nakagawa, Seiko; Sawai, Teruko
1995-01-01
A study was done on dechlorination of 1,1,2-trichloro-1,2,2-trifluoroethane (CFC113) in neutral and alkaline alcohol solutions by means of γ-irradiation. The dechlorination yield (G (Cl - )) was found to depend on the kind of alcohol used as solvents and the presence of hydroxide ion. The order of G (Cl - ) value in alkaline solution was isopropyl alcohol>> ethyl alcohol > methyl alcohol. It was suggested that the high yield obtained in alkaline isopropyl alcohol solution is explained by a chain process in dechlorination reaction. In case of alkaline isopropyl alcohol solution, CFC113 was dechlorinated to lower chlorinated ethane, and 1,1-dichloro-1,2,2-trifluoroetane was a main product. We have discussed on the chain dechlorination mechanism in alkaline isopropyl alcohol solution. (author)
DEFF Research Database (Denmark)
Parving, H H; Noer, Ivan; Deckert, Toke
1976-01-01
injected 125I-labelled human serum albumin; GFR was measured on the forearm by straingauge plethysmography and CDS for 51Cr-EDTA clearance; CFC was measured on the forearm by straingauge plethysmography and CDC, for 51Cr-EDTA was determined in the jyperaemic anterio tibial muscle by the local clearance......The microvascular permeability to small and large molecules was studied during good and poor metabolic regulation in ten short duration juvenile diabetics. The following variables were measured; daily urinary albumin and beta2-microglobulin-excretion rates, whole body transcapillary escape rate...... of albumin (TER), glomerular filtration rate (GFR), capillary filtration coefficient (CFC), and capillary diffusion capacity (CDC). The urinary albumin and beta2-microglobulin concentration were measured by sensitive radioimmunoassays; TER was detemined from the initial disappearance of intravenously...
Investigation of plasma facing components in JT-60U operation
International Nuclear Information System (INIS)
Masaki, K.; Ando, T.; Kodama, K.; Arai, T.; Neyatani, Y.; Yoshino, R.; Tsuji, S.; Yagyu, J.; Kaminaga, A.; Sasajima, T.; Ouchi, Y.; Koike, T.; Shimizu, M.
1995-01-01
The mechanical fracture of three carbon fiber composite (CFC) first wall tiles was observed. This damage was probably caused by the electromagnetic force due to halo current during disruption. The required current to break the CFC tile is estimated to be 25 kA. The broken tile was rotated poloidally around the plasma with a speed of about 10 m/s during the following discharge. A possible driving force of this rotation might be the electromagnetic force due to the scrape-off layer (SOL) current. The required current to rotate the piece of the broken tile is 1 kA. These results indicate that electromagnetic interaction between SOL plasma and the plasma facing components is important in the research on the plasma wall interactions in fusion devices. ((orig.))
International Nuclear Information System (INIS)
Bjarnov, E.; Munk, J.; Nielsen, O.J.; Pagsberg, P.; Sillesen, A.
1982-04-01
Gas phase reactions of hydroxyl radicals with ethane and a series of Cl- and F-substituted methanes were studied at atmospheric pressure and over the temperature range 300-400degK. Hydroxyl radicals were produced by pulse radiolysis of water vapour and the decay rate was studied by monitoring the transient light absorption at 3090 A. Arrhenius parameters (A,Esub(a)) for the reaction RH + OH arrow R + HOH were obtained for the reactants RH = C 2 H 6 ,CH 3 Cl,CH 2 Cl 2 ,CHFCl 2 . CF 2 Cl 2 (CFC-12) which contains no C-H bonds was found to be inert toward attack by hydroxyl radicals. Since no other tropospheric sink reactions have been reported for CFC-12 its possible impact on the stratospheric ozone remains a controversial problem. (author)
Analysis of new species retrieved from MIPAS
Directory of Open Access Journals (Sweden)
Shaomin Cai
2014-02-01
Full Text Available The Michelson Interferometer for Passive Atmospheric Sounding (MIPAS instrument which operated on the Envisat satellite from 2002-2012 is a Fourier transform spectrometer for the measurement of high-resolution gaseous emission spectra at the Earth's limb. It operates in the near- to mid-infrared, where many of the main atmospheric trace gases have important emission features. The initial operational products were profiles of Temperature, H2O, O3, CH4, N2O, HNO3, and NO2, and this list was recently extended to include N2O5, ClONO2, CFC-11 and CFC-12. Here we present preliminary results of retrievals of the third set of species under consideration for inclusion in the operational processor: HCN, CF4, HCFC-22, COF2 and CCl4.
International Nuclear Information System (INIS)
Reichle, R; Desgranges, C; Faisse, F; Pocheau, C; Lasserre, J-P; Oelhoffen, F; Eupherte, L; Todeschini, M
2009-01-01
Tore Supra has-like ITER-reflecting internal surfaces, which can perturb the machine protection systems based on infrared (IR) thermography. To ameliorate this situation, we have measured and modelled in the 3-5 μm wavelength range the bi-directional reflection distribution function (BRDF) of wall material samples from Tore Supra and conducted in situ reflection measurements and simulated them with the CEA COSMOS code. BRDF results are presented for B 4 C and carbon fibre composite (CFC) tiles. The hemispherical integrated reflection ranges from 0.12 for the B 4 C sample to 0.39 for a CFC tile from the limiter erosion zone. In situ measurements of the IR reflection of a blackbody source off an ICRH and an LHCD antenna of Tore Supra are well reproduced by the simulation.
Energy Technology Data Exchange (ETDEWEB)
Reichle, R; Desgranges, C; Faisse, F; Pocheau, C [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Lasserre, J-P; Oelhoffen, F; Eupherte, L; Todeschini, M [CEA, DAM, CESTA, F-33114 Le Barp (France)
2009-12-15
Tore Supra has-like ITER-reflecting internal surfaces, which can perturb the machine protection systems based on infrared (IR) thermography. To ameliorate this situation, we have measured and modelled in the 3-5 {mu}m wavelength range the bi-directional reflection distribution function (BRDF) of wall material samples from Tore Supra and conducted in situ reflection measurements and simulated them with the CEA COSMOS code. BRDF results are presented for B{sub 4}C and carbon fibre composite (CFC) tiles. The hemispherical integrated reflection ranges from 0.12 for the B{sub 4}C sample to 0.39 for a CFC tile from the limiter erosion zone. In situ measurements of the IR reflection of a blackbody source off an ICRH and an LHCD antenna of Tore Supra are well reproduced by the simulation.
Metal-Detergent/Cleaner Compatibility
National Research Council Canada - National Science Library
Hindin, Barry
1994-01-01
...) such as CFC-1 13 or 1,1,1 Trichioroethane (TCA) in their cleaning and degreasing procedures. During the last few years, AGMC has been evaluating alternative, environmentally acceptable chemicals to replace their ODC cleaners...
5 CFR 4501.103 - Prior approval for certain outside activities.
2010-01-01
... official duties involve the administration of the CFC program; or (4)(i) Except as provided in paragraph (a... otherwise to represent, such an OPM employee who is the subject of disciplinary, loyalty, or other personnel...
Presidential Green Chemistry Challenge: 1996 Greener Reaction Conditions Award
Presidential Green Chemistry Challenge 1996 award winner, Dow Chemical Company, developed a process to manufacture polystyrene foam sheet packaging that uses carbon dioxide (CO2) as a blowing agent, eliminating CFC-12 and HCFC-22.
Consumerism triggers AC explosion
Energy Technology Data Exchange (ETDEWEB)
Lafferty, Richard
1997-05-01
The growth in air conditioning in the United Kingdom in recent years is examined in this article, and split systems, the phasing out of CFC and HCFC refrigerants, global warming, and comfort levels are considered. (UK)
National Research Council Canada - National Science Library
Allmond, Samuel
2003-01-01
...; and secondly by producing the world's largest SPF. North Korea (NK) has built the world's largest SPF in the world with more than 100,000 men to support surprise attacks to disrupt CFC combat buildup and operations...
Directory of Open Access Journals (Sweden)
Mirza Yusuf
2017-12-01
Full Text Available Ramah lingkungan menjadi isu yang gencar dalam penelitian. Cloro Fluoro Carbon (CFC yang digunakan dalam AC konvensional akan menguap ke udara bebas berdampak kerusakan lapisan ozon. Ditinjau secara micro dalam penggunaan sitem pendingin dapat diterapkan pada pendingin kabin mobil. System pendingin mobil konfensional menimbulkan 2 kerugian yaitu lebih boros bahan bakar karena couple pulley compressor AC membebani putaran mesin dan penggunaan CFC yang tidak ramah lingkungan. System pendingin ramah lingkunagan dan mampu menghemat bahan bakar mesin tersebut dapat kita temukan pada modul thermoelectric. terobosan baru sistem pendingin tersebut menggunakan modul pendingin Thermo Electric Cooler (TEC yang memanfaatkan sisi dingin pada Thermo Electric Cooler (TEC dengan memanfaatkan seaback effect . Thermo Electric Cooler (TEC ketika dialiri tegangan DC (arus searah pada kedua jalur kabel penghubungnya maka salah satu sisi akan menjadi panas, sementara sisi satunya akan menjadi dingin. Salahsatu cara yang dapat ditempuh untuk memaksimalkan proses pendinginan, maka sisi panas Thermo Electric Cooler (TEC harus diturunkan temperaturenya serendah mungkin mungkin dengan menggunakan alat penukar kalor heat sink serta dibantu kipas(fan. semakin lama proses pendinginan, maka semakin optimal suhu ruangan yang didinginkan. Dari data Hasil pengujian dapat diketahui perangkat pendingin tersebut mampu bekerja dengan rate penurunan temperature memadai. Selanjutnya dapat dapat diaplikasikan sebagai alat pendingin ruangan yang efektif, efisien dan ramah lingkungan. Kata kunci: Kabin mobil, Air Conditioner (AC konvensional, Cloro Fluoro Carbon (CFC, Thermo Electric Cooler (TEC, komponen sistem pendingin.
Comparison of halocarbon measurements in an atmospheric dry whole air sample.
Rhoderick, George C; Hall, Bradley D; Harth, Christina M; Kim, Jin Seog; Lee, Jeongsoon; Montzka, Stephen A; Mühle, Jens; Reimann, Stefan; Vollmer, Martin K; Weiss, Ray F
The growing awareness of climate change/global warming, and continuing concerns regarding stratospheric ozone depletion, will require continued measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track atmospheric mole fractions and assess the impact of policy on emission rates, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. Precise measurements of these species aid in determining small changes in their atmospheric abundance. A common source of standards/scales and/or well-documented agreement of different scales used to calibrate the measurement instrumentation are key to understanding many sets of data reported by researchers. This report describes the results of a comparison study among National Metrology Institutes and atmospheric research laboratories for the chlorofluorocarbons (CFCs) dichlorodifluoromethane (CFC-12), trichlorofluoromethane (CFC-11), and 1,1,2-trichlorotrifluoroethane (CFC-113); the hydrochlorofluorocarbons (HCFCs) chlorodifluoromethane (HCFC-22) and 1-chloro-1,1-difluoroethane (HCFC-142b); and the hydrofluorocarbon (HFC) 1,1,1,2-tetrafluoroethane (HFC-134a), all in a dried whole air sample. The objective of this study is to compare calibration standards/scales and the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. The results of this study show agreement among four independent calibration scales to better than 2.5% in almost all cases, with many of the reported agreements being better than 1.0%.
Comparison of halocarbon measurements in an atmospheric dry whole air sample
Directory of Open Access Journals (Sweden)
George C. Rhoderick
2015-11-01
Full Text Available Abstract The growing awareness of climate change/global warming, and continuing concerns regarding stratospheric ozone depletion, will require continued measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track atmospheric mole fractions and assess the impact of policy on emission rates, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. Precise measurements of these species aid in determining small changes in their atmospheric abundance. A common source of standards/scales and/or well-documented agreement of different scales used to calibrate the measurement instrumentation are key to understanding many sets of data reported by researchers. This report describes the results of a comparison study among National Metrology Institutes and atmospheric research laboratories for the chlorofluorocarbons (CFCs dichlorodifluoromethane (CFC-12, trichlorofluoromethane (CFC-11, and 1,1,2-trichlorotrifluoroethane (CFC-113; the hydrochlorofluorocarbons (HCFCs chlorodifluoromethane (HCFC-22 and 1-chloro-1,1-difluoroethane (HCFC-142b; and the hydrofluorocarbon (HFC 1,1,1,2-tetrafluoroethane (HFC-134a, all in a dried whole air sample. The objective of this study is to compare calibration standards/scales and the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. The results of this study show agreement among four independent calibration scales to better than 2.5% in almost all cases, with many of the reported agreements being better than 1.0%.
Substitutes for potent green house gases. HFCs, PFCs and SF{sub 6}. Status report
Energy Technology Data Exchange (ETDEWEB)
Pedersen, P.H. [Dansk Teknologisk Institut (Denmark)
1997-12-31
CFCs (halogenated chlorofluorocarbons), HCFCs (hydrochlorofluorocarbons), HFCs (hydrofluorocarbons), PFCs (fluorocarbons) and SF{sub 6} (sulphur hexafluoride) are all artificial substances which were not to be found in nature until recently. In 1995 the Danish consumption of HFC substances was approximately 740 tonnes, where the corresponding amount of SF{sub 6} was about 17 tonnes. If the entire amount of these substances was released to to the atmosphere, the resulting impact would correspond to an increased emission of greenhouse gases, corresponding to approximately 1.5 million tonnes of CO{sub 2}. HFC substances would account for 73%, SF{sub 6} with 25% and PFC for 1%. This corresponds to approximately 2.6% of the Danish CO{sub 2} emission (nearly 60 million tonnes per year). This corresponds to about half of the aimed 6% reduction of CO{sub 2} emission attained by introduction of mandatory green taxes on CO{sub 2}. According to experience from the CFC programme it is possible to recover some CFC and send it to controlled destruction. From 1993 to 1996 the refrigeration industry, for instance, has returned a total amount of 163 tonnes of CFC refrigerant through the KMO organization (Koelebranchens Miljoe Ordning). Most of this has been destroyed and a small amount has been purified and recycled afterwards. Similarly, it is likely to believe that some HFC refrigerant will be returned through the KMO organization. (au) 11 refs., also published in Danish
Directory of Open Access Journals (Sweden)
Shrivastava Sachin
2015-01-01
Full Text Available The minimization of weight and maximization of payload is an ever challenging design procedure for air vehicles. The present study has been carried out with an objective to redesign control surface of an advanced all-metallic fighter aircraft. In this study, the structure made up of high strength aluminum, titanium and ferrous alloys has been attempted to replace by carbon fiber composite (CFC skin, ribs and stiffeners. This study presents an approach towards development of a methodology for optimization of first-ply failure index (FI in unidirectional fibrous laminates using Genetic-Algorithms (GA under quasi-static loading. The GAs, by the application of its operators like reproduction, cross-over, mutation and elitist strategy, optimize the ply-orientations in laminates so as to have minimum FI of Tsai-Wu first-ply failure criterion. The GA optimization procedure has been implemented in MATLAB and interfaced with commercial software ABAQUS using python scripting. FI calculations have been carried out in ABAQUS with user material subroutine (UMAT. The GA's application gave reasonably well-optimized ply-orientations combination at a faster convergence rate. However, the final optimized sequence of ply-orientations is obtained by tweaking the sequences given by GA's based on industrial practices and experience, whenever needed. The present study of conversion of an all metallic structure to partial CFC structure has led to 12% of weight reduction. Therefore, the approach proposed here motivates designer to use CFC with a confidence.
Prototyping phase of the high heat flux scraper element of Wendelstein 7-X
Energy Technology Data Exchange (ETDEWEB)
Boscary, J., E-mail: jean.boscary@ipp.mpg.de [Max Planck Institute for Plasma Physics, Garching (Germany); Greuner, H. [Max Planck Institute for Plasma Physics, Garching (Germany); Ehrke, G. [Max Planck Institute for Plasma Physics, Greifswald (Germany); Böswirth, B.; Wang, Z. [Max Planck Institute for Plasma Physics, Garching (Germany); Clark, E. [University of Tennessee, Knoxville (United States); Lumsdaine, A. [Oak Ridge National Laboratory, USA National Laboratory, Oak Ridge, Tennessee (United States); Tretter, J. [Max Planck Institute for Plasma Physics, Garching (Germany); McGinnis, D.; Lore, J. [Oak Ridge National Laboratory, USA National Laboratory, Oak Ridge, Tennessee (United States); Ekici, K. [University of Tennessee, Knoxville (United States)
2016-11-01
Highlights: • Aim of scraper element: reduction of heat loads on high heat flux divertor ends. • Design: actively water-cooled for 20 MW/m{sup 2} local heat loads. • Technology: CFC NB31 monoblocks bonded by HIP to CuCrZr cooling tube. • Successful high heat flux testing up to 20 MW/m{sup 2}. - Abstract: The water-cooled high heat flux scraper element aims to reduce excessive heat loads on the target element ends of the actively cooled divertor of Wendelstein 7-X. Its purpose is to intercept some of the plasma fluxes both upstream and downstream before they reach the divertor surface. The scraper element has 24 identical plasma facing components (PFCs) divided into 6 modules. One module has 4 PFCs hydraulically connected in series by 2 water boxes. A PFC, 247 mm long and 28 mm wide, has 13 monoblocks made of CFC NB31 bonded by hot isostatic pressing onto a CuCrZr cooling tube equipped with a copper twisted tape. 4 full-scale prototypes of PFCs have been successfully tested in the GLADIS facility up to 20 MW/m{sup 2}. The difference observed between measured and calculated surface temperatures is probably due to the inhomogeneity of CFC properties. The design of the water box prototypes has been detailed to allow the junction between the cooling pipe of the PFCs and the water boxes by internal orbital welding. The prototypes are presently under fabrication.
Goble, D.; Gardner, W. P.; Naftz, D. L.; Solder, J. E.
2017-12-01
We use environmental tracers: CFC's, SF6, and 222Rn measured in stream water to determine volume and mean age of groundwater discharging to the Little Wind River, near Riverton, Wyoming. Samples of 222Rn were collected every 200 m along a 2 km reach, surrounding a known groundwater discharge zone. Nearby groundwater wells, in-stream piezometers and seepage meters were sampled for 222Rn, CFC's and SF6. Tracer concentrations measured in groundwater and in-stream piezometers were used to estimate the mean age of the subsurface system. High resolution 222Rn samples were used to determine the location and volume of groundwater inflow using a model of instream transport that includes radioactive decay and gas exchange with the atmosphere. The age of groundwater entering the stream was then estimated from in-stream measured CFC and SF6 concentrations using a new coupled stream transport and lumped-parameter groundwater age model. Ages derived from in-stream measurements were then compared to the age of subsurface water measured in piezometers, seepage meters, and groundwater wells. We then asses the ability of groundwater age inferred from in-stream samples to provide constraint on the age of the subsurface discharge to the stream. The ability to asses groundwater age from in-stream samples can provide a convenient method to constrain the regional distribution of groundwater circulation rates when groundwater sampling is challenging or wells are not in place.
Kutz, Dieter F; Schmid, Barbara C; Meindl, Tobias; Timmann, Dagmar; Kolb, Florian P
2016-08-01
The "raspberry task" represents a precision grip task that requires continuous adjustment of grip forces and pull forces. During this task, subjects use a specialised grip rod and have to increase the pull force linearly while the rod is locked. The positions of the fingers are unrestrained and freely selectable. From the finger positions and the geometry of the grip rod, a physical lever was derived which is a comprehensive measurement of the subject's grip behaviour. In this study, the involvement of the cerebellum in establishing cued force changes (CFC) was examined. The auditory stimulus was associated with a motor behaviour that has to be readjusted during an ongoing movement that already started. Moreover, cerebellar involvement on grip behaviour was examined. The results show that patients presenting with degenerating cerebellar disease (CBL) were able to elicit CFC and were additionally able to optimise grip behaviour by minimising the lever. Comparison of the results of CBL with a control group of healthy subjects showed, however, that the CFC incidence was significantly lower and the reduction of the lever was less in CBL. Hence, the cerebellum is involved not only in the classical conditioning of reflexes but also in the association of sensory stimuli with complex changes in motor behaviour. Furthermore, the cerebellum is involved in the optimisation of grip behaviour during ongoing movements. Recent studies lead to the assumption that the cerebello-reticulo-spinal pathway might be important for the reduced optimisation of grip behaviour in CBL.
Comparison of halocarbon measurements in an atmospheric dry whole air sample
Hall, Bradley D.; Harth, Christina M.; Kim, Jin Seog; Lee, Jeongsoon; Montzka, Stephen A.; Mühle, Jens; Reimann, Stefan; Vollmer, Martin K.; Weiss, Ray F.
2015-01-01
The growing awareness of climate change/global warming, and continuing concerns regarding stratospheric ozone depletion, will require continued measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track atmospheric mole fractions and assess the impact of policy on emission rates, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. Precise measurements of these species aid in determining small changes in their atmospheric abundance. A common source of standards/scales and/or well-documented agreement of different scales used to calibrate the measurement instrumentation are key to understanding many sets of data reported by researchers. This report describes the results of a comparison study among National Metrology Institutes and atmospheric research laboratories for the chlorofluorocarbons (CFCs) dichlorodifluoromethane (CFC-12), trichlorofluoromethane (CFC-11), and 1,1,2-trichlorotrifluoroethane (CFC-113); the hydrochlorofluorocarbons (HCFCs) chlorodifluoromethane (HCFC-22) and 1-chloro-1,1-difluoroethane (HCFC-142b); and the hydrofluorocarbon (HFC) 1,1,1,2-tetrafluoroethane (HFC-134a), all in a dried whole air sample. The objective of this study is to compare calibration standards/scales and the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. The results of this study show agreement among four independent calibration scales to better than 2.5% in almost all cases, with many of the reported agreements being better than 1.0%. PMID:26753167
International Nuclear Information System (INIS)
Weber, J.
1993-01-01
Last December, after an all-out, nearly $500 million development effort, an Imperial Chemical Industries (ICI) plant in Louisiana was the first world-scale US facility to start pumping out HFC 134a, an alternative to CFC12, the chemical that accounts for more than 50% of CFC use. The saga of 134a is an object lesson in how a global crisis can compel governments and companies to transform technology far faster than either thought possible. With deadlines for phasing out CFCs closing in, ICI and its rivals, Du Pont and Elf, developed technology speedily by constructing factories even while their choice molecules were still being tested. ICI slashed the time it takes to commercialize a technology from the industry norm of more than a decade to only five years. If companies are forced to act on environmental issues, they do it
International Nuclear Information System (INIS)
Gregor, Klaus; Reinhart, Anton
1998-01-01
Stringent regulations to reduce the use of chlorofluorocarbons (CFC) and halogenated chlorofluorocarbons (HCFC) have been set into force by many European countries. A ban for new plants containing HCFCs in 2005 and a total ban of HCFCs in 2020 are discussed within the European Community. Siemens-KWU and Sulzer Escher Wyss have developed a well-proofed procedure to solve the CFC problem for existing refrigeration systems in nuclear power plants. The new refrigerants are fluorinated hydrocarbons and for the centrifugal water chiller R134a is best suited. Prior to the market introduction toxicity, short and long term health effects, inflammability and stability of R134a have been investigated. The mechanical examination included wear, corrosion, lubrication and resistance to decomposition. A well-proven procedure was established which ensures the owner of the plant and the supplier best results
2010-07-01
... the following criteria, derived from Society of Automotive Engineers (SAE) standards and recommended... Substitutes] Application Substitute Decision Conditions Comments Electronics Cleaning w/CFC-113 and MCF HFC... Sector [Acceptable Subject to Narrowed Use Limits] Application Substitute Decision Comments Electronics...
Global Warming: How Much and Why?
Lanouette, William
1990-01-01
Summarizes the history of the study of global warming and includes a discussion of the role of gases, like carbon dioxide, methane, and chlorofluorocarbon (CFC). Discusses modern research on the global warming, including computer modelling and the super-greenhouse effect. (YP)
Gerwen, R.J.M. van; Verwoerd, M.; Oostendorp, P.A.
1999-01-01
Hydrocarbons are promising alternatives for CFC, HCFC and HFC refrigerants. Due to their flammable nature, safety aspects have to be considered carefully. The world-wide situation concerning acceptability and practical application of flammable refrigerants is becoming more and more complex and
The Fourth International Symposium on Genetic Disorders of the Ras/MAPK pathway
D.A. Stevenson (David A.); L. Schill (Lisa); L. Schoyer (Lisa); B.S. Andresen (B.); A. Bakker (Annette); P. Bayrak-Toydemir (Pinar); E.M.M. Burkitt Wright (Emma M.); K. Chatfield (Kathryn); F. Elefteriou (Florent); Y. Elgersma (Ype); M.J. Fisher (Michael J.); D. Franz (David); B.D. Gelb (Bruce); A. Goriely (Anne); K.W. Gripp (Karen); A.Y. Hardan (Antonio Y.); K.M. Keppler-Noreuil (Kim M.); B. Kerr (Bronwyn); B. Korf (Bruce); C. Leoni (Chiara); F. Mccormick (Frank); S.R. Plotkin (Scott R.); K.A. Rauen (Katherine); K. Reilly (Karlyne); A.E. Roberts; A. Sandler (Abby); D. Siegel (Dawn); K.S. Walsh (Karin S.); B.C. Widemann (Brigitte C.)
2016-01-01
textabstractThe RASopathies are a group of disorders due to variations of genes associated with the Ras/MAPK pathway. Some of the RASopathies include neurofibromatosis type 1 (NF1), Noonan syndrome, Noonan syndrome with multiple lentigines, cardiofaciocutaneous (CFC) syndrome, Costello syndrome,
Mutation analysis of the SHOC2 gene in Noonan-like syndrome and in hematologic malignancies
Komatsuzaki, Shoko; Aoki, Yoko; Niihori, Tetsuya; Okamoto, Nobuhiko; Hennekam, Raoul C. M.; Hopman, Saskia; Ohashi, Hirofumi; Mizuno, Seiji; Watanabe, Yoriko; Kamasaki, Hotaka; Kondo, Ikuko; Moriyama, Nobuko; Kurosawa, Kenji; Kawame, Hiroshi; Okuyama, Ryuhei; Imaizumi, Masue; Rikiishi, Takeshi; Tsuchiya, Shigeru; Kure, Shigeo; Matsubara, Yoichi
2010-01-01
Noonan syndrome is an autosomal dominant disease characterized by dysmorphic features, webbed neck, cardiac anomalies, short stature and cryptorchidism. It shows phenotypic overlap with Costello syndrome and cardio-facio-cutaneous (CFC) syndrome. Noonan syndrome and related disorders are caused by
Detailed electromagnetic analysis for optimization of a tungsten divertor plate for JET
International Nuclear Information System (INIS)
Sadakov, S.; Bondarchuk, E.; Doinikov, N.; Kitaev, B.; Kozhukhovskaya, N.; Maximiva, I.; Hirai, T.; Mertens, P.; Neubauer, O.; Obidenko, T.
2006-01-01
The ITER-like wall project at JET involves the replacement of the divertor tiles by either tungsten-coated carbon fibre composite (CFC) or solid tungsten. The background is a full replacement of CFC in order to avoid tritium retention due to co-deposition of carbon. In a R-and-D phase (T.Hirai et al., R-and-D on full tungsten divertor and beryllium wall for JET ITER-like Wall Project.), both tungsten coating and solid tungsten are investigated. Tungsten has a high electrical conductivity, exceeding that of graphite or CFC by two orders of magnitude. This drawback has to be compensated by a proper design (Ph. Mertens et al., Conceptual Design for a Bulk Tungsten Divertor Tile in JET (both citations: this conference)). This report shows how detailed electromagnetic consideration has influenced the design of the solid tungsten divertor for JET. Patterns and sum values were calculated for: (1) eddy currents induced by variation of two orthogonal magnetic fields; (2) toroidal eddy current induced by variation of the poloidal magnetic flux, (3) eddy-current related loads in three orthogonal magnetic fields; (4) Halo current pattern for two cases; (5) Halo-current related loads in three orthogonal magnetic fields; (6) the worst loads combinations; (7) stresses in fixtures. Analytical and numerical methods were combined and cross-checked. The load-bearing septum replacement plate (LB-SRP) which is currently used in the JET divertor consists of two large CFC tiles attached to two superimposed Inconel frames, namely wedge and adapter. The present design is quite loaded by eddy-currents and does not allow for simple replacement of the CFC with solid tungsten. A tree-like shape, which excludes large contours of eddy currents, is proposed. In realization of the tree-like shape, the wedge has a narrow middle part, elongated in radial direction, and eight wings, elongated in toroidal direction. Eight feet form the Halo current path. Each wing carries one tungsten lamellae stack
Simulation of cracks in tungsten under ITER specific heat loads
International Nuclear Information System (INIS)
Peschany, S.
2006-01-01
The problem of high tritium retention in co-deposited carbon layers on the walls of ITER vacuum chamber motivates investigation of materials for the divertor armour others than carbon fibre composite (CFC). Tungsten is most probable material for CFC replacement as the divertor armour because of high vaporisation temperature and heat conductivity. In the modern ITER design tungsten is a reference material for the divertor cover, except for the separatrix strike point armoured with CFC. As divertor armour, tungsten should withstand severe heat loads at off-normal ITER events like disruptions, ELMs and vertical displacement events. Experiments on tungsten heating with plasma streams and e-beams have shown an intense crack formation at the surface of irradiated sample [ V.I. Tereshin, A.N. Bandura, O.V. Byrka et al. Repetitive plasma loads typical for ITER type-I ELMs: Simulation at QSPA Kh-50.PLASMA 2005. ed. By Sadowski M.J., AIP Conference Proceedings, American Institute of Physics, 2006, V 812, p. 128-135., J. Linke. Private communications.]. The reason for tungsten cracking under severe heat loads is thermo stress. It appears as due to temperature gradient in solid tungsten as in resolidified layer after cooling down. Both thermo stresses are of the same value, but the gradiental stress is compressive and the stress in the resolidified layer is tensile. The last one is most dangerous for crack formation and it was investigated in this work. The thermo stress in tungsten that develops during cooling from the melting temperature down to room temperature is ∼ 8-16 GPa. Tensile strength of tungsten is much lower, < 1 GPa at room temperature, and at high temperatures it drops at least for one order of magnitude. As a consequence, various cracks of different characteristic scales appear at the heated surface of the resolidified layer. For simulation of the cracks in tungsten the numeric code PEGASUS-3D [Pestchanyi and I. Landman. Improvement of the CFC structure to
Stratospheric measurements of ozone-depleting substances and greenhouse gases using AirCores
Laube, Johannes; Leedham Elvidge, Emma; Kaiser, Jan; Sturges, Bill; Heikkinen, Pauli; Laurila, Tuomas; Hatakka, Juha; Kivi, Rigel; Chen, Huilin; Fraser, Paul; van der Veen, Carina; Röckmann, Thomas
2017-04-01
Retrieving air samples from the stratosphere has previously required aircraft or large balloons, both of which are expensive to operate. The novel "AirCore" technique (Karion et al., 2010) enables stratospheric sampling using weather balloons, which is much more cost effective. AirCores are long (up to 200 m) stainless steel tubes which are placed as a payload on a small balloon, can ascend to over 30 km and fill upon descent, collecting a vertical profile of the atmosphere. Retrieved volumes are much smaller though, which presents a challenge for trace gas analysis. To date, only the more abundant trace gases such as carnon dioxide (CO2) and methane (CH4) have been quantified in AirCores. Halogenated trace gases are also important greenhouse gases and many also deplete stratospheric ozone. Their concentrations are however much lower i.e. typically in the part per trillion (ppt) molar range. We here present the first stratospheric measurements of halocarbons in AirCores obtained using UEA's highly sensitive (detection limits of 0.01-0.1 ppt in 10 ml of air) gas chromatography mass spectrometry system. The analysed air originates from a Stratospheric Air Sub-sampler (Mrozek et al., 2016) which collects AirCore segments after the non-destructive CO2 and CH4 analysis. Successfully measured species include CFC-11, CFC-12, CFC-113, CFC-115, H-1211, H-1301, HCFC-22, HCFC-141b, HCFC-142b, HCFC-133a, and sulphur hexafluoride (SF6). We compare the observed mixing ratios and precisions with data obtained from samples collected during various high-altitude aircraft campaigns between 2009 and 2016 as well as with southern hemisphere tropospheric long-term trends. As part of the ERC-funded EXC3ITE (EXploring stratospheric Composition, Chemistry and Circulation with Innovative Techniques) project more than 40 AirCore flights are planned in the next 3 years with an expanded range of up to 30 gases in order to explore seasonal and interannual variability in the stratosphere
Improvement of thermal shock resistance of isotropic graphite by ti-doping
International Nuclear Information System (INIS)
Lopez-Galilea, I.; Ordas, N.; Garcia-Rosales, C.; Lindig, S.
2007-01-01
Full text of publication follows: Carbon fiber reinforced carbon (CFC) is the present candidate material for the strike point area of the ITER divertor due to its ability to withstand excessive heat loads during ELMs and plasma disruptions. However, chemical erosion of carbon under hydrogen bombardment from the plasma involves serious disadvantages for this application (replacement and safety problems due to tritium co-deposition). In addition, the manufacturing process of present CFC candidate materials is long and complex resulting in high costs, and CFC materials are inherently anisotropic. Doping of carbon with small amounts (several at. %) of titanium has proved to be effective in reducing chemical erosion while maintaining or even improving the mechanical properties. furthermore, TiC as dopant contributes to increase significantly the thermal conductivity and consequently the thermal shock resistance, due to the catalytic effect of this carbide on the graphitization. The aim of this work is to improve substantially the thermal shock resistance of fine-grained isotropic graphite by doping it with small amounts of TiC, reducing at the same time the chemical erosion. By this way Ti-doped graphites could be competitive with present CFC candidate materials for next step fusion devices. To achieve this, a synthetic naphthalene-derived mesophase pitch named AR is used as carbon precursor; this raw material exhibits excellent graphitizability, high chemical purity and consistent quality. Due to the low viscosity at the softening point of AR, resulting in swelling during the carbonization treatment, it is necessary to modify the initial viscosity of AR by an adequate oxidative stabilization treatment. As dopant, TiC powder with 130 nm average particle size is added. The influence of several manufacturing parameters such as oxidative stabilization treatment, carbonization cycle, graphitization temperature and dwell time during graphitization have been investigated in
Improvement of thermal shock resistance of isotropic graphite by ti-doping
Energy Technology Data Exchange (ETDEWEB)
Lopez-Galilea, I.; Ordas, N.; Garcia-Rosales, C. [Navarrra Univ., CEPT, San Sebastian (Spain); Lindig, S. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, Garching (Germany)
2007-07-01
Full text of publication follows: Carbon fiber reinforced carbon (CFC) is the present candidate material for the strike point area of the ITER divertor due to its ability to withstand excessive heat loads during ELMs and plasma disruptions. However, chemical erosion of carbon under hydrogen bombardment from the plasma involves serious disadvantages for this application (replacement and safety problems due to tritium co-deposition). In addition, the manufacturing process of present CFC candidate materials is long and complex resulting in high costs, and CFC materials are inherently anisotropic. Doping of carbon with small amounts (several at. %) of titanium has proved to be effective in reducing chemical erosion while maintaining or even improving the mechanical properties. furthermore, TiC as dopant contributes to increase significantly the thermal conductivity and consequently the thermal shock resistance, due to the catalytic effect of this carbide on the graphitization. The aim of this work is to improve substantially the thermal shock resistance of fine-grained isotropic graphite by doping it with small amounts of TiC, reducing at the same time the chemical erosion. By this way Ti-doped graphites could be competitive with present CFC candidate materials for next step fusion devices. To achieve this, a synthetic naphthalene-derived mesophase pitch named AR is used as carbon precursor; this raw material exhibits excellent graphitizability, high chemical purity and consistent quality. Due to the low viscosity at the softening point of AR, resulting in swelling during the carbonization treatment, it is necessary to modify the initial viscosity of AR by an adequate oxidative stabilization treatment. As dopant, TiC powder with 130 nm average particle size is added. The influence of several manufacturing parameters such as oxidative stabilization treatment, carbonization cycle, graphitization temperature and dwell time during graphitization have been investigated in
Redesign 3 R Machine as a Refrigerant Waste Treatment Alternative in Environmental Rescue
Negara, I. P. S.; Arsawan, I. M.
2018-01-01
Cooling machine technologies really affect nowadays’ modern life, not only limited in enhancement of life quality and comfort, but it has also reached the essential things of humans’ life supporter (Arora, 2001). Cooling machine technologies have direct contribution toward environmental damage such as depletion of ozone layer and global warming through synthetic refrigerant waste and leakage (CFC and HFC) to environment. The refrigerant release to the environment is 60% of the service sector. Destructive characteristics of ozone possessed by CFC were first proposed by Rowland and Molina which were then supported by yard measurement. It is estimated that ozone layer damage occurs for about 3% every decade. The ozone layer located in the stratosphere is functioned to prevent ultraviolet-B ray from entering into earth surface. This Ultraviolet-B is suspected to be the cause of health problem for humans and disorder for plants on earth. As for the purpose of this research is to obtain a product design of refrigerant waste processing system (recovery and recycle refrigerant) as well as to acknowledge the work method (COP) of cooling machines that use CFC refrigerant (R-12) as the result of recovery and recycle compared to CFC refrigerant (R-12)/pure R134a. One method that can be used is by redesigning existing equipment namely 3R machine that cannot be used anymore thus it can be reused. This research will be conducted through modifying the existing 3R machine therefore it can be reused and be easily operated as well as doing the maintenance, after that the refrigerant as the result of recovery will be tried on a refrigeration system and a test of refrigeration system work method will be conducted by using the refrigerant recycle product which is obtained and compared with the work method of the one with pure refrigeration.The result has been achieved that the redesign product of refrigerant waste processing equipment can be reused and able to perform the recovery
HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION
The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...
78 FR 52285 - Clearing Exemption for Certain Swaps Entered Into by Cooperatives
2013-08-22
... of America, and National Rural Utilities Cooperative Finance Corporation (CFC). Comments received on... comment letters supporting the rulemaking. The FCC, the National Rural Utilities Cooperative Finance... by the FHL Banks and ICBA. A fundamental characteristic of cooperatives is that they distribute or...
Carbon fiber composites application in ITER plasma facing components
Barabash, V.; Akiba, M.; Bonal, J. P.; Federici, G.; Matera, R.; Nakamura, K.; Pacher, H. D.; Rödig, M.; Vieider, G.; Wu, C. H.
1998-10-01
Carbon Fiber Composites (CFCs) are one of the candidate armour materials for the plasma facing components of the International Thermonuclear Experimental Reactor (ITER). For the present reference design, CFC has been selected as armour for the divertor target near the plasma strike point mainly because of unique resistance to high normal and off-normal heat loads. It does not melt under disruptions and might have higher erosion lifetime in comparison with other possible armour materials. Issues related to CFC application in ITER are described in this paper. They include erosion lifetime, tritium codeposition with eroded material and possible methods for the removal of the codeposited layers, neutron irradiation effect, development of joining technologies with heat sink materials, and thermomechanical performance. The status of the development of new advanced CFCs for ITER application is also described. Finally, the remaining R&D needs are critically discussed.
Carbon fiber composites application in ITER plasma facing components
International Nuclear Information System (INIS)
Barabash, V.; Federici, G.; Matera, R.; Akiba, M.; Nakamura, K.; Bonal, J.P.; Pacher, H.D.; Roedig, M.; Vieider, G.; Wu, C.H.
1998-01-01
Carbon fiber composites (CFCs) are one of the candidate armour materials for the plasma facing components of the international thermonuclear experimental reactor (ITER). For the present reference design, CFC has been selected as armour for the divertor target near the plasma strike point mainly because of unique resistance to high normal and off-normal heat loads. It does not melt under disruptions and might have higher erosion lifetime in comparison with other possible armour materials. Issues related to CFC application in ITER are described in this paper. They include erosion lifetime, tritium codeposition with eroded material and possible methods for the removal of the codeposited layers, neutron irradiation effect, development of joining technologies with heat sink materials, and thermomechanical performance. The status of the development of new advanced CFCs for ITER application is also described. Finally, the remaining R and D needs are critically discussed. (orig.)
Ih tunes theta/gamma oscillations and cross-frequency coupling in an in silico CA3 model.
Directory of Open Access Journals (Sweden)
Samuel A Neymotin
Full Text Available Ih channels are uniquely positioned to act as neuromodulatory control points for tuning hippocampal theta (4-12 Hz and gamma (25 Hz oscillations, oscillations which are thought to have importance for organization of information flow. contributes to neuronal membrane resonance and resting membrane potential, and is modulated by second messengers. We investigated oscillatory control using a multiscale computer model of hippocampal CA3, where each cell class (pyramidal, basket, and oriens-lacunosum moleculare cells, contained type-appropriate isoforms of . Our model demonstrated that modulation of pyramidal and basket allows tuning theta and gamma oscillation frequency and amplitude. Pyramidal also controlled cross-frequency coupling (CFC and allowed shifting gamma generation towards particular phases of the theta cycle, effected via 's ability to set pyramidal excitability. Our model predicts that in vivo neuromodulatory control of allows flexibly controlling CFC and the timing of gamma discharges at particular theta phases.
Between prohibition and proof of need
International Nuclear Information System (INIS)
Haltiner, E. W.
2003-01-01
This article discusses the consequences of new Swiss legislation on the use of chloro-fluoro-carbons (CFC) in refrigeration and air-conditioning units. In particular, the initial replacement of refrigerants that deplete the ozone layer with CFC products is discussed and the climate warming issues associated with global warming potential of these CFCs are examined. The measures set out in the new materials decree that bans substances with a long-term stability in certain appliances and that demands the adherence to the newest technical standards for operation and maintenance are described. The options of refraining from using cooling apparatus at all or the use of other possible solutions for meeting cooling needs using natural working fluids are discussed and the associated problems are discussed. The article is completed with a table giving figures on ecological impact of various substances and a summary of current regulations
Early work on the stratospheric ozone depletion-CFC issue
Molina, M.
2012-12-01
I became involved with the atmospheric chemistry of chlorofluorocarbons (CFCs) shortly after joining Sherry Rowland's research group at the University of California, Irvine, in 1973. CFCs had been detected in the troposphere by James Lovelock in 1971, and the question we set out to answer was the fate of these compounds of industrial origin in the environment, as well as possibly identifying any consequences of their accumulation in the atmosphere. After examining many potential sinks for these compounds we realized that because of their unusual stability the most likely destruction process was photolysis in the stratosphere. I carried out measurements of the absorption spectra of these compounds in the near ultraviolet; previous work involved only spectra in the far ultraviolet, not relevant for atmospheric chemistry. The results indicated that photolysis would take place in the upper stratosphere. I subsequently carried out calculations using one-dimensional atmospheric models to estimate their atmospheric residence times, which turned out to be many decades. We realized that the chlorine atoms generated by photolysis of the CFCs would participate in a catalytic chain reaction that would efficiently destroy ozone. Furthermore, we estimated that the amount of CFCs produced industrially was comparable to the amount of nitric oxide produced naturally in the stratosphere by the decomposition of nitrous oxide; work by Paul Crutzen and Harold Johnston had indicated that the abundance of ozone in the stratosphere was controlled by nitric oxide. We then formulated the hypothesis that the continued release of CFCs to the environment posed a threat to the stability of the ozone layer, and published our results in the journal Nature in 1974. The publication was noticed almost exclusively by the community of experts in stratospheric chemistry, and hence Sherry Rowland and I decided at that time that it was our responsibility to communicate this finding to society at large, and particularly to decision makers in government, while at the same time promoting additional scientific research to test the validity of our hypothesis.
Energy and global warming impacts of CFC alternative technologies
International Nuclear Information System (INIS)
Fischer, S.K.; Fairchild, P.D.; Hughes, P.J.
1992-01-01
Chlorofluorocarbons (CFCs) are used in a number of applications, and volumes of CFCs used grew at a tremendous pace during the 1960s and 1970s. However, in the mid-1980s, it was confirmed that these extremely useful chemicals contribute to the destruction of stratospheric ozone. These chemicals are being phased out of use rapidly to protect the ozone layer and it is very important that the replacements for CFSs do not result in a net increase in global warming by introducing less efficient processes that lead to higher energy use and increased carbon dioxide emissions. A study was conducted to identify those alternative chemicals and technologies that could replace CFCs in energy related applications before the year 2000, and to assess the total potential impact of these alternatives on global warming. The analysis for this project included an estimate of the direct effects from the release of blowing agents, refrigerants, and solvents into the atmosphere and the indirect effects in the form of carbon dioxide emissions resulting from energy use for commercial and residential heating and cooling, household and commercial refrigeration, building and automobile air-conditioning, and general metal and electronics solvent cleaning. The discussion in this paper focuses on those aspects of the study relevant to refrigeration and air-conditioning. In general the use of hydrofluorocarbon (HFC) and hydrochlorofluorocarbon (HCFC) alternatives for CFCs lead to large and sometimes dramatic reduction in total equivalent warming impact (TEWI), lifetime equivalent CO 2 emission. Most of the reductions result from decreased direct effects without significant changes in energy use. 3 refs., 3 figs., 1 tab
Thermo-mechanical tests of a CFC divertor mock-up
International Nuclear Information System (INIS)
Cardella, A.; Akiba, M.; Duwe, R.; Di Pietro, E.; Suzuki, S.; Satoh, K.; Reheis, N.
1994-01-01
Thermo-mechanical tests have been performed on a divertor mock-up consisting of a metallic tube armoured with five carbon fibre composite tiles. The tube is inserted the tiles and brazed with TiCuSil braze (monoblock concept). The tube material is TZM, a molybdenum alloy, and the armour material is SEP CARB N112, a high conductivity carbon-carbon composite. Using special surface preparation consisting of laser drilling, small (≅ 500 μm) holes in the composite have been made to increase the surface wetted by the braze and the resistance. The mock-up has been tested at the JAERI 400 kW electron beam test facility JEBIS. The aim of the test was to assess the performance of the mock-up in screening and thermal fatigue tests with particular attention to the behaviour of the armour to heat sink joint. (orig.)
Material Surface Damage under High Pulse Loads Typical for ELM Bursts and Disruptions in ITER
Energy Technology Data Exchange (ETDEWEB)
Landman, I.S.; Pestchanyi, S.E.; Bazylev, B.N [Forschungszentrum Karlsruhe (Germany). Inst. for Pulsed Power and Microwave Technology; Safronov, V.M. [Troitsk Inst. for Innovation and Fusion Research (TRINITI) (Russian Federation); Garkusha, I.E. [Kharkov Inst. of Physics and Technology (KIPT) (Ukraine). Inst. of Plasma Physics
2004-08-01
The divertor armour material for the tokamak ITER will probably be carbon manufactured as fibre composites (CFC) and tungsten as either brush-like structures or thin plates. Disruptive pulse loads where the heat deposition Q may reach 10{sup 2} MJ/m{sup 2} on a time scale {tau} of 3 ms, or operation in the ELMy H-mode at repetitive loads with Q {approx} 3MJ/m{sup 2} and {tau}{approx}0.3 ms; deteriorate armour performance. This work surveys recent numerical and experimental investigations of erosion mechanisms at these off-normal regimes carried out at FZK, TRINITI, and IPP-Kharkov. The modelling uses the anisotropic thermomechanics code PEGASUS-3D for the simulation of CFC brittle destruction, the surface melt motion code MEMOS-1.5D for tungsten targets, and the radiation-magnetohydrodynamics code FOREV-2D for calculating the plasma impact and simulating the heat loads for the ITER regime. Experiments aimed at validating these codes are being carried out at the plasma gun facilities MK-200UG, QSPA-T, and QSPA-Kh50 which produce powerful streams of hydrogen plasma with Q=10-30MJ/m{sup 2} and {tau} = 0.03-0.5 ms. Essential results are, for CFC targets, the experiments at high heat loads and the development of a local overheating model incorporated in PEGASUS-3D, and for the tungsten targets the analysis of evaporation- and melt motion erosion on the base of MEMOS-1.5D calculations for repetitive ELMs.
Energy Technology Data Exchange (ETDEWEB)
Kattan, N.; Favrat, D.; Thome, J. R.; Nidegger, E.; Zuercher, O. [Ecole Polytechnique Federale, Lab. d` Energetique Industrielle (LENI), Lausanne (Switzerland)
1995-07-15
The substitution of old refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, request a good knowledge of heat transfer properties of substitute fluids. The test measurements in LENI test facility (concentric tubes with water flowing in a counter-current flow) with new refrigerants like HFC134a, HCFC123, R-402A, have established a new data bank with new refrigerants, a comparison with old refrigerants like CFC11, CFC12 CFC/HCFC502 and with existent correlations. Correlations were programmed to calculate and compare heat transfer coefficient during the tests. To develop a new correlation based on flow regimes, a high speed Sony video tape camera is used to observe and identify flow patterns. Important images are captured, digitalized, stored for later analysis and sent to a color plotter. Several flow pattern maps were programmed and compared to flow regimes observed on the test rig. Local flow boiling heat transfer coefficients were measured for HFC134a and HCFC123 evaporating inside a microfin tube. In addition, microheat transfer augmentation relative to plain tube test data was investigated. The presence of oil in the evaporator has an effect on heat transfer coefficient. Local flow boiling heat transfer coefficients were measured for refrigerant HFC134a-oil ester (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of refrigerants and lubricating oils is developed. A very high accuracy, straight vibrating tube type of density flowmeter is used to measure oil concentrations of flowing HFC134a-oil mixtures. (author) figs., tabs., refs.
Prieto, Claudia I; Palau, María J; Martina, Pablo; Achiary, Carlos; Achiary, Andrés; Bettiol, Marisa; Montanaro, Patricia; Cazzola, María L; Leguizamón, Mariana; Massillo, Cintia; Figoli, Cecilia; Valeiras, Brenda; Perez, Silvia; Rentería, Fernando; Diez, Graciela; Yantorno, Osvaldo M; Bosch, Alejandra
2016-01-01
The epidemiological and clinical management of cystic fibrosis (CF) patients suffering from acute pulmonary exacerbations or chronic lung infections demands continuous updating of medical and microbiological processes associated with the constant evolution of pathogens during host colonization. In order to monitor the dynamics of these processes, it is essential to have expert systems capable of storing and subsequently extracting the information generated from different studies of the patients and microorganisms isolated from them. In this work we have designed and developed an on-line database based on an information system that allows to store, manage and visualize data from clinical studies and microbiological analysis of bacteria obtained from the respiratory tract of patients suffering from cystic fibrosis. The information system, named Cystic Fibrosis Cloud database is available on the http://servoy.infocomsa.com/cfc_database site and is composed of a main database and a web-based interface, which uses Servoy's product architecture based on Java technology. Although the CFC database system can be implemented as a local program for private use in CF centers, it can also be used, updated and shared by different users who can access the stored information in a systematic, practical and safe manner. The implementation of the CFC database could have a significant impact on the monitoring of respiratory infections, the prevention of exacerbations, the detection of emerging organisms, and the adequacy of control strategies for lung infections in CF patients. Copyright © 2015 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Material Surface Damage under High Pulse Loads Typical for ELM Bursts and Disruptions in ITER
Landman, I. S.; Pestchanyi, S. E.; Safronov, V. M.; Bazylev, B. N.; Garkusha, I. E.
The divertor armour material for the tokamak ITER will probably be carbon manufactured as fibre composites (CFC) and tungsten as either brush-like structures or thin plates. Disruptive pulse loads where the heat deposition Q may reach 102 MJ/m 2 on a time scale Ïä of 3 ms, or operation in the ELMy H-mode at repetitive loads with Q âe 1/4 3 MJ/m2 and Ïä âe 1/4 0.3 ms, deteriorate armour performance. This work surveys recent numerical and experimental investigations of erosion mechanisms at these off-normal regimes carried out at FZK, TRINITI, and IPP-Kharkov. The modelling uses the anisotropic thermomechanics code PEGASUS-3D for the simulation of CFC brittle destruction, the surface melt motion code MEMOS-1.5D for tungsten targets, and the radiation-magnetohydrodynamics code FOREV-2D for calculating the plasma impact and simulating the heat loads for the ITER regime. Experiments aimed at validating these codes are being carried out at the plasma gun facilities MK-200UG, QSPA-T, and QSPA-Kh50 which produce powerful streams of hydrogen plasma with Q = 10–30 MJ/m2 and Ïä = 0.03–0.5 ms. Essential results are, for CFC targets, the experiments at high heat loads and the development of a local overheating model incorporated in PEGASUS-3D, and for the tungsten targets the analysis of evaporation- and melt motion erosion on the base of MEMOS-1.5D calculations for repetitive ELMs.
Müller, Viktor; Perdikis, Dionysios; von Oertzen, Timo; Sleimen-Malkoun, Rita; Jirsa, Viktor; Lindenberger, Ulman
2016-01-01
Resting-state and task-related recordings are characterized by oscillatory brain activity and widely distributed networks of synchronized oscillatory circuits. Electroencephalographic recordings (EEG) were used to assess network structure and network dynamics during resting state with eyes open and closed, and auditory oddball performance through phase synchronization between EEG channels. For this assessment, we constructed a hyper-frequency network (HFN) based on within- and cross-frequency coupling (WFC and CFC, respectively) at 10 oscillation frequencies ranging between 2 and 20 Hz. We found that CFC generally differentiates between task conditions better than WFC. CFC was the highest during resting state with eyes open. Using a graph-theoretical approach (GTA), we found that HFNs possess small-world network (SWN) topology with a slight tendency to random network characteristics. Moreover, analysis of the temporal fluctuations of HFNs revealed specific network topology dynamics (NTD), i.e., temporal changes of different graph-theoretical measures such as strength, clustering coefficient, characteristic path length (CPL), local, and global efficiency determined for HFNs at different time windows. The different topology metrics showed significant differences between conditions in the mean and standard deviation of these metrics both across time and nodes. In addition, using an artificial neural network approach, we found stimulus-related dynamics that varied across the different network topology metrics. We conclude that functional connectivity dynamics (FCD), or NTD, which was found using the HFN approach during rest and stimulus processing, reflects temporal and topological changes in the functional organization and reorganization of neuronal cell assemblies.
Hvattum, E; Normann, P T; Oulie, I; Uran, S; Ringstad, O; Skotland, T
2001-01-01
A new contrast agent (Sonazoid; NC100100) for ultrasound imaging has been developed. It is an aqueous suspension of lipid stabilised perfluorobutane (PFB) gas microbubbles. An automatic headspace capillary gas-chromatographic mass spectrometric method using electron impact ionisation was developed for analysis of Sonazoid PFB in rat blood. The calibration standards were gaseous PFB dissolved in ethanol in the range of 0.5-5000 ng PFB. Fluorotrichloromethane (CFC 11) was used as an internal standard of the method and the MS detector was set to single ion monitoring of the base fragment ions of PFB (m/z 69 and 119) and CFC 11 (m/z 101). The calibration graph, made by plotting the peak area ratios of PFB (m/z 69) to CFC 11(m/z 101) against the amount of PFB, was fitted to a second-order polynomial equation with weighting 1/y2 and found to be reproducible. The limit of quantification of the method was set to 0.4 ng PFB. The between-day variation of the method was below 9.2% relative standard deviation (RSD) and the within-day variation of the method was below 7.6% RSD. The accuracy of the method, as compared to Coulter counter, was estimated by determination of PFB in samples where Sonazoid was added to saline and found to range from 91.5% to 105.2%. PFB, added as Sonazoid, was found to be stable for at least 7 months in rat blood samples when stored at -20 degrees C.
Hurst, D. F.; Lin, J. C.; Romashkin, P. A.; Daube, B. C.; Gerbig, C.; Matross, D. M.; Wofsy, S. C.; Hall, B. D.; Elkins, J. W.
2006-08-01
Contemporary emissions of six restricted, ozone-depleting halocarbons, chlorofluorocarbon-11 (CFC-11, CCl3F), CFC-12 (CCl2F2), CFC-113 (CCl2FCClF2), methyl chloroform (CH3CCl3), carbon tetrachloride (CCl4), and Halon-1211 (CBrClF2), and two nonregulated trace gases, chloroform (CHCl3) and sulfur hexafluoride (SF6), are estimated for the United States and Canada. The estimates derive from 900 to 2900 in situ measurements of each of these gases within and above the planetary boundary layer over the United States and Canada as part of the 2003 CO2 Budget and Regional Airborne-North America (COBRA-NA) study. Air masses polluted by anthropogenic sources, identified by concurrently elevated levels of carbon monoxide (CO), SF6, and CHCl3, were sampled over a wide geographical range of these two countries. For each polluted air mass, we calculated emission ratios of halocarbons to CO and employed the Stochastic Time-Inverted Lagrangian Transport (STILT) model to determine the footprint associated with the air mass. Gridded CO emission estimates were then mapped onto the footprints and combined with measured emission ratios to generate footprint-weighted halocarbon flux estimates. We present statistically significant linear relationships between halocarbon fluxes (excluding CCl4) and footprint-weighted population densities, with slopes representative of per capita emission rates. These rates indicate that contemporary emissions of five restricted halocarbons (excluding CCl4) in the United States and Canada continue to account for significant fractions (7-40%) of global emissions.
International Nuclear Information System (INIS)
Laner, David; Rechberger, Helmut
2007-01-01
The treatment of cooling appliances in Austria is primarily influenced by two factors. On the one hand is their changing composition and on the other hand the ordinance on Waste Prevention, Collection and Treatment of Waste Electrical and Electronic Equipment (WEEE ordinance), which stipulates a minimum recycling rate of 75% for cooling appliances. This paper investigates whether this recycling rate leads to optimal treatment practices for cooling appliances with respect to resource conservation and environmental protection. Two different treatment technologies which achieve recycling rates between 50-60% and 80-90%, respectively, are compared both for cooling appliances containing Chlorofluorocarbons (CFCs) and for appliances containing Volatile Organic Compounds (VOC). Materials and energy balances are developed for each model. To evaluate resource consumption, expenditures as well as savings of energy and materials are incorporated via the Cumulative Energy Demand (CED). In order to analyse the environmental impact of the different practices, balances for CFC, CO 2 , HF, HCl and solid residues are established. The results show that the treatment type aiming for a maximum of materials recycling contributes more to resource conservation than the other treatment type. But for CFC appliances the former is associated with substantial CFC emissions, which turn out to be most relevant when treating these appliances. Generally, it is found that the optimum recycling rate is a function of the composition of the appliance and the technologies applied, both in recycling and in primary production. A high recycling rate per se does not automatically result in an optimal solution with regard to resource conservation and environmental protection. (author)
40 CFR Appendix B to Subpart B of... - Standard for Recover Equipment
2010-07-01
... protects the earth against harmful ultraviolet radiation. To reduce the emissions of CFCs, the 1990 Clean Air Act requires recycle of CFC-12 (R-12) used in mobile air-conditioning systems to eliminate system... reuse of CFCs in mobile air-conditioning systems. Establishing extraction equipment specifications for...
Huhn, Oliver; Rhein, Monika; Hoppema, Mario; van Heuven, Steven
We use a 27 year long time series of repeated transient tracer observations to investigate the evolution of the ventilation time scales and the related content of anthropogenic carbon (C-ant) in deep and bottom water in the Weddell Sea. This time series consists of chlorofluorocarbon (CFC)
2010-01-01
..., the United States Virgin Islands, the Commonwealth of Northern Mariana Islands, American Samoa, and... postal service. Federation or Federated Group means a group of voluntary charitable human health and... the group of Federal officials designated by the Director to conduct the CFC in a particular community...
Sources, sinks, trends, and opportunities
International Nuclear Information System (INIS)
Ciborowski, P.
1989-01-01
Each year the emission of greenhouse gases commits the earth to a warming of 0.02 to 0.06 degrees C. Many of these gases are released as by-products of fossil fuel combustion. The remainder are produced as a result of forest clearing in the tropics or agriculture or industrial activities. Carbon dioxide (CO 2 ) is the most important greenhouse gas, contributing about half of global heating. In addition, there are what are known as the non-CO 2 greenhouse gases: methane (CH 4 ), nitrous oxide (N 2 O), freon CFC-12 (CF 2 Cl 2 ), freon CFC-11 (CF 3 Cl), and tropospheric ozone (O 3 ). Carbon monoxide and the nitrogen gases, increase the amount of methane and ozone in the troposphere. There are also about 15 or 20 other greenhouse gases of lesser importance. This paper reviews the sources of some of these greenhouse gases, analyzes trends in their emissions, and suggests means through which greenhouse gas emissions can be limited
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
Aspen Systems and a team of nineteen agencies and industry participants conducted a series of tests to determine the performance of HFC-134a, HCFC-22, and CFC-502 for supermarket application. This effort constitutes the first phase of a larger project aimed at carrying out both laboratory and demonstration tests of the most viable HFC refrigerants and the refrigerants they replace. The results of the Phase I effort are presented in the present report. The second phase of the project has also been completed. It centered on testing all viable HFC replacement refrigerants for CFC-502. These were HFC-507, HFC-404A, and HFC-407A. The latter results are published in the Phase II report for this project. As part of Phase I, a refrigeration rack utilizing a horizontal open drive screw compressor was constructed in our laboratory. This refrigeration rack is a duplicate of one we have installed in a supermarket in Clifton Park, NY.
CERN apprenticeship scheme honoured
2008-01-01
Prestigious awards for two apprentices who did their practical training at CERN. Sylvain Heinzen, apprentice physics lab technician at CERN, receiving his award from Pierre-François UNGER, State Councillor responsible for the Federal Department of the Economy and Health. The other award-winner, Cédric Gerber, is on the right of the photo.Among Geneva’s top apprentices who were honoured by the Fondation sociale de l’Union industrielle genevoise (UIG) on 28 October this year, were two CERN apprentices. Electronics technician Cédric Gerber and physics lab technician Sylvain Heinzen both did their four-year sandwich course at CERN, obtaining their professional qualification, the Certificat fédéral de capacité (CFC), in June. On top of that, Cédric Gerber, who had been a particularly outstanding apprentice, received two further distinctions at the CFC awards ceremony - the State Council prize for achieving one of the top-ten o...
FOXI2: a possible gene contributing to ectodermal dysplasia.
Kurban, Mazen; Zeineddine, Savo Bou; Hamie, Lamiaa; Safi, Remi; Abbas, Ossama; Kibbi, Abdul Ghani; Bitar, Fadi; Nemer, Georges
2017-12-01
Cardio-facio-cutaneous syndrome (CFC), Noonan syndrome (NS), and Costello syndrome are a group of diseases that belong to the RASopathies. The syndromes share clinical features making diagnosis a challenge. To investigate the phenotype and genotype of a 10-year-old Iraqi girl with overlapping features of CFC, NS, and Costello syndromes, with additional features of ectodermal dysplasia. DNA was examined by exome sequencing and protein expression by immunohistochemistry. Exome sequencing identified a mutation in the SOS1 gene and a de novo deletion in the FOXI2 gene which was neither present in the international databases, nor in 400 chromosomes from the same population. Based on immunohistochemical staining, FOXI2 was identified in the basal cell layer of the skin and overlapped with the expression of P63, a major player in ectodermal dysplasia. We therefore suggest screening for FOXI2 mutation in the setting of ectodermal features that are not associated with genes known to contribute to ectodermal dysplasia.
Macroscopic erosion of divertor and first wall armour in future tokamaks
Würz, H.; Bazylev, B.; Landman, I.; Pestchanyi, S.; Safronov, V.
2002-12-01
Sputtering, evaporation and macroscopic erosion determine the lifetime of the 'in vessel' armour materials CFC, tungsten and beryllium presently under discussion for future tokamaks. For CFC armour macroscopic erosion means brittle destruction and dust formation whereas for metallic armour melt layer erosion by melt motion and droplet splashing. Available results on macroscopic erosion from hot plasma and e-beam simulation experiments and from tokamaks are critically evaluated and a comprehensive discussion of experimental and numerical macroscopic erosion and its extrapolation to future tokamaks is given. Shielding of divertor armour materials by their own vapor exists during plasma disruptions. The evolving plasma shield protects the armour from high heat loads, absorbs the incoming energy and reradiates it volumetrically thus reducing drastically the deposited energy. As a result, vertical target erosion by vaporization turns out to be of the order of a few microns per disruption event and macroscopic erosion becomes the dominant erosion source.
The heat removal capability of actively cooled plasma-facing components for the ITER divertor
Missirlian, M.; Richou, M.; Riccardi, B.; Gavila, P.; Loarer, T.; Constans, S.
2011-12-01
Non-destructive examination followed by high-heat-flux testing was performed for different small- and medium-scale mock-ups; this included the most recent developments related to actively cooled tungsten (W) or carbon fibre composite (CFC) armoured plasma-facing components. In particular, the heat-removal capability of these mock-ups manufactured by European companies with all the main features of the ITER divertor design was investigated both after manufacturing and after thermal cycling up to 20 MW m-2. Compliance with ITER requirements was explored in terms of bonding quality, heat flux performances and operational compatibility. The main results show an overall good heat-removal capability after the manufacturing process independent of the armour-to-heat sink bonding technology and promising behaviour with respect to thermal fatigue lifetime under heat flux up to 20 MW m-2 for the CFC-armoured tiles and 15 MW m-2 for the W-armoured tiles, respectively.
Laser lock-in thermography for thermal contact characterisation of surface layer
International Nuclear Information System (INIS)
Semerok, A.; Jaubert, F.; Fomichev, S.V.; Thro, P.-Y.; Courtois, X.; Grisolia, C.
2012-01-01
Lock-in thermography was applied to determine the thermal contact conductance of a W-layer (140 μm) on a CFC-substrate. A lock-in thermography system together with a pulse repetition rate Nd:YAG laser (1064 nm, 1–500 Hz pulse repetition rate) for layer heating was applied for phase shift measurements on the W-layer. A numerical model for direct phase shift calculations was developed and applied to rapid determination of the Fourier amplitudes and phases of the temperature. Thermal conductance coefficients were obtained by comparing the experimental and simulation phase shifts. -- Highlights: ► Lock-in thermography determines a layer/substrate thermal conductance. ► Thermal conductance coefficient of W-layer on a CFC-substrate. ► Model for direct phase shift calculations was developed and applied. ► Rapid determination of the Fourier amplitudes and phases of the temperature. ► Comparing the experimental and simulation phase shifts.
Anti-Avoidance Rules di Indonesia Pasca Amandemen UU Pajak Penghasilan
Directory of Open Access Journals (Sweden)
Adrianto Dwi Nugroho
2012-02-01
Full Text Available The fourth amendment to the Indonesian Income Tax Act (UU PPh has inserted three new provisions encountering three newly-identified tax avoidance schemes. However, the previous regulations in respect of thin capitalization, CFC and interest stripping were not carefully be given attention and be made in conformity with their newest developments. As an illustration, the term “company” has never been defined in the Act. Instead, the Act introduces the same term in the conduit company rules. Another example involves the CFC rule which does not put additional provisions to define “control”. Another interesting development is the regulation of the International-hiring out of labor which instead of making it in conformity with the OECD MC, the rule empowers the country to increase the taxable income of an employee in respect of employment excercised abroad. This article attempts to demonstrate how the Indonesian anti-avoidance rules work out and prove how taxpayers may well, ironically, abuse those rules.
International Nuclear Information System (INIS)
Fuse, Toshiaki; Tachikawa, Nobuo.
1996-01-01
A cooling tube made of a pure copper is connected to the inner portion of an armour (heat resistant member) made of an anisotropic carbon/carbon composite (CFC) material. The CFC material has a high heat conductivity in longitudinal direction of fibers and has low conductivity in perpendicular thereto. Fibers extending in the armour from a heat receiving surface just above the cooling tube are directly connected to the cooling tube. A portion of the fibers extending from a heat receiving surface other than portions not just above the cooling tube is directly bonded to the cooling tube. Remaining fibers are disposed so as to surround the cooling tube. The armour and the cooling tube are soldered using an active metal flux. With such procedures, high thermal load components for use in a thermonuclear reactor are formed, which are excellent in a heat removing characteristic and hardly causes defects such as crackings and peeling. (I.N.)
Macroscopic erosion of divertor and first wall armour in future tokamaks
International Nuclear Information System (INIS)
Wuerz, H.; Bazylev, B.; Landman, I.; Pestchanyi, S.; Safronov, V.
2002-01-01
Sputtering, evaporation and macroscopic erosion determine the lifetime of the 'in vessel' armour materials CFC, tungsten and beryllium presently under discussion for future tokamaks. For CFC armour macroscopic erosion means brittle destruction and dust formation whereas for metallic armour melt layer erosion by melt motion and droplet splashing. Available results on macroscopic erosion from hot plasma and e-beam simulation experiments and from tokamaks are critically evaluated and a comprehensive discussion of experimental and numerical macroscopic erosion and its extrapolation to future tokamaks is given. Shielding of divertor armour materials by their own vapor exists during plasma disruptions. The evolving plasma shield protects the armour from high heat loads, absorbs the incoming energy and reradiates it volumetrically thus reducing drastically the deposited energy. As a result, vertical target erosion by vaporization turns out to be of the order of a few microns per disruption event and macroscopic erosion becomes the dominant erosion source
The heat removal capability of actively cooled plasma-facing components for the ITER divertor
International Nuclear Information System (INIS)
Missirlian, M; Richou, M; Loarer, T; Riccardi, B; Gavila, P; Constans, S
2011-01-01
Non-destructive examination followed by high-heat-flux testing was performed for different small- and medium-scale mock-ups; this included the most recent developments related to actively cooled tungsten (W) or carbon fibre composite (CFC) armoured plasma-facing components. In particular, the heat-removal capability of these mock-ups manufactured by European companies with all the main features of the ITER divertor design was investigated both after manufacturing and after thermal cycling up to 20 MW m - 2. Compliance with ITER requirements was explored in terms of bonding quality, heat flux performances and operational compatibility. The main results show an overall good heat-removal capability after the manufacturing process independent of the armour-to-heat sink bonding technology and promising behaviour with respect to thermal fatigue lifetime under heat flux up to 20 MW m - 2 for the CFC-armoured tiles and 15 MW m - 2 for the W-armoured tiles, respectively.
Hamme, Roberta C.; Emerson, Steven R.; Severinghaus, Jeffrey P.; Long, Matthew C.; Yashayaev, Igor
2017-10-01
Dissolved gas distributions are important because they influence oceanic habitats and Earth's climate, yet competing controls by biology and physics make gas distributions challenging to predict. Bubble-mediated gas exchange, temperature change, and varying atmospheric pressure all push gases away from equilibrium. Here we use new noble gas measurements from the Labrador Sea to demonstrate a technique to quantify physical processes. Our analysis shows that water-mass formation can be represented by a quasi steady state in which bubble fluxes and cooling push gases away from equilibrium balanced by diffusive gas exchange forcing gases toward equilibrium. We quantify the rates of these physical processes from our measurements, allowing direct comparison to gas exchange parameterizations, and predict the physically driven saturation of other gases. This technique produces predictions that reasonably match N2/Ar observations and demonstrates that physical processes should force SF6 to be ˜6% more supersaturated than CFC-11 and CFC-12, impacting ventilation age calculations.
Directory of Open Access Journals (Sweden)
Irfan Gustian
2013-10-01
Full Text Available Normal 0 false false false EN-US X-NONE X-NONE Study on comparison the physicochemical properties of bunch press fibre cellulose (Bpfc and cyclone fibre cellulose (Cfc wastes from industry Crude Palm oil (CPO have been performed. The physicochemical properties both of celluloses have been done such as the average degree of polymerization (DP, solubility properties, functional group analysis, thermal properties and X-ray diffraction patterns. The average degrees of polymerization (DP have been obtained 2195 and 567 for Bpfc and Cfc. Bunch press fibre cellulose and cyclone fibre cellulose were soluble in cupriethylenediamine (CED. FT-IR analysis showed the same pattern of spectrum but different intensities. Thermal stability of bunch press fibre cellulose and cyclone fibre cellulose remains stable up to a temperature of 250 °C. Glass transition bunch press fibre cellulose greater than the glass transition cyclone fibre cellulose and X-ray diffraction pattern shows the same pattern and intensity varies.
2011-03-29
1,1- Difluoroethane (HFC-152a) Dibromodifluoromethane (Halon 1202) 1,2-Dichloro-1,1,2,2-tetrafluoroethane (CFC-114) Dib th 1 2 Di hl th (F 150)romome... difluoroethane (HCFC-142b) Dichloromethane (DCM) 2-Chloro-1,1,1,2-tetrafluoroethane (HFC-124) Difluoromethane (HFC32) Dibromotetrafluoroethane (Halon
5 CFR 950.401 - Campaign and publicity information.
2010-01-01
... permit the distribution by organizations of promotional information to Federal personnel in public areas... contributors. All CFC Charity Lists must inform employees of their right to make a choice to contribute or not... List: (1) OPM will include in the annual distribution of the National/International and International...
75 FR 42571 - Guarantees for Bonds and Notes Issued for Electrification or Telephone Purposes
2010-07-22
... strength and its pledged loan collateral. Accordingly, CFC contends that financial risk to RUS is already... concurrent loans as provided in part 1710 of this chapter. (b) * * * (2) Maintain sufficient collateral equal... program for cooperative and other not-for-profit lenders that make loans for eligible electric and...
Shang, Yuhong; Yang, Congjun; Liu, Zhihang; Song, Jiqing; Li, Pingliang; Li, Lingxu; Zhou, Fei; Xin, Hua; Wan, Fanghao; Matsumoto, Hiroshi; Luo, Xiaoyong
2017-10-01
Acanthospermum hispidum DC, an Asteraceae weed species, was very susceptible to fluazifop-P-butyl, but tolerant to other aryloxyphenoxypropionate herbicides, such as haloxyfop-P-methyl. However, other Asteraceae weeds including Bidens pilosa were all tolerant to fluazifop-P-butyl. Membrane lipid peroxidation by increasing the levels of reactive oxygen species (ROS) was proposed as an action mechanism of fluazifop-P-butyl in A. hispidum. To further clarify the primordial action site of fluazifop-P-butyl in this species, the effects on chlorophyll fluorescence characteristics and cytohistology of apical meristems were studied. Chlorophyll fluorescence characteristics (CFC) in sensitive A. hispidum seedlings were markedly affected by 10μM fluazifop-P-butyl, with the dark fluorescence yield (Fo), maximal fluorescence yield (Fm), maximal PS II quantum yield (Fv/Fm), effective photosystem II (PS II) quantum yield [Y(II)], and quantum yield of regulated energy dissipation [Y(NPQ)] declining, quantum yield of nonregulated energy dissipation [Y(NO)] rising, but these measures were not affected in Bidens pilosa. The effects of fluazifop-P-butyl on chlorophyll fluorescence properties were observed on the growing point before the mature leaves by about 4-6h. Haloxyfop-P-methyl, a control herbicide, had no effects on CFC of either A. hispidum or B. pilosa. In addition, damage to apical meristem cells of A. hispidum was observed at 6 HAT prior to changes in chlorophyll fluorescence parameters suggesting that the primary action site of fluazifop-P-butyl in this species is in the apical meristem and the effects on CFC may be the results of secondary action. Copyright © 2017 Elsevier Inc. All rights reserved.
Integration of environmentally compatible soldering technologies for waste minimization
International Nuclear Information System (INIS)
Hosking, F.M.
1992-01-01
There has been a concentrated effort throughout the international microelectronics industry to phase out chlorofluorocarbon (CFC) materials and alleviate the serious problem of ozone depletion created by the release of CFCS. The development of more environmentally compatible manufacturing technologies is the cornerstone of this effort. Alternative materials and processes for cleaning and soldering have received special attention. Electronic. soldering typically utilizes rosin-based fluxes to promote solder wettability. Flux residues must be removed from the soldered parts when high product reliability is essential. Halogenated or CFC solvents have been the principle chemicals used to clean the residues. With the accelerated push to eliminate CFCs in the US by 1995, CFC-free solvents, aqueous-based cleaning, water soluble or ''no clean'' fluxes, and fluxless soldering technologies are being developed and quickly integrated into manufacturing practice. Sandia's Center for Solder Science and Technology has been ch g a variety of fluxless and alternative soldering technologies for DOE's waste minimization program. The work has focused on controlled atmosphere, laser, and ultrasonic fluxless soldering, protective metallic and organic coatings, and fluxes which have water soluble or low solids-based chemistries. With the increasing concern that Pb will also be banned from electronic soldering, Sandia has been characterizing the wetting, aging, and mechanical properties of Pb-fire solder alloys. The progress of these integrated studies will be discussed. Their impact on environmentally compatible manufacturing will be emphasized. Since there is no universal solution to the various environmental, safety, and health issues which currently face industry, the proposed technologies offer several complementary materials and processing options from which one can choose
Energy Technology Data Exchange (ETDEWEB)
Kattan, N.; Favrat, D.; Thome, J. R.; Nidegger, E.; Zuercher, O. [Ecole Polytechnique Federale, Lab. d` Energetique Industrielle (LENI), Lausanne (Switzerland)
1995-07-15
The substitution of old refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, request a good knowledge of heat transfer properties of substitute fluids. The test measurements in LENI test facility (concentric tubes with water flowing in a counter-current flow) with new refrigerants like HFC134a, HCFC123, R-404A, R-402A, have established a new data bank with new refrigerants, a comparison with old refrigerants like CFC11, CFC12 CFC/HCFC502 and with existent correlations. Correlations were programmed to calculate and compare heat transfer coefficient during the tests. To develop a new correlation based on flow regimes, a high speed Sony video tape camera is used to observe and identify flow patterns. Important images are captured, digitalized, stored for later analysis and sent to a color plotter. Several flow pattern maps were programmed and compared to flow regimes observed on the test rig. Local flow boiling heat transfer coefficients were measured for HFC134a and HCFC123 evaporating inside a microfin tube. In addition, microfin heat transfer augmentation relative to plain tube test data was investigated. The presence of oil in the evaporator has an effect on heat transfer coefficient. Local flow boiling heat transfer coefficients were measured for refrigerant HFC134a-oil ester (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of refrigerants and lubricating oils is developed. A very high accuracy, straight vibrating tube type of density flowmeter is used to measure oil concentrations of flowing HFC134a-oil mixtures. (author) 28 figs., 25 refs.
Recent and ancient recharge deciphered by multi-dating tracer technique
Dogramaci, Shawan; Cook, Peter; Mccallum, Jimes; Purtchert, Roland
2017-04-01
Determining groundwater residence time from environmental tracer concentrations obtained from open bores or long screened intervals is fraught with difficulty because the sampled water represents variety of ages. Information on the distribution of groundwater age is commonly obtained by measuring more than one tracer. We examined the use of the multi-tracer technique representing different time frames (39Ar, 85Kr, 14C, 3H, CFC 11- CFC-12 CFC-113, SF6 and Cl,) to decipher the groundwater ages sampled from long screened bores in a regional aquifer in the Pilbara region of northwest Australia. We then applied a technique that assumes limited details of the form of the age distribution. Tracer concentrations suggest that groundwater samples are a mixture of young and old water - the former is inferred to represent localised recharge from an adjacent creek, and the latter to be diffuse recharge. Using our method, we were able to identify distinct age components in the groundwater. The results suggest the presence of four distinct age groups; zero and 20 years, 50 to 100 years, 100 to 600 years and approximately 1000 years old. These relatively high recharge events were consistent with local recharge sources (50-100 years) and confirmed by palaeo-climate record obtained from lake sediments. We found that although the ages of these components were well constrained, the relative proportions of each component was highly sensitive to errors of environmental tracer data. Our results show that the method we implemented can identify distinct age groups in groundwater samples without prior knowledge of the age distribution. The presence of distinct recharge times gives insight into groundwater flow conditions over long periods of time.
Directory of Open Access Journals (Sweden)
Lyerly Herbert K
2008-03-01
Full Text Available Abstract Background Single-cell assays of immune function are increasingly used to monitor T cell responses in immunotherapy clinical trials. Standardization and validation of such assays are therefore important to interpretation of the clinical trial data. Here we assess the levels of intra-assay, inter-assay, and inter-operator precision, as well as linearity, of CD8+ T cell IFNγ-based ELISPOT and cytokine flow cytometry (CFC, as well as tetramer assays. Results Precision was measured in cryopreserved PBMC with a low, medium, or high response level to a CMV pp65 peptide or peptide mixture. Intra-assay precision was assessed using 6 replicates per assay; inter-assay precision was assessed by performing 8 assays on different days; and inter-operator precision was assessed using 3 different operators working on the same day. Percent CV values ranged from 4% to 133% depending upon the assay and response level. Linearity was measured by diluting PBMC from a high responder into PBMC from a non-responder, and yielded R2 values from 0.85 to 0.99 depending upon the assay and antigen. Conclusion These data provide target values for precision and linearity of single-cell assays for those wishing to validate these assays in their own laboratories. They also allow for comparison of the precision and linearity of ELISPOT, CFC, and tetramer across a range of response levels. There was a trend toward tetramer assays showing the highest precision, followed closely by CFC, and then ELISPOT; while all three assays had similar linearity. These findings are contingent upon the use of optimized protocols for each assay.
Directory of Open Access Journals (Sweden)
A. Roiger
2008-08-01
Full Text Available We report on the retrieval of PAN (CH3C(OOONO2 in the upper tropical troposphere from limb measurements by the remote-sensor MIPAS-STR on board the Russian high altitude research aircraft M55-Geophysica. The measurements were performed close to Araçatuba, Brazil, on 17 February 2005. The retrieval was made in the spectral range 775–820 cm−1 where PAN exhibits its strongest feature but also more than 10 species interfere. Especially trace gases such as CH3CCl3, CFC-113, CFC-11, and CFC-22, emitting also in spectrally broad not-resolved branches, make the processing of PAN prone to errors. Therefore, the selection of appropriate spectral windows, the separate retrieval of several interfering species and the careful handling of the water vapour profile are part of the study presented. The retrieved profile of PAN has a maximum of about 0.14 ppbv at 10 km altitude, slightly larger than the lowest reported values (<0.1 ppbv and much lower than the highest reported in the literature (0.65 ppbv. Besides the NOy constituents measured by MIPAS-STR (HNO3, ClONO2, HO2NO2, PAN, the in situ instruments aboard the Geophysica provide simultaneous measurements of NO, NO2, and the sum NOy. Comparing the sum of in-situ and remotely derived NO+NO2+HNO3+ClONO2+HO2NO2+PAN with total NOy a deficit of 30–40% (0.2–0.3 ppbv in the troposphere remains unexplained whereas the values fit well in the stratosphere.
Stratospheric cooling and polar ozone loss due to H2 emissions of a global hydrogen economy
Feck, T.; Grooß, J.-U.; Riese, M.; Vogel, B.
2009-04-01
"Green" hydrogen is seen as a major element of the future energy supply to reduce greenhouse gas emissions substantially. However, due to the possible interactions of hydrogen (H2) with other atmospheric constituents there is a need to analyse the implications of additional atmospheric H2 that could result from hydrogen leakage of a global hydrogen infrastructure. Emissions of molecular H2 can occur along the whole hydrogen process chain which increase the tropospheric H2 burden. Across the tropical tropopause H2 reaches the stratosphere where it is oxidised and forms water vapour (H2O). This causes increased IR-emissions into space and hence a cooling of the stratosphere. Both effects, the increase of stratospheric H2O and the cooling, enhances the potential of chlorine activation on liquid sulfate aerosol and polar stratospheric clouds (PSCs), which increase polar ozone destruction. Hence a global hydrogen economy could provoke polar ozone loss and could lead to a substantial delay of the current projected recovery of the stratospheric ozone layer. Our investigations show that even if 90% of the current global fossil primary energy input could be replaced by hydrogen and approximately 9.5% of the product gas would leak to the atmosphere, the ozone loss would be increased between 15 to 26 Dobson Units (DU) if the stratospheric CFC loading would retain unchanged. A consistency check of the used approximation methods with the Chemical Lagrangian Model of the Stratosphere (CLaMS) shows that this additional ozone loss can probably be treated as an upper limit. Towards more realistic future H2 leakage rate assumptions (< 3%) the additional ozone loss would be rather small (? 10 DU). However, in all cases the full damage would only occur if stratospheric CFC-levels would retain unchanged. Due to the CFC-prohibition as a result of the Montreal Protocol the forecasts suggest a decline of the stratospheric CFC loading about 50% until 2050. In this case our calculations
International Nuclear Information System (INIS)
Greuner, H.; Boeswirth, B.; Boscary, J.; Plankensteiner, A.; Schedler, B.
2006-01-01
The HHF testing of WENDELSTEIN 7-X pre-series target elements is an indispensable step in the qualification of the manufacturing process. The finally 890 divertor target elements are made of an actively water-cooled CuCrZr heat sink covered with flat tiles of CFC NB31 as plasma facing material. A set of 20 full scale pre-series elements was manufactured by PLANSEE to validate the materials and manufacturing technologies prior to the start of the series production. Due to the large mismatch in the coefficients of thermal expansion for CFC and CuCrZr - resulting in high residual stresses as well as high operation-induced stresses - the bonding zone between CFC and CuCrZr was detected to be the most critical issue for the operational behaviour of the target elements. To achieve a sufficiently high manufacturing quality together with a high lifetime during operation thermal testing of full scale mockups was performed in combination with extensive FEM analyses. In both cases heat loads were applied similar to the expected heat loads in W7-X. All pre-series elements were tested in the ion beam test facility GLADIS. The elements were tested with 100 cycles of 10 MW/m 2 and several elements with even higher cycle numbers and heat loads up to 24 MW/m 2 . The instrumentation of the targets (thermocouples, strain gages) and the infrared camera observation of the heat loaded surface allow an experimental evaluation of the thermo-mechanical behaviour of the tested elements. The main result is a good agreement between experimental data and numerically computed predictions. Hot spots were, however, observed at the edges of several tiles during the HHF tests indicating local bonding problems. Therefore, a programme of fully 3D nonlinear thermal-mechanical FEM calculations was started to evaluate the thermo-mechanical behavior of the target elements with special focus on the optimization of the stress situation in the bonding zone between the CFC and the CuCrZr heat sink. This
Energy Technology Data Exchange (ETDEWEB)
Zouhair, Lachkar
2007-02-15
Mesoscale eddies play a fundamental role in ocean dynamics particularly in the Southern Ocean. Global-scale tracer simulations are typically made at coarse resolution without explicitly modeling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of anthropogenic CO{sub 2}, CFC-11 and bomb {delta}{sup 14}C. We made global anthropogenic transient tracer simulations in coarse-resolution, ORCA2, and eddy-permitting, ORCA05 and ORCA025, versions of the ocean modelling system NEMO. We focus on the Southern Ocean where tracer air-sea fluxes are largest. Eddies have little effect on bomb {delta}{sup 14}C uptake and storage. Yet for CFC-11 and anthropogenic CO{sub 2}, increased eddy activity reduces southern extra-tropical uptake by 28% and 25% respectively, thereby providing better agreement with observations. It is shown that the discrepancies in the equilibration times between the three tracers determine their respective sensitivities to the model horizontal resolution. Applying Gent and McWilliams (1990) (GM) parameterization of eddies in the non-eddying version of the model does improve results, but not enough. An in-depth investigation of the mechanisms by which eddies affect the uptake of the transient tracers shows that including mesoscale eddies leads to an overall reduction in the Antarctic Intermediate Water (AAIW) ventilation, and modifies substantially the spatial distribution of their source regions. This investigation reveals also that the GM parameterization still overestimates the ventilation and the subduction of AAIW in the Indian Ocean where the simulated mixed layer is particularly deep during the winter. This work suggests that most current coarse-resolution models may overestimate the ventilation of AAIW in the Indian sector of the Southern Ocean. This study shows also that the use of the GM parameterization may be of limited utility where mixed layer is relatively deep and confirms the general need for a
Role of mesoscale eddies in the global ocean uptake of anthropogenic CO2
International Nuclear Information System (INIS)
Zouhair, Lachkar
2007-02-01
Mesoscale eddies play a fundamental role in ocean dynamics particularly in the Southern Ocean. Global-scale tracer simulations are typically made at coarse resolution without explicitly modeling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of anthropogenic CO 2 , CFC-11 and bomb Δ 14 C. We made global anthropogenic transient tracer simulations in coarse-resolution, ORCA2, and eddy-permitting, ORCA05 and ORCA025, versions of the ocean modelling system NEMO. We focus on the Southern Ocean where tracer air-sea fluxes are largest. Eddies have little effect on bomb Δ 14 C uptake and storage. Yet for CFC-11 and anthropogenic CO 2 , increased eddy activity reduces southern extra-tropical uptake by 28% and 25% respectively, thereby providing better agreement with observations. It is shown that the discrepancies in the equilibration times between the three tracers determine their respective sensitivities to the model horizontal resolution. Applying Gent and McWilliams (1990) (GM) parameterization of eddies in the non-eddying version of the model does improve results, but not enough. An in-depth investigation of the mechanisms by which eddies affect the uptake of the transient tracers shows that including mesoscale eddies leads to an overall reduction in the Antarctic Intermediate Water (AAIW) ventilation, and modifies substantially the spatial distribution of their source regions. This investigation reveals also that the GM parameterization still overestimates the ventilation and the subduction of AAIW in the Indian Ocean where the simulated mixed layer is particularly deep during the winter. This work suggests that most current coarse-resolution models may overestimate the ventilation of AAIW in the Indian sector of the Southern Ocean. This study shows also that the use of the GM parameterization may be of limited utility where mixed layer is relatively deep and confirms the general need for a more adequate
'getting here from there': trauma and transformation in canadian ...
African Journals Online (AJOL)
visser
partners never demanded much of our soldiers beyond our field skills. Part-time .... The common Soviet enemy was as present and dangerous as ever. With ..... Withers' committee clearly saw RMC graduates as the standard bearers .... Centre', described by professional librarians as world class.76 Now all that CFC has to.
2010-01-01
... listed in the Charity List. In addition, an employee may not make a CFC contribution to an organization listed in the Charity List of a campaign covering a geographic location different from the campaign where the employee works, except in cases of emergencies or disasters as approved by the Director. This...
26 CFR 1.863-8 - Source of income derived from space and ocean activity under section 863(d).
2010-04-01
..., DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Regulations Applicable to Taxable... from sources without the United States to the extent the income, based on all the facts and... income derived by a CFC is income from sources without the United States to the extent the income, based...
Microbiological Examination of Ready-to-Eat Salads (Crispy Green ...
African Journals Online (AJOL)
A study of ready-to-eat salads (crispy Green) from retail establishments in the United Kingdom, was undertaken to determine their microbiological quality. The salads were collected and examined according to a standardized protocol. Total count was carried out and all colonies on CFC and MRS were counted as ...
5 CFR 950.301 - National and international federations eligibility.
2010-01-01
... eligibility. 950.301 Section 950.301 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL... business days of the date of the request may result in a determination that the federation will not be... donations. (3) That it does not employ in its CFC operations the services of private consultants, consulting...
Oleg Alexandrovič Lavrentěv a výzkum termojaderné fúze v Sovětském svazu
Czech Academy of Sciences Publication Activity Database
Řípa, Milan
2016-01-01
Roč. 66, č. 6 (2016), s. 357-366 ISSN 0009-0700 Institutional support: RVO:61389021 Keywords : fusion * tokamak * Lavrentiev O. A. * Berija L. P. * Sagdeev R. Z. * Sacharov A. D. * electromagnetic trap Subject RIV: BL - Plasma and Gas Discharge Physics http://www.cscasfyz.fzu.cz/cfc101aktcis.php
DEFF Research Database (Denmark)
Nørgaard, Jørgen
2004-01-01
The question is raised to what extend new technologies should - before released on the market - be subjected to a principle of precaution, including the relevance of the product. The issue is illustrated by examples from the past like asbestos and CFC gasses, as well as new cases like mobile phones...
77 FR 41940 - Clearing Exemption for Certain Swaps Entered Into by Cooperatives
2012-07-17
... example, the CFC was formed as a nonprofit corporation under the District of Columbia Cooperative... or its counterparty (if the counterparty is an SD or MSP) must report: (1) That the election of the.... The average hourly wage for a compliance attorney is $390, which means that the annual per cooperative...
5 CFR 950.801 - Campaign schedule.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Campaign schedule. 950.801 Section 950... VOLUNTARY ORGANIZATIONS CFC Timetable § 950.801 Campaign schedule. (a) The Combined Federal Campaign will be.../International and International parts of the Charity List to all local campaigns by a date to be determined by...
49 CFR 572.146 - Test conditions and instrumentation.
2010-10-01
... transducer location as shown in drawing 210-0000. A lower neck transducer as specified in drawing SA 572-S19...) Head acceleration—Class 1000 (2) Neck (i) Force—Class 1000 (ii) Moments—Class 600 (iii) Pendulum acceleration—Class 180 (iv) Rotation potentiometer response (if used)—CFC 60. (3) Thorax: (i) Rib/sternum...
International Nuclear Information System (INIS)
Safronov, V.M.; Arkhipov, N.I.; Klimov, N.S.; Kovalenko, D.V.; Moskaleva, A.A.; Podkovyrov, V.L.; Toporkov, D.A.; Zhitlukhin, A.M.; Landman, I.S.; Poznyak, I.M.
2008-01-01
Carbon fibre composite (CFC) and tungsten were irradiated by intense plasma streams at plasma gun facilities MK-200UG and QSPA-T. The targets were tested by plasma loads relevant to Edge Localised Modes (ELM) and mitigated disruptions in ITER. Onset condition of material erosion and properties of erosion products have been studied
2011-06-24
... the US2 stock from US2, the issuing corporation. Therefore, because CFC's adjusted basis in the US2... States property is stock of a domestic corporation described in section 956(c)(1)(B) or an obligation of... corporation from the domestic issuing corporation. Specified United States property does not include property...
Moving Advanced Desiccant Materials into Mainstream Non-CFC Cooling Products
Energy Technology Data Exchange (ETDEWEB)
Sand, J R [ORNL; Grossman, G [ORNL; Rice, C K [ORNL; Fairchild, P D [ORNL; Gross, I L [Engelhard/ICC
1994-01-01
Desiccant air-conditioning systems can be used as alternatives for conventional air-conditioning equipment in any commercial or residential building. Recent breakthroughs in desiccant materials technology and the creation of new markets by Indoor Air Quality issues make desiccant-based air-conditioning equipment practical for many space-conditioning applications.
Moving Advanced Desiccant Materials into Mainstream Non-CFC Cooling Products
Energy Technology Data Exchange (ETDEWEB)
Sand, J. R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Grossman, T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rice, C. K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Fairchild, P. D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gross, I. L. [Engelhard/ICC, Hatboro, PA (United States). Fresh Air Solutions
2004-12-30
Desiccant dehumidification technology is emerging as a technically viable alternative for comfort conditioning in many commercial and institutional buildings. Attempts to improve the indoor air quality of buildings has resulted in increasingly stringent guidelines for occupant outdoor air ventilation rates. Additionally, revised building heating, ventilating, and air-conditioning (HVAC) design criteria based on regional peak dew point data highlight the important of the latent (moisture removal) building load relative to the sensible (temperature) building load.
CuPb rheocast alloy as joining material for CFC composites
Salvo, M.; Lemoine, P.; Ferraris, M.; Appendino Montorsi, M.; Matera, R.
1995-10-01
High heat flux components for future use in thermonuclear fusion reactors are designed as layered structures. The assembling of the different parts (armour, heat sink and external structure) requires a joint which could withstand large heat loads and thermal stresses. In this paper we examined a 50 wt% PbCu rheocast alloy (RCA) as joining material for the armour/heat sink joint. The alloy was prepared in vacuum in a rotational furnace and was characterized by SEM-EDS analysis and heating microscopy. The obtained microstructure was globular as foreseen and it remained after prolonged heating at 650°C. The alloy showed very good ductility: sheets of about 200 μm were rolled starting from about 1 × 1 × 1 cm 3 cubes. The alloy was successful in joining both the armour and the heat sink materials, respectively, carbon fibre reinforced composites and copper. Initial mechanical testing shows that the technique is viable for the foreseen applications in the field of thermonuclear fusion reactors.
Ultrasonic non-destructive testing on CFC monoblock divertor mock-up
International Nuclear Information System (INIS)
Ezato, K.; Taniguchi, M.; Sato, K.; Araki, M.; Akiba, M.
2001-01-01
Non-destructive ultrasonic testing has been applied for the characterization of joints by means of a polymer transducer. One of the advantages of the polymer transducer is flexibility in its shape and the possibility to install multiple transducers in one probe, which can reduce the time for inspection. As a first step, the size effect of the transducer on the resolution and sensitivity was examined to detect the joint flaw. Transducers with circumferential angles of 5 , 10 and 30 were tested. For this test a small divertor element with a driller hole was prepared, which simulates a joint defect. The transducers with angles of 30 could not characterize the size of the artificial joint flaw. On the contrary, the size of the artificial defect was successfully detected with an accuracy of 90% by means of the transducers with angles of 5 and 10 . From the viewpoint of the sensitivity of the detection of the joint flaw, the transducer with the angle of 10 is appropriate because it could detect the largest intensity of the reflected signal caused by the same artificial defect of the joint interface. (orig.)
Cu-Pb rheocast alloy as joining material for CFC composites
International Nuclear Information System (INIS)
Salvo, M.
1995-01-01
High heat flux components for future use in thermonuclear fusion reactors are designed as layered structures. The assembling of the different parts (armour, heat sink and external structure) requires a joint which could withstand large heat loads and thermal stresses. In this paper we examined a 50 wt% Pb-Cu rheocast alloy (RCA) as joining material for the armour/heat sink joint. The alloy was prepared in vacuum in a rotational furnace and was characterized by SEM-EDS analysis and heating microscopy. The obtained microstructure was globular as foreseen and it remained after prolonged heating at 650 C. The alloy showed very good ductility: sheets of about 200 μm were rolled starting from about 1x1x1 cm 3 cubes. The alloy was successful in joining both the armour and the heat sink materials, respectively, carbon fibre reinforced composites and copper. Initial mechanical testing shows that the technique is viable for the foreseen applications in the field of thermonuclear fusion reactors. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Huhn, Oliver; Roether, Wolfgang [Institut fuer Umweltphysik, Universitaet Bremen (Germany)
2007-07-01
North Atlantic Deep Water (NADW) represents the Atlantic part of the deep, southward return arm of the oceanic 'conveyor belt', which moderates Europe's climate and effects most of the water transfer from the ocean surface into the deep waters globally. The transfer starts from the NADW formation regions, which in the case of upper NADW (approx. 1500-2000 m depth) is the Labrador Sea (far NW Atlantic). NADW is found concentrated toward the continental slope of the Americas, but subject to meandering, and to recirculation into, and mixing with, the waters of the interior Atlantic. Individual water parcels thus follow a complex ensemble of trajectories. We have obtained characteristics of that ensemble by fitting the free parameters of a suitable function using extensive observations of the transient tracers CFC-11, CFC-12, CCl{sub 4}, and tritium. A tracer transfer function of ocean-surface concentrations to those in newly formed NADW was derived as a precursory step. In the upper NADW we obtain RMS transfer-time dispersions on the way from the Labrador Sea of 31 years at 6 N rising to 53 years at 20 S, compared to mean transfer times ranging 46 to 79 years ({+-}20 %); furthermore, approximately 10 % to 40 % of the water is old, tracer-free water admixed on the way. Similar results have been obtained for lower NADW (approx. 2500-4000 m). The combination of tritium and CFC observations is particularly suited to constrain the dispersion, since it acts on the concentrations of these tracers in an opposite way. The tracer-adjusted transfer functions allow quantification of the NADW transport of pollutants and other compounds delivered to the NADW formation region. The results can furthermore check mean transfer times and large-scale dispersion of the NADW part of dynamic ocean circulation models.
Testing of high heat flux components manufactured by ENEA for ITER divertor
International Nuclear Information System (INIS)
Visca, Eliseo; Escourbiac, F.; Libera, S.; Mancini, A.; Mazzone, G.; Merola, M.; Pizzuto, A.
2009-01-01
ENEA is involved in the International Thermonuclear Experimental Reactor (ITER) R and D activities and in particular in the manufacturing of high heat flux plasma-facing components, such as the divertor targets. During the last years ENEA has manufactured actively cooled mock-ups by using different technologies, namely brazing, diffusion bonding and HIPping. A new manufacturing process that combines two main techniques PBC (Pre-Brazed Casting) and the HRP (Hot Radial Pressing) has been set up and widely tested. A full monoblock medium scale vertical target, having a straight CFC armoured part and a curved W armoured part, was manufactured using this process. The ultrasonic method was used for the non-destructive examinations performed during the manufacturing of the component, from the monoblock preparation up to the final mock-up assembling. The component was also examined by thermography on SATIR facility (CEA, France), afterwards it was thermal fatigue tested at FE200 (200 kW electron beam facility, CEA/AREVA France). The successful results of the thermal fatigue testing performed according the ITER requirements (10 MW/m 2 , 3000 cycles of 10 s on both CFC and W part, then 20/15 MW/m 2 , 2000 cycles of 10 s on CFC/W part, respectively) have confirmed that the developed process can be considerate a candidate for the manufacturing of monoblock divertor components. Furthermore, a 35-MW/m 2 Critical Heat Flux was measured at relevant thermal-hydraulics conditions at the end of the testing campaign. This paper reports the manufacturing route, the thermal fatigue testing results, the pre and post non-destructive examination and the destructive examination performed on the ITER vertical target medium scale mock-up. These activities were performed in the frame of EFDA contracts (04-1218 with CEA, 93-851 JN with AREVA and 03-1054 with ENEA).
Encoding of emotion-paired spatial stimuli in the rodent hippocampus
Directory of Open Access Journals (Sweden)
Rebecca eNalloor
2012-06-01
Full Text Available Rats can acquire the cognitive component of CS-US associations between sensory and aversive stimuli without a functional basolateral amygdala. Thus, other brain regions should support such associations. Some septal/dorsal CA1 (dCA1 neurons respond to both spatial stimuli and footshock, suggesting that dCA1 could be one such region. We report that, in both dorsal and ventral hippocampus, different neuronal ensembles express immediate-early genes when a place is experienced alone vs. when it is associated with foot shock. We assessed changes in the size and overlap of hippocampal neuronal ensembles activated by two behavioral events using a cellular imaging method, Arc/Homer1a catFISH. The control group (A-A experienced the same place twice, while the experimental group (A-CFC received the same training plus two foot shocks during the second event. During fear conditioning, A-CFC, compared to A-A, rats had a smaller ensemble size in dCA3, dCA1 and vCA3, but not vCA1. Additionally, A-CFC rats had a lower overlap score in dCA1 and vCA3. Locomotion did not correlate with ensemble size. Importantly, foot shocks delivered in a training paradigm that prevents establishing shock-context associations, did not induce significant Arc expression, rejecting the possibility that the observed changes in ensemble size and composition simply reflect experiencing a foot shock. Combined with data that Arc is necessary for lasting synaptic plasticity and long-term memory, the data suggests that Arc/H1a+ hippocampal neuronal ensembles encode aspects of fear conditioning beyond space and time. Rats, like humans, may use the hippocampus to create integrated episodic-like memory during fear conditioning.
International Nuclear Information System (INIS)
Rosen, M.R.; Hong, Y.S.; Reeves, R.; Sheppard, D.; Roberts, K.; Viljevac, Z.; Smaill, A.
2002-01-01
Disposal of storm water in the Mt Eden area of Auckland, New Zealand, is via 'soak holes' drilled directly into the top of fractured basalt. Although this method of disposal has been used for at least 60 years, its sustainability with respect to groundwater quality has not been addressed. The groundwater has relatively low concentrations of dissolved heavy metals, although total metals are higher suggesting that the metals are bound to mobile particulates within the aquifer. PAH concentrations are also low in the aquifer, although sampling after rainfall events show small increases in PAH. Tritium measurements of the groundwater showed that all of the groundwater south of Chamberlin Park is less than 2 years old. This area has many soak holes. The data suggest that infiltration is very rapid and occurs throughout the area almost simultaneously after rainfall events. One well north of Chamberlin Park, where soak holes are absent has an age of 47 years ± 2 years. The groundwater here is low in dissolved oxygen and appears to be slow moving. CFC measurements indicate that all wells sampled south of Chamberlin Park are contaminated by excess CFCs. However, this result indicates rapid recharge from the surface via storm water. The same well north of Chamberlin Park that was dated using tritium, also has a CFC age of approximately 30 years. Thus, CFC dating may be useful in urban areas that are separated from atmospheric contamination by confining beds or slow circulation. A Kohonen self-organising feature maps (KSOFM) neural network was used to analyse the effect on storm water infiltration on groundwater quality, and determine the inter-relationship of the groundwater quality variables. The model shows that where the land use type is industrial or residential with many soak holes, there is a strong correlation of increased concentrations of heavy metals and storm water infiltration. (author)
Matters which shorten the ozone layer; Substances qui appauvrissent la couche d'ozone
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-12-01
This document, proposed by the ministry of the national development and the environment, gives the list of the main texts relative to the matters which shorten the ozone layer and the evolution of the community regulations in this domain. The concerned matters are the Cfc and the HCFC production and use. (A.L.B.)
Anthropogenous modifications of the atmosphere. The atmospheric ozone threat
International Nuclear Information System (INIS)
Aimedieu, P.
1991-01-01
Ozone role and atmospheric chemistry are first reviewed: chemical reactions and vertical distribution of ozone in the atmosphere. The origins of chlorofluorocarbon air pollution and the role of the various types of CFC on ozone depletion, greenhouse effect, cancer, etc. are then discussed. The political and environmental discussions concerning these phenomena are also reviewed
Feng, Yujie; Yang, Qiao; Wang, Xin; Logan, Bruce E.
2010-01-01
-AH). The combined heat and acid treatment improve power production to 1370 mW m-2, which is 34% larger than the untreated control (CF-C, 1020 mW m-2). This power density is 25% higher than using only acid treatment (1100 mW m-2) and 7% higher than that using only
Energy Technology Data Exchange (ETDEWEB)
Heinonen, E.W.; Tapscott, R.E. [Univ. of New Mexico, Albuquerque, NM (United States)
1994-07-01
Regulations on alternative refrigerants and concerns for the environment are forcing the refrigeration industry to consider the use of potentially flammable fluids to replace CFC fluids currently in use. The objectives of this program are to establish the conditions under which refrigerants and refrigerant blends exhibit flammability and to develop appropriate methods to measure flammability.
Evolutionary genetic analyses of MEF2C gene: implications for learning and memory in Homo sapiens.
Kalmady, Sunil V; Venkatasubramanian, Ganesan; Arasappa, Rashmi; Rao, Naren P
2013-02-01
MEF2C facilitates context-dependent fear conditioning (CFC) which is a salient aspect of hippocampus-dependent learning and memory. CFC might have played a crucial role in human evolution because of its advantageous influence on survival of species. In this study, we analyzed 23 orthologous mammalian gene sequences of MEF2C gene to examine the evidence for positive selection on this gene in Homo sapiens using Phylogenetic Analysis by Maximum Likelihood (PAML) and HyPhy software. Both PAML Bayes Empirical Bayes (BEB) and HyPhy Fixed Effects Likelihood (FEL) analyses supported significant positive selection on 4 codon sites in H. sapiens. Also, haplotter analysis revealed significant ongoing positive selection on this gene in Central European population. The study findings suggest that adaptive selective pressure on this gene might have influenced human evolution. Further research on this gene might unravel the potential role of this gene in learning and memory as well as its pathogenetic effect in certain hippocampal disorders with evolutionary basis like schizophrenia. Copyright © 2012 Elsevier B.V. All rights reserved.
Mechanics of brazed joints and compliant layers in high heat flux components
International Nuclear Information System (INIS)
Lovato, G.; Moret, F.; Chaumat, G.
1994-01-01
Soft layers are of great interest for the joining of dissimilar materials like beryllium, tungsten or carbon base refractory tiles for plasma interface and cooled structures made of copper or molybdenum. Soft layers reduce the residual and in-service stress/strain level without reducing the thermal capability. Thin soft layers interfaces are produced during the brazing or HIP bonding cycles. However, the numerical modelling of the mechanical effect of such soft layers remains largely inaccurate. The camber of [CFC tiles (A05, N11, N112)/Ag-Cu-Ti filler metal/OFHC or TZM substrate] assemblies is recorded during the whole brazing thermal cycle and subsequent thermal fatigue cycles using a special vertical dilatometer. An inverse method based on Finite Element modelling of the samples is used to determine the joint constitutive law. Then, by comparing experiments and FEM calculations, the effects of distributed damage of the CFC and of the strain hardening and thermal softening of OFHC on the in-service stress/strain state of the component are observed. (authors). 5 refs., 7 figs
Effects of ELMs on ITER divertor armour materials
Energy Technology Data Exchange (ETDEWEB)
Zhitlukhin, A. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation)]. E-mail: zhitlukh@triniti.ru; Klimov, N. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation); Landman, I. [Forschungszentrum Karlsruhe, P.O. Box 3640, 76021 Karlsruhe (Germany); Linke, J. [Forschungszentrum Juelich, EURATOM-Association, Juelich (Germany)]. E-mail: j.linke@fz-juelich.de; Loarte, A. [EFDA, Boltzmannstr. 2, 85748 Garching (Germany); Merola, M. [EFDA, Boltzmannstr. 2, 85748 Garching (Germany); Podkovyrov, V. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation); Federici, G. [ITER JWS Garching, Boltzmannstr. 2, 85748 Garching (Germany); Bazylev, B. [Forschungszentrum Karlsruhe, P.O. Box 3640, 76021 Karlsruhe (Germany); Pestchanyi, S. [Forschungszentrum Karlsruhe, P.O. Box 3640, 76021 Karlsruhe (Germany); Safronov, V. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation); Hirai, T. [Forschungszentrum Juelich, EURATOM-Association, Juelich (Germany); Maynashev, V. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation); Levashov, V. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation); Muzichenko, A. [SRC RF TRINITI, Troitsk, 142190, Moscow Region (Russian Federation)
2007-06-15
This paper is concerned with investigation of an erosion of the ITER-like divertor plasma facing components under plasma heat loads expected during the Type I ELMs in ITER. These experiments were carried out on plasma accelerator QSPA at the SRC RF TRINITI under EU/RF collaboration. Targets were exposed by series repeated plasma pulses with heat loads in a range of 0.5-1.5 MJ/m{sup 2} and pulse duration 0.5 ms. Erosion of CFC macrobrushes was determined mainly by sublimation of PAN-fibres that was less than 2.5 {mu}m per pulse. The CFC erosion was negligible at the energy density less than 0.5 MJ/m{sup 2} and was increased to the average value 0.3 {mu}m per pulse at 1.5 MJ/m{sup 2}. The pure tungsten macrobrushes erosion was small in the energy range of 0.5-1.3 MJ/m{sup 2}. The sharp growth of tungsten erosion and the intense droplet ejection were observed at the energy density of 1.5 MJ/m{sup 2}.
ANALISIS POSITIONING RESTORAN CEPAT SAJI
Directory of Open Access Journals (Sweden)
Osa Omar Sharif
2017-04-01
Full Text Available Penelitian ini bertujuan untuk meneliti positioning restoran cepat saji McDonald's, Kentucky Fried Chicken, California Fried Chicken, A&W, dan Texas Chicken. Penelitian dilakukan di Kota Bandung dengan mengambil sebanyak 400 responden. Analisis yang digunakan dalam penelitian ini adalah analisis multidimensional scaling, analisis memberikan gambaran positioning dari restoran cepat saji yang ditampilkan dalam perceptual map. Restoran cepat saji yang memiliki layanan paling baik adalah McD dan yang memiliki layanan paling buruk adalah CFC. Restoran cepat saji yang memiliki rasa makanan paling enak adalah McD dan yang memiliki rasa makanan tidak enak adalah CFC. KFC dinilai paling ideal karena selalu berhasil menduduki peringkat satu dan dua jika dilihat dari sudut pandang restoran cepat saji yang lain. Pesaing terdekat McD adalah KFC. McD mendapatkan ranking pertama dari segi atribut layanan, kebersihan, variasi makanan, dan rasa makanan. Dengan posisi seperti ini McD seharusnya tetap menjaga kualitas layanan, kebersihan, variasi makanan, dan rasa makanan agar konsumen tetap memilih untuk datang ke McD. KFC sebaiknya tetap menjaga suasana yang membuat konsumen nyaman akan suasana di dalam atau diluar restoran
Effects of ELMs on ITER divertor armour materials
Zhitlukhin, A.; Klimov, N.; Landman, I.; Linke, J.; Loarte, A.; Merola, M.; Podkovyrov, V.; Federici, G.; Bazylev, B.; Pestchanyi, S.; Safronov, V.; Hirai, T.; Maynashev, V.; Levashov, V.; Muzichenko, A.
2007-06-01
This paper is concerned with investigation of an erosion of the ITER-like divertor plasma facing components under plasma heat loads expected during the Type I ELMs in ITER. These experiments were carried out on plasma accelerator QSPA at the SRC RF TRINITI under EU/RF collaboration. Targets were exposed by series repeated plasma pulses with heat loads in a range of 0.5-1.5 MJ/m2 and pulse duration 0.5 ms. Erosion of CFC macrobrushes was determined mainly by sublimation of PAN-fibres that was less than 2.5 μm per pulse. The CFC erosion was negligible at the energy density less than 0.5 MJ/m2 and was increased to the average value 0.3 μm per pulse at 1.5 MJ/m2. The pure tungsten macrobrushes erosion was small in the energy range of 0.5-1.3 MJ/m2. The sharp growth of tungsten erosion and the intense droplet ejection were observed at the energy density of 1.5 MJ/m2.
Mechanics of brazed joints and compliant layers in high heat flux components
International Nuclear Information System (INIS)
Lovato, G.; Moret, F.; Chaumat, G.; Cailletaud, G.; Pilvin, P.
1995-01-01
Soft layers are of great interest for the joining of dissimilar materials like beryllium, tungsten or carbone base refractory tiles for plasma interface and cooled structures made of copper or molybdenum. Soft layers reduce the residual and in-service stress/strain level without reducing the thermal capability. Thin soft layers interfaces are produced during the brazing or HIP bonding cycles. However, the numerical modelling of the mechanical effect of such soft layers remains largely inaccurate. The camber of [CFC tiles (A05, N11, N112)/Ag-Cu-Ti filler metal/OFHC or TZM substrate] assemblies is recorded during the whole brazing thermal cycle and subsequent thermal fatigue cycles using a special vertical dilatometer. An inverse method based on Finite Element modelling of the samples is used to determine the joint constitutive law. Then, by comparing experiments and FEM calculations, the effects of distributed damage of the CFC and of the strain hardening and thermal softening of OFHC on the in-service stress/strain state of the component are observed. (orig.)
A new method used to evaluate organic working fluids
International Nuclear Information System (INIS)
Zhang, Xinxin; He, Maogang; Wang, Jingfu
2014-01-01
In this paper, we propose a method named “Weight Classification-Hasse Dominance” to evaluate organic working fluids. This new method combines the advantages of both the method of weight determination and the Hasse Diagram Technique (HDT). It can be used to evaluate the thermodynamic performance, environmental protection indicator, and safety requirement of organic working fluid simultaneously. This evaluation method can offer good reference for working fluid selection. Using this method, the organic working fluids which have been phased out and will be phased out by the Montreal Protocol including CFCs (chlorofluorocarbons), HCFCs (hydrochlorofluorocarbons), and HFCs (hydrofluorocarbons) were evaluated. Moreover, HCs (hydrocarbons) can be considered as a completely different kind of organic working fluid from CFCs, HCFCs, and HFCs according to the comparison based on this new evaluation method. - Highlights: • We propose a new method used to evaluate organic working fluids. • This evaluation method can offer good reference for working fluid selection. • CFC, HCFC, and HFC working fluids were evaluated using this evaluation method. • HC can be considered as a totally different working fluid from CFC, HCFC, and HFC
Loading nature of the interfacial cracks in a joint component under fusion-relevant thermal loads
International Nuclear Information System (INIS)
You, J.H.
1998-01-01
One of the standard design concepts for divertor components in a fusion reactor is the bonded joint structure. Understanding the loading nature of interfacial cracks are significant for the assessment of structural integrity of divertor joint components. In this paper, the thermomechanical loading nature of interfacial cracks is discussed. A bi-material joint element consisting of the CFC/TZM system is considered. A typical fusion operation condition is simulated assuming a pulsed high heat flux loading. Stress singularities near the interfacial crack tips are characterized quantitatively in terms of the fracture mechanical parameters. The evolution of the stress intensity factors and the energy release rate during the given transient thermal load are determined. The difference in loading characteristics between the edge crack and the center crack is discussed. High heat flux cycling tests are performed on brazed CFC/TZM divertor elements in an electron beam test facility. The microstructures of the damaged interface agree with the predicted fracture modes. The loading nature and possible failure mechanisms are discussed for a fusion-relevant thermal loading. (orig.)
UV-VIS Spectroscopy Applied to Stratospheric Chemistry, Methods and Results
Energy Technology Data Exchange (ETDEWEB)
Karlsen, K.
1996-03-01
This paper was read at the workshop ``The Norwegian Climate and Ozone Research Programme`` held on 11-12 March 1996. Numerous observations and modeling have shown with a very high degree of certainty that the man-made emissions of chlorofluorocarbons (CFC) and halons are responsible for the Antarctica ozone hole. It is also evident that the ozone layer of the Northern Hemisphere has suffered a certain decline over the last 10-15 years, possibly because of CFC and halons. 20-30% of the observed reduction is ascribed to coupled chlorine and bromine chemistry via a catalytic cycle resulting in the net conversion of 2O{sub 3} to 3O{sub 2}. But the details are not fully understood. The author plans to assemble a UV-VIS spectrometer for measuring the species OClO and BrO and to compare and discuss measured diurnal variations of OClO and BrO with model calculations. The use of Differential Optical Absorption Spectroscopy (DOAS) is discussed and some results from late 1995 presented. 6 refs., 2 figs.
Energy deposition and thermal effects of runaway electrons in ITER-FEAT plasma facing components
International Nuclear Information System (INIS)
Maddaluno, G.; Maruccia, G.; Merola, M.; Rollet, S.
2003-01-01
The profile of energy deposited by runaway electrons (RAEs) of 10 or 50 MeV in International Thermonuclear Experimental Reactor-Fusion Energy Advanced Tokamak (ITER-FEAT) plasma facing components (PFCs) and the subsequent temperature pattern have been calculated by using the Monte Carlo code FLUKA and the finite element heat conduction code ANSYS. The RAE energy deposition density was assumed to be 50 MJ/m 2 and both 10 and 100 ms deposition times were considered. Five different configurations of PFCs were investigated: primary first wall armoured with Be, with and without protecting CFC poloidal limiters, both port limiter first wall options (Be flat tile and CFC monoblock), divertor baffle first wall, armoured with W. The analysis has outlined that for all the configurations but one (port limiter with Be flat tile) the heat sink and the cooling tube beneath the armour are well protected for both RAE energies and for both energy deposition times. On the other hand large melting (W, Be) or sublimation (C) of the surface layer occurs, eventually affecting the PFCs lifetime
International Nuclear Information System (INIS)
Heuvel, R.L. van den
1990-01-01
Radiation damage from 241 Am to bone marrow cells was manifest in long-term bone marrow cultures (LTC) from offspring of mice radiocontaminated at 14th day of gestation (119, 479, 803, 1754 kBq 241 Am kg). Offspring were reared by their own contaminated mother for 3 weeks postnatal. LTC from these offspring were less able to support in vitro CFC proliferation than control LTC. This radiation damage persisted 71 weeks after radiocontamination in utero. Damage was observed at lower doses if 241 Am contamination occurred at foetal rather than adult ages. Radiation damage was observed only using LTC. After culturing LTC in 25% FCS and recharging the stromal adherent layer with bone marrow cell suspensions originating either from control offspring or from offspring contaminated with 241 Am in utero evidence was found that the proliferation capacity of haemopoietic cells was diminished. However, the nature of effects on the stromal elements is currently somewhat equivocal. Following in utero contamination stromal adherent cells appeared to support better production of in vitro CFC. (author)
Energy deposition and thermal effects of runaway electrons in ITER-FEAT plasma facing components
Maddaluno, G.; Maruccia, G.; Merola, M.; Rollet, S.
2003-03-01
The profile of energy deposited by runaway electrons (RAEs) of 10 or 50 MeV in International Thermonuclear Experimental Reactor-Fusion Energy Advanced Tokamak (ITER-FEAT) plasma facing components (PFCs) and the subsequent temperature pattern have been calculated by using the Monte Carlo code FLUKA and the finite element heat conduction code ANSYS. The RAE energy deposition density was assumed to be 50 MJ/m 2 and both 10 and 100 ms deposition times were considered. Five different configurations of PFCs were investigated: primary first wall armoured with Be, with and without protecting CFC poloidal limiters, both port limiter first wall options (Be flat tile and CFC monoblock), divertor baffle first wall, armoured with W. The analysis has outlined that for all the configurations but one (port limiter with Be flat tile) the heat sink and the cooling tube beneath the armour are well protected for both RAE energies and for both energy deposition times. On the other hand large melting (W, Be) or sublimation (C) of the surface layer occurs, eventually affecting the PFCs lifetime.
Handbook of plastic foams: types, properties, manufacture, and applications
National Research Council Canada - National Science Library
Landrock, Arthur H
1995-01-01
... is an introduction and also covers the subject of foam formation. The chapter includes a discussion of the Montreal Protocol mandating the development of foams with substantially reduced CFC content by 1995. Chapter 2 is a comprehensive discussion of thermosetting foams of all types, with the emphasis on urethane and phenolic foams. The authors, K Ashida and K Iwa...
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This paper is a series of transparencies which explains the engagements of Elf Atochem company in the replacement of chlorofluorocarbons (CFCs): development of HFCs, production of FORANE, safety and environmental criteria, main refrigerants and their application in new installations, perspectives in reconversion, replacement of R-22, CFC-12 and R-502 fluids with respect to their applications. (J.S.)
Comparison of hybrid and baseline ELMy H-mode confinement in JET with the carbon wall
Beurskens, M. N. A.; Frassinetti, L.; Challis, C.; Osborne, T.; Snyder, P. B.; Alper, B.; Angioni, C.; Bourdelle, C.; Buratti, P.; Crisanti, F.; Giovannozzi, E.; Giroud, C.; Groebner, R.; Hobirk, J.; Jenkins, I.; Joffrin, E.; Leyland, M. J.; Lomas, P.; Mantica, P.; McDonald, D.; Nunes, I.; Rimini, F.; Saarelma, S.; Voitsekhovitch, I.; P. de Vries,; Zarzoso, D.
2013-01-01
The confinement in JET baseline type I ELMy H-mode plasmas is compared to that in so-called hybrid H-modes in a database study of 112 plasmas in JET with the carbon fibre composite (CFC) wall. The baseline plasmas typically have beta(Nu) similar to 1.5-2, H-98 similar to 1, whereas the hybrid
26 CFR 1.954-1 - Foreign base company income.
2010-04-01
... under the rules of section 951 and thus is subject to current taxation under section 1, 11 or 55 of the... through FP and separately without FP. Based on the facts in the table below, the foreign base company... interest income is from sources within CFC's country of operation, is subject to a $10 income tax therein...
Energy Technology Data Exchange (ETDEWEB)
Zouhair, Lachkar
2007-02-15
Mesoscale eddies play a fundamental role in ocean dynamics particularly in the Southern Ocean. Global-scale tracer simulations are typically made at coarse resolution without explicitly modeling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of anthropogenic CO{sub 2}, CFC-11 and bomb {delta}{sup 14}C. We made global anthropogenic transient tracer simulations in coarse-resolution, ORCA2, and eddy-permitting, ORCA05 and ORCA025, versions of the ocean modelling system NEMO. We focus on the Southern Ocean where tracer air-sea fluxes are largest. Eddies have little effect on bomb {delta}{sup 14}C uptake and storage. Yet for CFC-11 and anthropogenic CO{sub 2}, increased eddy activity reduces southern extra-tropical uptake by 28% and 25% respectively, thereby providing better agreement with observations. It is shown that the discrepancies in the equilibration times between the three tracers determine their respective sensitivities to the model horizontal resolution. Applying Gent and McWilliams (1990) (GM) parameterization of eddies in the non-eddying version of the model does improve results, but not enough. An in-depth investigation of the mechanisms by which eddies affect the uptake of the transient tracers shows that including mesoscale eddies leads to an overall reduction in the Antarctic Intermediate Water (AAIW) ventilation, and modifies substantially the spatial distribution of their source regions. This investigation reveals also that the GM parameterization still overestimates the ventilation and the subduction of AAIW in the Indian Ocean where the simulated mixed layer is particularly deep during the winter. This work suggests that most current coarse-resolution models may overestimate the ventilation of AAIW in the Indian sector of the Southern Ocean. This study shows also that the use of the GM parameterization may be of limited utility where mixed layer is relatively deep and confirms the general need for a
Exploring Hydrofluorocarbons as Groundwater Age Tracers (Invited)
Haase, K. B.; Busenberg, E.; Plummer, L. N.; Casile, G.; Sanford, W. E.
2013-12-01
Groundwater dating tracers are an essential tool for analyzing hydrologic conditions in groundwater systems. Commonly used tracers for dating post-1940's groundwater include sulfur hexafluoride (SF6), chlorofluorocarbons (CFCs), 3H-3He, and other isotopic tracers (85Kr, δ2H and δ18O isotopes, etc.). Each tracer carries a corresponding set of advantages and limitations imposed by field, analytical, and interpretive methods. Increasing the number available tracers is appealing, particularly if they possess inert chemical properties and unique temporal emission histories from other tracers. Atmospherically derived halogenated trace gases continue to hold untapped potential for new tracers, as they are generally inert and their emission histories are well documented. SF5CF3, and CFC-13 were previously shown to have application as dating tracers, though their low mixing ratios and low solubility require large amounts of water to be degassed for their quantification. Two related groups of compounds, hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) are hypothesized to be potential age tracers, having similar mixing ratios to the CFCs and relatively high solubility. However, these compounds yield gas chromatography electron capture detector (GC-ECD) responses that are 10-2 -10-5 less than CFC-12, making purge and trap or field stripping GC-ECD approaches impractical. Therefore, in order to use dissolved HCFCs and HFCs as age tracers, different approaches are needed. To solve this problem, we developed an analytical method that uses an atomic emission detector (GC-AED) in place of an ECD to detect fluorinated compounds. In contrast to the ECD, the AED is a universally sensitive, highly linear, elementally specific detector. The new GC-AED system is being used to measure chlorodifluoromethane (HCFC-22), 1,1,1,2-tetrafluoroethane (HFC-134a), and other fluorinated compounds in one liter water samples to study their potential as age dating tracers. HCFC-22 is a
Evaluation of Oceanic Transport Statistics By Use of Transient Tracers and Bayesian Methods
Trossman, D. S.; Thompson, L.; Mecking, S.; Bryan, F.; Peacock, S.
2013-12-01
Key variables that quantify the time scales over which atmospheric signals penetrate into the oceanic interior and their uncertainties are computed using Bayesian methods and transient tracers from both models and observations. First, the mean residence times, subduction rates, and formation rates of Subtropical Mode Water (STMW) and Subpolar Mode Water (SPMW) in the North Atlantic and Subantarctic Mode Water (SAMW) in the Southern Ocean are estimated by combining a model and observations of chlorofluorocarbon-11 (CFC-11) via Bayesian Model Averaging (BMA), statistical technique that weights model estimates according to how close they agree with observations. Second, a Bayesian method is presented to find two oceanic transport parameters associated with the age distribution of ocean waters, the transit-time distribution (TTD), by combining an eddying global ocean model's estimate of the TTD with hydrographic observations of CFC-11, temperature, and salinity. Uncertainties associated with objectively mapping irregularly spaced bottle data are quantified by making use of a thin-plate spline and then propagated via the two Bayesian techniques. It is found that the subduction of STMW, SPMW, and SAMW is mostly an advective process, but up to about one-third of STMW subduction likely owes to non-advective processes. Also, while the formation of STMW is mostly due to subduction, the formation of SPMW is mostly due to other processes. About half of the formation of SAMW is due to subduction and half is due to other processes. A combination of air-sea flux, acting on relatively short time scales, and turbulent mixing, acting on a wide range of time scales, is likely the dominant SPMW erosion mechanism. Air-sea flux is likely responsible for most STMW erosion, and turbulent mixing is likely responsible for most SAMW erosion. Two oceanic transport parameters, the mean age of a water parcel and the half-variance associated with the TTD, estimated using the model's tracers as
Arnold, B. W.; Gardner, P.
2013-12-01
Calibration of groundwater flow models for the purpose of evaluating flow and aquifer heterogeneity typically uses observations of hydraulic head in wells and appropriate boundary conditions. Environmental tracers have a wide variety of decay rates and input signals in recharge, resulting in a potentially broad source of additional information to constrain flow rates and heterogeneity. A numerical study was conducted to evaluate the reduction in uncertainty during model calibration using observations of various environmental tracers and combinations of tracers. A synthetic data set was constructed by simulating steady groundwater flow and transient tracer transport in a high-resolution, 2-D aquifer with heterogeneous permeability and porosity using the PFLOTRAN software code. Data on pressure and tracer concentration were extracted at well locations and then used as observations for automated calibration of a flow and transport model using the pilot point method and the PEST code. Optimization runs were performed to estimate parameter values of permeability at 30 pilot points in the model domain for cases using 42 observations of: 1) pressure, 2) pressure and CFC11 concentrations, 3) pressure and Ar-39 concentrations, and 4) pressure, CFC11, Ar-39, tritium, and He-3 concentrations. Results show significantly lower uncertainty, as indicated by the 95% linear confidence intervals, in permeability values at the pilot points for cases including observations of environmental tracer concentrations. The average linear uncertainty range for permeability at the pilot points using pressure observations alone is 4.6 orders of magnitude, using pressure and CFC11 concentrations is 1.6 orders of magnitude, using pressure and Ar-39 concentrations is 0.9 order of magnitude, and using pressure, CFC11, Ar-39, tritium, and He-3 concentrations is 1.0 order of magnitude. Data on Ar-39 concentrations result in the greatest parameter uncertainty reduction because its half-life of 269
Energy Technology Data Exchange (ETDEWEB)
Stuerchler, P. [GfG AG, Binz (Switzerland)
2001-09-01
Experts agree that ammonia is the best and most economical refrigerant for a number of applications, e.g. in skating rinks, the food industry, chemical plants, etc. It has good thermodynamic properties and a low ozone-depleting potential, but it is also an aggressive and toxic substance. The potential hazard to humans and plants can be reduced, however, by early detection of leaks. There are different specifications in different European countries. In Switzerland, the EKAS regulations apply. [German] In der Kaelteindustrie herrscht eine Uebereinstimmung, dass fuer eine Vielzahl von Anlagen, z.B. Eissportanlagen, Lebensmittelbetriebe, Chemieanlagen u.v.m., Ammoniak als das beste und wirtschaftlichste Kaeltemittel betrachtet wird. Die guten thermodynamischen Eigenschaften und das geringe Ozonabbaupotential haben Ammoniak zum wichtigsten Kaeltemittel in mittleren und Grossanlagen gemacht. Die aggressive und giftige Chemikalie Ammoniak birgt jedoch ein nicht zu unterschaetzendes Gefahrenpotential fuer Mensch und Anlage. Diese Gefahr kann weitestgehend eingedaemmt werden. Eine fruehe und zuverlaessige Erkennung von Leckagen minimiert deren Auswirkungen und Schaeden. Die Vorschriften hierzu sind laenderspezifisch in den Verordnungen und Richtlinien festgelegt. Fuer die Schweiz gelten die Richtlinien der EKAS. (orig.)
Focazio, Michael J.; Plummer, Niel; Bohlke, John K.; Busenberg, Eurybiades; Bachman, L. Joseph; Powars, David S.
1998-01-01
Knowledge of the residence times of the ground-water systems in Chesapeake Bay watershed helps resource managers anticipate potential delays between implementation of land-management practices and any improve-ments in river and estuary water quality. This report presents preliminary estimates of ground-water residence times and apparent ages of water in the shallow aquifers of the Chesapeake Bay watershed. A simple reservoir model, published data, and analyses of spring water were used to estimate residence times and apparent ages of ground-water discharge. Ranges of aquifer hydraulic characteristics throughout the Bay watershed were derived from published literature and were used to estimate ground-water residence times on the basis of a simple reservoir model. Simple combinations of rock type and physiographic province were used to delineate hydrogeomorphic regions (HGMR?s) for the study area. The HGMR?s are used to facilitate organization and display of the data and analyses. Illustrations depicting the relation of aquifer characteristics and associated residence times as a continuum for each HGMR were developed. In this way, the natural variation of aquifer characteristics can be seen graphically by use of data from selected representative studies. Water samples collected in September and November 1996, from 46 springs throughout the watershed were analyzed for chlorofluorocarbons (CFC?s) to estimate the apparent age of ground water. For comparison purposes, apparent ages of water from springs were calculated assuming piston flow. Additi-onal data are given to estimate apparent ages assuming an exponential distribution of ages in spring discharge. Additionally, results from previous studies of CFC-dating of ground water from other springs and wells in the watershed were compiled. The CFC data, and the data on major ions, nutrients, and nitrogen isotopes in the water collected from the 46 springs are included in this report. The apparent ages of water
Greenhouse effect and climatic consequences: a scientific evaluation
International Nuclear Information System (INIS)
1991-01-01
The greenhouse effect and its causes and mechanisms are first recalled; anthropogenic contribution (CO2, CFC, ...) is evaluated and related to the biosphere temperature variation, without neglecting natural climatic variations. Based on climate models and energy scenarios, anthropogenic contribution effects on climatic variation, sea-level rise, etc. are evaluated and compared. Recommendations for improving precision of climate models are proposed [fr
Effective Thermal Conductivity of Graphite Materials with Cracks
Pestchaanyi, S. E.; Landman, I. S.
The dependence of effective thermal diffusivity on temperature caused by volumetric cracks is modelled for macroscopic graphite samples using the three-dimensional thermomechanics code Pegasus-3D. At high off-normal heat loads typical of the divertor armour, thermostress due to the anisotropy of graphite grains is much larger than that due to the temperature gradient. Numerical simulation demonstrated that the volumetric crack density both in fine grain graphites and in the CFC matrix depends mainly on the local sample temperature, not on the temperature gradient. This allows to define an effective thermal diffusivity for graphite with cracks. The results obtained are used to explain intense cracking and particle release from carbon based materials under electron beam heat load. Decrease of graphite thermal diffusivity with increase of the crack density explains particle release mechanism in the experiments with CFC where a clear energy threshold for the onset of particle release has been observed in J. Linke et al. Fusion Eng. Design, in press, Bazyler et al., these proceedings. Surface temperature measurement is necessary to calibrate the Pegasus-3D code for simulation of ITER divertor armour brittle destruction.
International Nuclear Information System (INIS)
Suzuki, Satoshi; Akiba, Masato; Saito, Masakatsu
2006-01-01
Divertor is given the largest heat load in the in-vessel components of fusion machine. The functions and conditions of divertor are stated from the point of view of thermal and structural dynamics. The way of thinking of structure design of divertor of JT-60 and the ITER (International Thermonuclear Experimental Reactor) is explained. As the conditions of divertor, the materials for large heat load, heat removal, pressure boundary, control of damage, and thermal stress/strain are considered. The divertor has to be changed periodically. The materials are required the heat removal function for high heat load. CuCrZr will be used to cooling tube and heat sink, and CFC materials for the surface. The cross section of ITER, a part of divertor, heat load of divertor and other components, the thermal conductivity of CFC and metal materials, conditions of cooling water for divertor of BWR, PWR and ITER, the thermal stress produced on rod, vertical target of ITER, structure of cooling tube, distribution of temperature and critical heart flux of inner wall of cooling tube, and fatigue clack of cooling tube are shown. (S.Y.)
Experience gained with the 3D machining of the W7-X HHF divertor target elements
International Nuclear Information System (INIS)
Junghanns, P.; Boscary, J.; Peacock, A.
2015-01-01
Highlights: • The Wendelstein 7-X surface of the actively cooled divertor is built up of 890 individually 3D machined target elements. • To date 300 target elements have been 3D machined with an accuracy of ±0.015 mm. • Copper discovered on the surface of few elements is no risk to operation. - Abstract: The high heat flux (HHF) divertor of W7-X consists of 100 target modules assembled from 890 actively water-cooled target elements protected with CFC tiles. The divertor surface will be built up of individually 3D machined target elements with 89 individual element types. To date 300 of the 890 target elements have been 3D machined with a very good accuracy. To achieve this successful result, a prototyping phase has been conducted to qualify the manufacturing route and to define the acceptance criteria with measures taken to minimize the risk of unacceptable damage during the manufacturing. After the 3D-machining, during the incoming inspection, copper infiltration from the interface between the CFC tiles and the CuCrZr heat sink to the plasma facing surface was detected in a small number of elements.