WorldWideScience

Sample records for cfc

  1. Atlantic CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    R. Steinfeldt

    2010-01-01

    Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.

  2. CFC Outdoor Tournament 2011

    CERN Document Server

    2011-01-01

    Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...

  3. Study of groundwater mixing using CFC data

    Institute of Scientific and Technical Information of China (English)

    韩良丰; 庞忠和

    2001-01-01

    CFCs (Chlorofluorocarbons) are sensitive tools in the study of groundwater mixing. Based on results of CFC concentrations, the extent of mixing can be identified by three methods: 1. discrepancy between apparent ages determined by individual CFC compounds; 2. inconsistency between CFC concentration ratios and their respective apparent ages; and 3. correlation between the concentrations of two CFC compounds for a group of samples. The principle of determination of mixing ratios and apparent CFC water age in the case of a two component mixing of CFC-containing water with CFC-free water is described.

  4. Chlorine isotope composition in chlorofluorocarbons CFC-11, CFC-12 and CFC-113 in firn, stratospheric and tropospheric air

    NARCIS (Netherlands)

    Allin, S. J.; Laube, J. C.; Witrant, E.; Kaiser, J.; McKenna, E.; Dennis, P.; Mulvaney, R.; Capron, E.; Martinerie, P.; Roeckmann, Thomas; Blunier, T.; Schwander, J.; Fraser, P. J.; Langenfelds, R. L.; Sturges, W. T.

    2015-01-01

    The stratospheric degradation of chlorofluorocarbons (CFCs) releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O-3). A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, Laube et al., 2010

  5. Detected CFCs: UV Absorption Spectra, Atmospheric Lifetimes, Global Warming and Ozone Depletion Potentials for CFC-112, CFC-112a, CFC-113a and CFC-114a

    Science.gov (United States)

    Bernard, F.; Davis, M. E.; McGillen, M.; Fleming, E. L.; Burkholder, J. B.

    2015-12-01

    Chlorofluorocarbons (CFCs) are ozone depleting substances (ODSs) and potent greenhouse gases. Measurements have observed CFC-112 (CFCl2CFCl2), CFC-112a (CF2ClCCl3), and CFC-113a (CCl3CF3) in the atmosphere (Laube et al., 2014). The current atmospheric abundances of CFC-112 and CFC-112a are ~0.4 and ~0.06 ppt, respectively, with decreasing abundance since 1995. In contrast, CFC-113a was found to show continuous growth over the past 50 years with a current atmospheric abundance of ~0.5 ppt. The major atmospheric removal process for these compounds is expected to be UV photolysis in the stratosphere. To date there is, however, no UV absorption spectra for these compounds available in the literature. To better determine the atmospheric lifetimes and environmental impact of these CFCs, laboratory measurements of the UV absorption spectra of CFC-112, CFC-112a, CFC-113a, and CFC-114a (Cl2FCF3) between 195 and 235 nm and over the temperature range 207 to 323 K were performed. Spectrum parametrizations were developed for use in atmospheric models. Atmospheric lifetimes and ozone depletion potentials (ODPs) were calculated using the Goddard Space Flight Center 2-D atmospheric chemistry model. Infrared absorption spectra of these compounds were also measured and used to calculate their global warming potentials. The results of the laboratory measurements and model calculations will be presented. J. C. Laube et al., Newly detected ozone-depleting substances in the atmosphere, Nature Geoscience, 7, 266-269, 2014

  6. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2014-06-01

    Full Text Available Chlorofluorocarbons (CFCs play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their global loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer-tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11 and CF2Cl2 (CFC-12. We present estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 yr for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS, the HIgh Resolution Dynamics Limb Sounder (HIRDLS, and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. We found a CFC-11/CFC-12 lifetime ratio of 0.47±0.08 and a CFC-12 lifetime of 111(96–132 yr for ACE-FTS, a ratio of 0.46±0.07 and a lifetime of 112(97–133 yr for HIRDLS, and a ratio of 0.46±0.08 and a lifetime of 112(96–135 yr for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.47±0.04 and the CFC-12 lifetime estimate is 112(102–123 yr. These results agree with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC reassessment, which recommends lifetimes of 52(43–67 yr and 102(88–122 yr, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled model we found a CFC-11/CFC-12 lifetime ratio of 0.48±0.07 and a CFC-12 lifetime of 110(95–129 yr, based on

  7. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2014-11-01

    Full Text Available Chlorofluorocarbons (CFCs play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their stratospheric loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer–tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11 and CF2Cl2 (CFC-12. We present estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 years for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS, the HIgh Resolution Dynamics Limb Sounder (HIRDLS, and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. We found a CFC-11/CFC-12 lifetime ratio of 0.47±0.08 and a CFC-12 lifetime of 112(96–133 years for ACE-FTS, a ratio of 0.46±0.07 and a lifetime of 113(97–134 years for HIRDLS, and a ratio of 0.46±0.08 and a lifetime of 114(98–136 years for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.46±0.04 and the CFC-12 lifetime estimate is 113(103–124 years. These results agree with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC reassessment, which recommends lifetimes of 52(43–67 years and 102(88–122 years, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled model we found a CFC-11/CFC-12 lifetime ratio of 0.48±0.07 and a CFC-12 lifetime

  8. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Science.gov (United States)

    Hoffmann, Lars; Hoppe, Charlotte; Müller, Rolf; Dutton, Geoffrey S.; Gille, John C.; Griessbach, Sabine; Jones, Ashley; Meyer, Catrin I.; Spang, Reinhold; Volk, C. Michael; Walker, Kaley A.

    2015-04-01

    Chlorofluorocarbons (CFCs) play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their stratospheric loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer-tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11) and CF2Cl2 (CFC-12). We present new estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 yr for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS), the HIgh Resolution Dynamics Limb Sounder (HIRDLS), and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS). We found a CFC-11/CFC-12 lifetime ratio of 0.47 ± 0.08 and a CFC-12 lifetime of 112(96 - 133) yr for ACE-FTS, a ratio of 0.46 ± 0.07 and a lifetime of 113(97 - 134) yr for HIRDLS, and a ratio of 0.46 ± 0.08 and a lifetime of 114(98 - 136) yr for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.46 ± 0.04 and the CFC-12 lifetime estimate is 113(103 - 124) yr. These results are in excellent agreement with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC) reassessment, which recommends lifetimes of 52(43 - 67) yr for CFC-11 and 102(88 - 122) yr for CFC-12, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled EMAC/CLaMS model we found a CFC-11/CFC-12 lifetime ratio

  9. International research into chlorofluorocarbon (CFC) alternatives

    Energy Technology Data Exchange (ETDEWEB)

    Marseille, T.J.; Shankle, D.L.; Thurman, A.G.

    1992-05-01

    Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.

  10. "Annan finansiell verksamhet" - En tolkning i ljuset av CFC-lagstiftningen : En tolkning i ljuset av CFC-lagstiftningen

    OpenAIRE

    Kiryo, Josef

    2010-01-01

    The initial provisions concerning CFC-legislation were introduced 1990 and has since been subject to several revisions and adaptations. The fundamental purpose of the CFC-legislation is to prohibit and prevent tax evasion undertaken by such companies that own other foreign companies where generated income is subject to low rates of taxation. The CFC-legislation aims to provide the Swedish government with an op-portunity to tax this income. This is important in order to prevent tax avoidance a...

  11. CFC concentrations in fresh groundwater in Latvia

    Science.gov (United States)

    Bikše, J.; DÄ`liĆa, A.; Babre, A.; RetiÄ·e, I.; Raga, B.; PÄ`rkone, E.

    2012-04-01

    One of the main issues in groundwater studies is groundwater age, also known as residence time. This is important for investigating the groundwater filtration rate and to solve variety issues of groundwater use, management and protection. Groundwater age studies in Latvia have been rare, and the latest study, which defined the new results of age of groundwater using CFC dating method, was during years 2002 - 2006 and it was carried out by Denmark and Greenland Geological Survey (GEUS) and the Latvian State Geological Survey as a joint study on the impact of agriculture on groundwater quality in Latvia. Within the project "Interdisciplinary research groups and model system for groundwater studies" (PUMA) the studies of groundwater age by CFCs and 3H methods is continued. The concentration of tritium will be determined in about 60 samples, but the CFC concentration is now analyzed in 39 samples because previous studies have shown that Latvian CFC method is appropriate for aquifers to an average depth of 30-50 m. CFCs concentrations were analyzed in the laboratory at GEUS after Busenberg and Plummer described method by gas chromatography equipped with an EDC detector. Interpretation of the results was carried out by laboratory expert Troels Laier. Samples are taken on both from the unconfined aquifer and the first confined aquifer, the sampling interval varies from 5-10 m up to 120-130 m for tritium analysis and up to 80 m depth for most CFC analysis except one sample that comes from 128 m depth. It is stated that most of determined groundwater from both - confined and unconfined aquifer - has residence time of 35-55 years. So far, the results suggest that groundwater movement is fairly rapid in places where fractured dolomite forms the aquifer as the water residence time at 60-70 m depth is only 35-55 years. On the other hand, the composition of overlying Quaternary deposits (clay, glacial till loam or sand, sand - gravel sediments) has great importance on variations

  12. Release of CFC-11 from disposal of polyurethane foam waste

    DEFF Research Database (Denmark)

    Kjeldsen, Peter; Jensen, M.H.

    2001-01-01

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...

  13. CFC elimination and replacement in China; Elimination et remplacement des CFC en Chine

    Energy Technology Data Exchange (ETDEWEB)

    Bingfeng, Y.; Yezheng, W.; Zhigang, W. [School of Energy and Power Engineering, Xi' an Jiaotong University (China)

    2002-07-01

    This paper describes the position, policy and goals of the Chinese government with respect to the protection of the ozone layer and to the suppression of ozone-damaging compounds. It presents the implementation of the programs and the realizations relative to the elimination of CFCs and other ozone-damaging substances in domestic refrigerating appliances, in air conditioners for cars and in the solvent cleaning industry. It suggests some measures to answer the challenge of CFC replacement. (J.S.)

  14. Atmospheric Science and the CFC Industry

    Science.gov (United States)

    Steed, J. M.

    2012-12-01

    Industry involvement with developing atmospheric science and subsequent regulations to protect ozone was unusual. Chlorofluorocarbon manufacturers were research-based businesses accustomed to understanding the science behind product-related issues. When Lovelock's measurements in 1971 implied most of the cumulative production of CFCs remained in the atmosphere, global CFC producers funded academic research to identify natural sinks for the materials. The Fluorocarbon Program Panel (FPP) began in 1972, but changed focus to atmospheric photochemistry following Rowland and Molina's work in 1974. Despite early vociferous opposition, especially by the CFC-using aerosol industry, to any regulations, leaders among the producers worked to build their scientific understanding, expanding FPP funding and launching internal work in modeling and ozone trend analysis. The key first question for industry was not how much depletion might occur, but whether it would occur at all. If so, regardless of the amount, regulations and a major transition would be required in CFC-using industries, and the response would need to be global and prompt. So long as that basic question was in doubt, some businesses and countries would resist the economic cost of action. In the meantime, the producing industry worked to identify potential alternatives and to communicate atmospheric science to the downstream industries. Although the industry science effort was often disparaged as an attack on "real" science, my only assignment when I joined DuPont's Central Research Department in 1979 was to understand and contribute to the science, keeping both the company and our customers informed. Our modeling results were published freely. FPP funding led to better knowledge of the ClO + O rate constant, significantly increasing depletion in model calculations; supported the development of the techniques used to measure in situ atmospheric ClO, so important in later strengthening the case for chlorine

  15. CFC and HFC recycling equipments: Test performances

    International Nuclear Information System (INIS)

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid

  16. Construction of CFC-programs by LTL-specification

    Directory of Open Access Journals (Sweden)

    D. A. Ryabukhin

    2016-01-01

    Full Text Available This article continues a cycle of papers, which describe an approach to construction and verification of discrete PLC-programs by an LTL-specification. The approach provides a possibility of PLC-program correctness analysis by the model checking method. For the specification of the program behavior the linear-time temporal logic LTL is used. The correctness analysis of an LTL specification is performed automatically by the symbolic model checking tool Cadence SMV. Previously it was shown how ST-, LDand IL-programs are constructed by a correct (with verified program properties LTL-specification. In this article a technology of CFC-program construction by an LTL-specification is described. The language CFC (Continuous Function Chart is a variation of FBD (Function Block Diagram. FBD is a graphical language for microcircuits. CFC provides a possibility of free allocation of program components and connections on a screen. The approach to construction of CFC-programs is shown by an example. PLC-program representation on CFC within the approach to programming by LTL-specification differs from other representations. It gives the visualisation of a data flow from inputs to outputs. Influence and dependence between variables is explicitly shown during program execution within one PLC working cycle. In fact, CFC-program is a scheme of PLC-program data flow.

  17. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  18. CONTROL TECHNOLOGY OVERVIEW REPORT: CFC-11 EMISSIONS FROM FLEXIBLE POLYURETHANE FOAM MANUFACTURING

    Science.gov (United States)

    The report gives results of an engineering evaluation of technical options to reduce chlorofluorocarbon (CFC) emissions from flexible slabstock and molded polyurethane foam manufacturing plants. Among the technical options studied were recovery and recycle of CFC-11, alternative ...

  19. Nordic Seas and Arctic Ocean CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    E. Jeansson

    2010-02-01

    Full Text Available Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters have been retrieved from a large number of cruises and collected into a new database called CARINA (CARbon IN the Atlantic. These data have been merged into three sets of files, one for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS, the Atlantic (ATL and the Southern Ocean (SO. The first part of the CARINA database consists of three files, one for each CARINA region, containing the original, non-adjusted cruise data sets, including data quality flags for each measurement. These data have then been subject to rigorous quality control (QC in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the second part of the CARINA data product. This consists of three files, one for each CARINA region, which contain adjustments to the original data values based on recommendations from the CARINA QC procedures, along with calculated and interpolated values for some missing parameters.

    Here we present an overview of the QC of the CFC data for the AMS region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4. The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of data from some cruises, while other data were flagged to be of questionable quality, which excluded them from the final data product.

  20. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    Science.gov (United States)

    Tegtmeier, S.; Hegglin, M. I.; Anderson, J.; Funke, B.; Gille, J.; Jones, A.; Smith, L.; von Clarmann, T.; Walker, K. A.

    2016-02-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991-2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal structure. The CFC evaluations (based on MIPAS, ACE-FTS and HIRDLS) reveal that the uncertainty in our knowledge of the atmospheric CFC-11 and CFC-12 mean state, as given by satellite data sets, is smallest in the tropics and mid-latitudes at altitudes below 50 and 20 hPa, respectively, with a 1σ multi-instrument spread of up to ±5 %. For HF, the situation is reversed. The two available data sets (HALOE and ACE-FTS) agree well above 100 hPa, with a spread in this region of ±5 to ±10 %, while at altitudes below 100 hPa the HF annual mean state is less well known, with a spread ±30 % and larger. The atmospheric SF6 annual mean states derived from two satellite data sets (MIPAS and ACE-FTS) show only very small differences with a spread of less than ±5 % and often below ±2.5 %. While the overall agreement among the climatological data sets is very good for large parts of the upper troposphere and lower stratosphere (CFCs, SF6) or middle stratosphere (HF), individual discrepancies have been identified. Pronounced deviations between the instrument climatologies exist for particular atmospheric regions which differ from gas to gas. Notable features are differently shaped isopleths in the subtropics, deviations in the vertical gradients in the lower stratosphere and in the meridional gradients in the upper troposphere, and inconsistencies in the seasonal cycle. Additionally, long-term drifts between the instruments have been identified for the CFC-11 and CFC-12 time series. The evaluations as a

  1. CHARACTERIZATION OF H-Y AND CR-Y ZEOLITE CATALYSTS DURING THE OXIDATIVE DESTRUCTION OF CFC11 AND CFC12

    Science.gov (United States)

    The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...

  2. Overview of CFC replacement issues for household refrigeration

    Science.gov (United States)

    Vineyard, E. A.; Roke, L.; Hallett, F.

    In 1974, the famous ozone depletion theory of Rowland and Molina claimed that chlorofluorocarbons (CFCs) diffuse into the stratosphere where they are broken down by photolysis to release chlorine atoms that catalytically destroy ozone. Although the understanding of the science is still imperfect, there is little doubt that CFCs play a major role in the Antarctic ozone hole phenomenon and the decline in ozone observed in the rest of the world. Another issue that has become increasingly important is the potential of CFCs to change the earth's temperature and to modify the climate. While the main impact in global warming is made by increased concentrations of carbon dioxide, CFCs and other trace gases also contribute to this effect. In an effort to respond to the global environmental threat, a CFC protocol was adopted during a diplomatic conference in Montreal. This document, known as the Montreal Protocol, was ratified in 1988 and put into effect on January 1, 1989. In accordance with Article 6 of the Montreal Protocol, the countries that signed the agreement shall periodically assess the control measures provided for in the Protocol. As part of that assessment process, household refrigeration was investigated to determine the status of CFC-12 replacements. The conclusion was that much progress has been made towards finding a suitable replacement. Compressors designed for HFC-134a have efficiencies comparable to those for CFC-12 and acceptable reliability tests have been obtained with ester lubricants. In addition, other replacements such as R-152a and refrigerant mixtures exist, but will require more study. Cycle options, such as the Stirling cycle, may be viable, but are further out in the future. The impact of new refrigerants is expected to result in elimination of CFC-12 consumption in developed countries by 1997 and in developing countries by 2005.

  3. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2016-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) aboard the European satellite Envisat have been retrieved from versions MIPAS/4.61 to MIPAS/4.62 and MIPAS/5.02 to MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon-borne cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS-STRatospheric aircraft (MIPAS-STR), the satellite-borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS), as well as the ground-based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (full resolution, FR: July 2002-March 2004) and were used to validate MIPAS CFC-11 and CFC-12 products during that time, as well as profiles from the Improved Limb Atmospheric Spectrometer, ILAS-II. In general, we find that MIPAS shows slightly higher values for CFC-11 at the lower end of the profiles (below ˜ 15 km) and in a comparison of HATS ground-based data and MIPAS measurements at 3 km below the tropopause. Differences range from approximately 10 to 50 pptv ( ˜ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11 and is not as obvious in the relative differences between MIPAS and any of the comparison instruments. Differences at the lower end of the profile (below ˜ 15 km) and in

  4. EPA proposes CFC alternatives policy, ozone levels drop

    International Nuclear Information System (INIS)

    The Environmental Protection Agency has proposed its Significant New Alternatives Policy (SNAP), under which EPA will manage use of chlorofluorocarbon (CFC) substitutes. EPA also proposed a preliminary list of acceptable and unacceptable uses of CFC substitutes. Under SNAP, manufacturers or importers must notify EPA of the intent to sell, use, or distribute substitutes 90 days before introducing them into interstate commerce, and provide EPA with health and safety studies. EPA will determine eligibility for specific uses based on flammability, chemical toxicity, costs, global warming potential, and environmental and occupational exposures. Hydrochlorofluorocarbon (HCFC)-141b was targeted by EPA for restrictions in some applications involving polyurethane foams and solvent systems. Acceptable HCFC-141b uses include foams for insulation and flotation rigid polyurethane. HCFC-141b makers say the rule making does not come as a surprise. Elf Atochem says it has been working with EPA on the alternatives policy for the past two years and has steered away from unacceptable uses. Allied-Signal also says it has considered the limitations. Even while EPA plotted the management of CFC substitutes, there was further bad news on the stratospheric ozone layer. Government scientists at the National Aeronautics and Space Administrations's (NASA) Goddard Space Flight Center (Greenbelt, MD) say global ozone levels were 2%-3% lower in the second half of 1992 than at any previous time and that mid-latitudes Northern Hemisphere levels dropped 13%-14% below normal in January. Separately, NASA and Jet Propulsion Laboratory researchers report satellite measurements finding chlorine monoxide-a key villain in ozone destruction-in alarmingly high levels in the Arctic stratosphere. The NSA/JPL measurements-which had not been done before-are open-quote very soberingclose quotes, says Joe Waters, a JPL scientist

  5. Materials compatibility and lubricants research on CFC-refrigerant substitutes

    Science.gov (United States)

    Szymurski, S. R.; Hawley, M.; Hourahan, G. C.; Godwin, D. S.

    1994-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  6. High heat flux testing of CFC composites for the tokamak physics experiment

    Science.gov (United States)

    Valentine, P. G.; Nygren, R. E.; Burns, R. W.; Rocket, P. D.; Colleraine, A. P.; Lederich, R. J.; Bradley, J. T.

    1996-10-01

    High heat flux (HHF) testing of carbon fiber reinforced carbon composites (CFC's) was conducted under the General Atomics program to develop plasma-facing components (PFC's) for Princeton Plasma Physics Laboratory's tokamak physics experiment (TPX). As part of the process of selecting TPX CFC materials, a series of HHF tests were conducted with the 30 kW electron beam test system (EBTS) facility at Sandia National Laboratories, and with the plasma disruption simulator I (PLADIS-I) facility at the University of New Mexico. The purpose of the tests was to make assessments of the thermal performance and erosion behavior of CFC materials. Tests were conducted with 42 different CFC materials. In general, the CFC materials withstood the rapid thermal pulse environments without fracturing, delaminating, or degrading in a non-uniform manner; significant differences in thermal performance, erosion behavior, vapor evolution, etc. were observed and preliminary findings are presented below. The CFC's exposed to the hydrogen plasma pulses in PLADIS-I exhibited greater erosion rates than the CFC materials exposed to the electron-beam pulses in EBTS. The results obtained support the continued consideration of a variety of CFC composites for TPX PFC components.

  7. Prediction of future disposal of end-of-life refrigerators containing CFC-11.

    Science.gov (United States)

    Yazici, Burcu; Can, Zehra S; Calli, Baris

    2014-01-01

    The objective of this study was to predict the number of refrigerators containing CFC-11 blown isolation foam and the amount of CFC-11 banked in these refrigerators. By using a Weibull-based survival function, the number of CFC-11 containing and still-functioning refrigerators was estimated to be approximately 1.6 million in 2013 in Turkey. In order to determine the amount of CFC-11 in the isolation foam of these refrigerators, polyurethane (PU) foam samples were taken from a refrigerator manufactured in 1993 and the quantity of CFC-11 was analyzed by a GC-MS. It was determined that 113-195 mg CFC-11/g PU remains in the PU foam depending on the location such as door, sides, top and bottom. Knowing that a mid-sized refrigerator contains 4 kg PU on average, the total amount of PU foam to be disposed of is 6344 tons when the CFC-11 containing refrigerators in Turkey become obsolete in the near future. Furthermore, 717-1237 tons of CFC-11 are expected to be banked in the PU foam of these refrigerators which will exert an equivalent amount of ozone depleting potential (ODP). In addition, the global warming potential will vary between 3.4 and 5.9 million tons of CO2. PMID:24112854

  8. Energy and global warming impacts of CFC alternative technologies

    International Nuclear Information System (INIS)

    The primary objective of this study is to develop representative indications of the relative energy use, associated CO2 emissions, and total equivalent warming impact (TEWI) of viable options to replace CFCs in their major energy-related application areas. It was motivated, in part, by a concern that most attention to date has focused on the DIRECT global warming effect of CFC's and their alternatives, with adequate attention being paid to the INDIRECT effect of the CO2 emissions arising from the differences in energy consumption by systems using different alternatives. The DIRECT and INDIRECT contributions are combined in this analysis to determine the TEWI of the various technical options. The study is international in scope and takes into account significant differences in present CFC end-use practices, sources of energy, and other societal factors between Europe, Japan, and North America. This study should be considered an overview of key issues. The analysis addressed CFCs as well as alternative chemicals and technology alternatives in uses such as refrigeration, foam insulation, and metal and electronic cleaning and drying processes

  9. Assessing the applicability of global CFC and SF6 input functions to groundwater dating in Britain

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) and sulphur hexafluoride (SF6) are increasingly being used to date groundwaters. While these trace gases are generally well-mixed in the atmosphere, local atmospheric excesses (LAEs) have been found in some parts of the world, thereby affecting the interpretation of data from groundwater studies. To investigate the possibility of LAEs in Britain, mixing ratios of CFC-11, CFC-12 and SF6 were measured in soil gases from two large conurbations (London and Birmingham) and a smaller urban area, Bristol. Most mixing ratios for CFC-12 and SF6 were 6 input functions based on the NH-AMR curves appears justified for Britain. (author)

  10. CFC and HFC recycling equipments: Test performances; Qualificazione di dispositivi per il riciclaggio dei CFC e degli HFC

    Energy Technology Data Exchange (ETDEWEB)

    Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Pallotti, P. [ICF, Industria Componenti Frigoriferi Srl, Bologna (Italy)

    1996-12-01

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid.

  11. International symposium on environmental impacts of advanced alternative to CFC; CFC shinki daitai busshitsu no kankyo eikyo ni kansuru kokusai symposium hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-07

    The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.

  12. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  13. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  14. Dating groundwater with trifluoromethyl sulfurpentafluoride (SF 5CF3), sulfur hexafluoride (SF6), CF 3Cl (CFC-13), and CF2Cl2 (CFC-12)

    Science.gov (United States)

    Busenberg, E.; Plummer, L.N.

    2008-01-01

    [1] A new groundwater dating procedure using the transient atmospheric signal of the environmental tracers SF5CF3, CFC-13, SF6, and CFC-12 was developed. The analytical procedure determines concentrations of the four tracers in air and water samples. SF 5CF3 and CFC-13 can be used to date groundwaters in some environments where the CFCs and SF6 have previously failed because these new tracers have increasing atmospheric input functions, no known terrigenic source, and are believed to be stable under reducing conditions. SF5CF3 has a dating range from 1970 to modern; the mixing ratio (mole fraction) in North American air has increased from the detection limit of 0.005 parts per trillion (ppt) to the 2006 mole fraction of about 0.16 ppt. No evidence was found for degradation of SF5CF3 in laboratory anaerobic systems. The solubility of SF5CF3 was measured in water from 1 to 35??C. Groundwater samples that contained large amounts of terrigenic SF6 did not contain terrigenic SF 5CF3. CFC-13 is a trace atmospheric gas with a dating range in groundwater of about 1965 to modem. CFC-13 has been used primarily in very low-temperature refrigeration; thus groundwater environments are less likely to be contaminated with nonatmospheric sources as compared to other widely used CFCs. Because of the low solubility of SF5CF3 and CFC-13 in water, an excess air correction must be applied to the apparent ages. The new dating procedure was tested in water samples from wells and springs from Maryland, Virginia, and West Virginia.

  15. Formulation and evaluation of CFC free inhalers for beclomethasone dipropionate

    Directory of Open Access Journals (Sweden)

    Gopala Krishna Murthy Talasila

    2013-06-01

    Full Text Available Beclomethasone dipropionate CFC free inhalation formulations were developed with a view to treat asthma prophylactically. Dry powder inhalers (DPI for beclomethasone dipropionate were prepared with different grades of lactose monohydrate. The influence of carrier and overages on performance of DPI was studied. Metered dose inhalers (MDI with HFA based propellants were formulated with various doses, overages and different concentrations of alcohol. Formulated DPI and MDI were evaluated for various official and unofficial quality control tests. The influence of over doses on valve delivery, effect of overages on emitted dose and influence of alcohol on spray pattern from MDI were studied. The better fine particle fraction and emitted dose were obtained from the DPI formulated with 10:90 ratio of fine lactose: coarse lactose and with 20% w/w overages. The studies on MDI revealed that the 15% of overdoses are required for effective valve delivery and 20% overages are required for 100% drug delivery. 5-10%v/v alcohol was found to be preferable to get optimum emitted dose and fine particle fraction.

  16. Measurements of the Surface Tension for CFC Alternatives

    Science.gov (United States)

    Higashi, Yukihiro; Ikeda, Tadamitsu; Kuwana, Takeaki; Okada, Masaaki

    Measurements of the surface tension for two kinds of CFC alternatives, i.e., HCFC-123 (2,2-dichloro-1,1,1-trifluoroethane), and HFC-134a (1,1,1,2-tetrafluoroethane), have been made by the differential capillary rise method (DCRM) and the vertical plate method (VPM). For HCFC-123, 15 data have been obtained by DCRM in the temperature range between 273 and 333 K within the uncertainty of ±0.1mN/m, and 21 data have been obtained by VPM in the temperature range between 273 and 290 K within the uncertainty of ±0.2mN/m. For HFC-134a, 17 data have been obtained by DCRM in the temperature range between 276 and 329 K within the uncertainty of ±0.1mN/m. The uncertainty of temperature measurement by DCRM is estimated within ±20mK, whereas that by VPM within ±30mK. New correlations of the surface tension for HCFC-123 and HFC-134a have been also proposed.

  17. National action plan for recovery, recycling and reclamation of chlorofluorocarbons (CFC's); Part 2. Piano operativo nazionale per il recupero, il riciclaggio, il trattamento dei clorofluorocarburi (CFC); Parte 2

    Energy Technology Data Exchange (ETDEWEB)

    Relevant to the development of a plan for the recovery, recycling and reclamation of chlorofluorocarbons (CFC's), this paper tables a list of operating task activities and recommendations. They include: the creation of incentives for CFC recovery and recycling; the setting up of a recovered materials monitoring system; the drafting up of emission limits; information dissemination for greater public awareness; collaboration with owners and builders of plants using CFC's; development of suitable waste management and disposal procedures for CFC residuals.

  18. Infrared Absorption Spectra, Radiative Efficiencies, and Global Warming Potentials of Newly-Detected Halogenated Compounds: CFC-113a, CFC-112 and HCFC-133a

    Directory of Open Access Journals (Sweden)

    Maryam Etminan

    2014-07-01

    Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.

  19. SIMULATION OF PERFORMANCE OF CHLORINE-FREE FLURORINATED ETHERS AND FLUORINATED HYDROCARBONS TO REPLACE CFC-11 AND CFC-114 IN CHILLERS

    Science.gov (United States)

    The paper discusses simulation of the performance of chlorine-free fluorinated ethers and fluorinated hydrocarbons as potential long-term replacements for CFC-11 and -114. Modeling has been done with in-house refrigeration models based on the Carnahan-Starling-DeSantis Equation o...

  20. Evidence of CFC degradation in groundwater under pyrite-oxidizing conditions

    Science.gov (United States)

    Sebol, L.A.; Robertson, W.D.; Busenberg, E.; Plummer, L.N.; Ryan, M.C.; Schiff, S.L.

    2007-01-01

    A detailed local-scale monitoring network was used to assess CFC distribution in an unconfined sand aquifer in southwestern Ontario where the zone of 1-5-year-old groundwater was known with certainty because of prior use of a bromide tracer. Groundwater ???5 years old was confined to an aerobic zone at ???5 m depth and had CFC concentrations consistent with modern atmospheric mixing ratios at recharge temperatures of 7-11 ??C, as was observed in the 3-m thick vadose zone at the site. At depths below 6 m, the groundwater became progressively more reducing, however, with a denitrifying horizon at 6-7 m depth, and a Mn and Fe reducing zone below 7 m depth. In the anaerobic zone, 3H/3He ratios indicated that groundwater-age continued to increase uniformly with depth, to a maximum value of 27 years at 13 m depth. CFC concentrations, however, decreased abruptly within the denitrifying zone, leading to substantial age overestimation compared to the 3H/3He ages. Noble gas data indicated that the apparent CFC mass loss was not likely the result of gas stripping from possible bubble formation; thus, CFC degradation was indicated in the anoxic zone. The field data are consistent with first-order degradation rates of 0.3 yr-1 for CFC-12, 0.7 yr-1 for CFC-11, and 1.6 yr-1 for CFC-113. CFC attenuation at this site coincides with a zone where reduced S (pyrite) is actively oxidized by NO3 and dissolved oxygen (DO). Similar behavior has been observed at other sites [Tesoriero, A.J., Liebscher, H., Cox, S.E., 2000. Mechanism and rate of denitrification in an agricultural watershed: electron and mass balance along groundwater flow path. Water Resour. Res. 36 (6), 1545-1559; Hinsby, K., Hojberg, A.L., Engesgaard, P., Jensen, K.H., Larsen, F., Plummer, L.N., Busenberg, E., Accepted for publication. Transport and degradation of chlorofluorocarbons (CFCs) in a pyritic aquifer, Rabis Creek, Denmark. Water Resour. Res.], further demonstrating that the use of CFCs for age-dating anaerobic

  1. Surface damage characteristics of CFC and tungsten with repetitive ELM-like pulsed plasma irradiation

    Science.gov (United States)

    Kikuchi, Y.; Nishijima, D.; Nakatsuka, M.; Ando, K.; Higashi, T.; Ueno, Y.; Ishihara, M.; Shoda, K.; Nagata, M.; Kawai, T.; Ueda, Y.; Fukumoto, N.; Doerner, R. P.

    2011-08-01

    Surface damage of carbon fiber composite (CFC) and tungsten (W) due to repetitive ELM-like pulsed plasma irradiation has been investigated by using a magnetized coaxial plasma gun. CX2002U CFC and stress-relieved W samples were exposed to repetitive pulsed deuterium plasmas with duration of ˜0.5 ms, incident ion energy of ˜30 eV, and surface absorbed energy density of ˜0.3-0.7 MJ/m2. Bright spots on a CFC surface during pulsed plasma exposures were clearly observed with a high-speed camera, indicating a local surface heating. No melting of a W surface was observed under a single plasma pulse exposure at energy density of ˜0.7 MJ/m2, although cracks were formed. Cracking of the W surface grew with repetitive pulsed plasma exposures. Subsequently, the surface melted due to localized heat absorption.

  2. High RF power test of a CFC antenna module for lower hybrid current drive

    International Nuclear Information System (INIS)

    A mock-up of a 3.7 GHz Lower Hybrid Current Drive (LHCD) antenna module was fabricated from Carbon Fibre Composite (CFC) for the development of heat resistive low Z front facing the plasma. This 2 divided waveguide module is made from CFC plates and rods which are Cu-plated to reduce the RF losses. The withstand-voltage, the RF properties and the outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. A reference module made from Dispersion Strengthened Copper (DSC) was also fabricated. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m2 were performed with no breakdowns on the CFC module. It was also checked that the highest power density, up to 150 MW/m2, could be transmitted when the waveguides are filled with H2 at a pressure of 5 x 10-2 Pa. During a long pulse, the power reflection coefficient remains low in the 0.8-1.3 % range and no significant change in the reflection coefficient is measured after the thermal cycling provided by the long pulse operation. From thermocouple measurements, RF losses of the copper coated CFC and the DSC modules were compared. No significant differences were measured. From pressure measurements, it was found that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of DSC at 300 deg.C. It is concluded that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)

  3. Catalytic hydrolysis of CFC-12 over solid acid Ti(SO4)2

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The catalytic hydrolysis of dichlorodifluoromethane (CFC-12) was investigated over solid acid Ti(SO4)2. The catalytic activity decreased with the calcination temperature. When space velocity was 6 l h-1 g-cat-1, the CFC-12 conversion at 310oC over Ti(SO4)2 calcined at 350oC remained about 98.5% during 360 h on stream, and the selectivity to by-products remained zero. The findings enlarged the scope of traditional catalyst systems for the CFCs decomposition.

  4. Model in simuliranje delovanja odprtega hladilnega postopka brez uporabe CFC: Design and simulation of a CFC-free open air-conditioning system:

    OpenAIRE

    Stritih, Uroš; Novak, Peter; Može, Mitja

    2001-01-01

    In this paper a model is presented and its operation of a cooling process that uses air-as the cooling medium. In the introduction, conventional refrigerants are compared with an alternative refrigerant - air. The system construction and the thermodynamic model are presented. The model is used to study the performance of a CFC-free air-conditioning system, in which some parameters of the individual components are variable while the others are constant for the referenced data. The characterist...

  5. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  6. Tensile fracture characterization of braze joined copper-to-CFC coupon assemblies

    Science.gov (United States)

    Trester, P. W.; Valentine, P. G.; Johnson, W. R.; Chin, E.; Reis, E. E.; Colleraine, A. P.

    1996-10-01

    A vacuum brazing process was used to join a broad spectrum of carbon-fiber reinforced carbon matrix composite (CFC) materials, machined into cylindrical coupons, between coupons of oxygen-free copper, the braze alloy was a copper-base alloy which contained only low activation elements (Al, Si, and Ti) relative to a titanium baseline specification. This demonstration was of particular importance for plasma facing components (PFCs) under design for use in the Tokamak Physics Experiment (TPX); the braze investigation was conducted by General Atomics for the Princeton Plasma Physics Laboratory. A tensile test of each brazed assembly was conducted. The results from the braze processing, testing, and fracture characterization studies of this reporting support the use of CFC's of varied fiber architecture and matrix processing in PFC designs for TPX. Further, the copper braze alloy investigated is now considered to be a viable candidate for a low-activation bond design. The prediction of plasma disruption-induced loads on the PFCs in TPX requires that joint strength between CFC tiles and their copper substrate be considered in design analysis and CFC selection.

  7. On the accuracy of the IWM-CFC approximation in differentially rotating relativistic stars

    CERN Document Server

    Iosif, Panagiotis

    2014-01-01

    We determine the accuracy of the conformal flatness (IWM-CFC) approximation for the case of single, but strongly differentially rotating relativistic stars. We find that for the fastest rotating and most relativistic polytropic models, the deviation from full general relativity is below 5% for integrated quantities and below 10% for local quantities, such as the angular velocity. Furthermore, we study the deviation of the IWM-CFC approximation from full general relativity by evaluating and comparing different error indicators. We find that for the models that are not near the maximum mass, a simple error indicator constructed from local values of the metric potentials is more indicative of the accuracy of the IWM-CFC approximation than an error indicator that is based on the Cotton-York tensor. Furthermore, we construct a simple, linear empirical relation that allows for the estimation of the error made by the IWM-CFC approximation and which only involves the flattening of the star due to rotation and the min...

  8. Research on interactions of plasma streams with CFC targets in the Rod Plasma Injector facility

    Directory of Open Access Journals (Sweden)

    Zaloga Dobromil R.

    2016-06-01

    Full Text Available This paper present results of optical spectroscopy studies of interactions of intense plasma streams with a solid target made of carbon fibre composite (CFC. The experiments were carried out within the Rod Plasma Injector (RPI IBIS facility. The optical measurements were performed first for a freely propagating plasma stream in order to determine the optimal operational parameters of this facility. Optical emission spectra (OES were recorded for different operational modes of the RPI IBIS device, and spectral lines were identified originating from the working gas (deuterium as well as some lines from the electrode material (molybdenum. Subsequently, optical measurements of plasma interacting with the CFC target were performed. In the optical spectra recorded with the irradiated CFC samples, in addition to deuterium and molybdenum lines, many carbon lines, which enabled to estimate erosion of the investigated targets, were recorded. In order to study changes in the irradiated CFC samples, their surfaces were analysed (before and after several plasma discharges by means of scanning electron microscope (SEM and energy dispersive spectroscopy (EDS techniques. The analysis of the obtained SEM images showed that the plasma irradiation induces noticeable changes in the surface morphology, for example vaporisation of some carbon fibres and formation of microcracks. The obtained EDS images showed that upon the irradiated target surface, some impurity ions are also deposited, particularly molybdenum ions from the applied electrodes.

  9. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  10. Global warming impacts of CFC alternative technologies: Combining fluorocarbon and CO2 effects

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) are on their way out, due to their role in stratospheric ozone depletion and the related international Montreal Protocol agreement and various national phaseout timetables. As the research, engineering development, and manufacturing investment decisions have ensued to prepare for this transition away from CFCs, the climate change issue has emerged and there has recently been increased attention on the direct global warming potential (GWP) of the fluorocarbon alternatives as greenhouse gases. However, there has been less focus on the indirect global warming effect arising from end-use energy changes and associated CO2 emissions. A study was undertaken to address these combined global warming effects. A concept of Total Equivalent Warming Impact (TEWI) was developed for combining the direct and indirect effects and was used for evaluating CFC-replacement options available in the required CFC transition time frame. Analyses of industry technology surveys indicate that CFC-user industries have made substantial progress toward near-equal energy efficiency with many HCFC/HFC alternatives. The findings also bring into question the relative importance of the direct effect in many applications and stress energy efficiency when searching for suitable CFC alternatives. For chillers, household refrigerators, and unitary air-conditioning or heat pump equipment, changes in efficiency of only 2--5% would have a greater effect on future TEWI than completely eliminating the direct effect

  11. Study on the Trend of CFC-113 in the Atmosphere of Shanghai Region%上海地区大气中CFC-113的变化趋势研究

    Institute of Scientific and Technical Information of China (English)

    吴力波; 陈立民; 杨越; 沈轶; 孙国忠

    2000-01-01

    As the main ozone-depleting compound, the abundance of CFC-113 in the troposphere has been widely concerned by scientists. The monitoring, which has been performed since 1997 in Shanghai region, indicates a declining trend in CFC-113 abundance.Further more it shows that both release and production of CFC-113 in Shanghai region still remain low in absolute amount.%作为主要的臭氧层耗竭物质CFC-113,在对流层大气中的浓度,受到科学家的广泛关注.从1997年起,对上海地区CFC-113进行分析研究的结果表明,上海地区CFC-113的浓度呈下降趋势.另从绝对数量来看,上海地区CFC-113的生产量和排放量仍然处于较低的水平.

  12. The Effect of Diapycnal Mixing on the Ventilation and CFC-11 Uptake in the Southern Ocean

    Institute of Scientific and Technical Information of China (English)

    Yongqi GAO; Helge DRANGE

    2004-01-01

    The Miami Isopycnic Coordinate Ocean Model (MICOM) is used to investigate the effect of diapycnal mixing on the oceanic uptake of CFC-11 and the ventilation of the surface waters in the Southern Ocean (south of 45°S). Three model experiments are performed: one with a diapycnal mixing coefficient Kd (m2 s-1) of 2 × 10-7/N (Expt. 1), one with Kd = 0 (Expt. 2), and one with Kd = 5 × 10-8/N (Expt. 3), N (s-1) is the Brunt-Vaisala frequency. The model simulations indicate that the observed vertical distribution of CFC-11 along 88°W (prime meridian at 0°E) in the Southern Ocean is caused by local ventilation of the surface waters and westward-directed (eastward-directed) isopycnic transport and mixing from deeply ventilated waters in the Weddell Sea region. It is found that at the end of 1997, the simulated net ocean uptake of CFC-11 in Expt. 2 is 25% below that of Expt. 1. The decreased uptake of CFC-11 in the Southern Ocean accounts for 80% of this difference. Furthermore, Expts. 2 and 3 yield far more realistic vertical distributions of the ventilated CFC-waters than Expt. 1. The experiments clearly highlight the sensitivity of the Southern Ocean surface water ventilation to the distribution and thickness of the simulated mixed layer. It is argued that inclusion of CFCs in coupled climate models could be used as a test-bed for evaluating the decadal-scale ocean uptake of heat and CO2.

  13. CFC substitutes. Substitute refrigerants and technologies in refrigeration engineering. Ersatzstoffe fuer FCKW. Ersatzkaeltemittel und Ersatztechnologien in der Kaeltetechnik

    Energy Technology Data Exchange (ETDEWEB)

    Hesse, U. (Forschungszentrum fuer Kaeltetechnik und Waermepumpen GmbH, Hannover (Germany)); Dietrich, K. (Bayer AG, Leverkusen (Germany)); Kauffeld, M.; Rinne, F. (Hannover Univ. (Germany). Inst. fuer Kaeltetechnik); Preisegger, E. (Hoechst AG, Frankfurt am Main (Germany)); Schwarz, J. (ZEO-TECH GmbH, Muenchen (Germany)); Kern, H.

    1992-01-01

    The CFC problem, i.e. ozone depletion and greenhouse effect, is the main problem in refrigeration engineering today. The ban on CFC has made it necessary to act, even before a general solution to the problem has been found. The book goes into detail on CFC substitutes development, testing, and application, as well as on alternative technologies and possible future developments. Safety aspects are considered for all materials and techniques. Contents: Fundamentals, development so far, restrictions - substitutes on the basis of partly halogenated hydrocarbons - ammonia as a substitute in refrigeration systems - safety aspects in the application of refrigerants and CFC substitutes - refrigerant mixtures as substitutes - sorption systems - cold air processes - further alternative substances and processes - future prospects. (orig.) With 125 figs., 108 refs.

  14. Relative abundance estimations of chengal tree in a tropical rainforest by using modified Canopy Fractional Cover (mCFC)

    International Nuclear Information System (INIS)

    Tree species composition estimations are important to sustain forest management. This study challenged estimates of relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of trees species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying trees species composition

  15. Relative abundance estimations of Chengal trees in a tropical rainforest by using modified canopy fractional cover (mCFC)

    International Nuclear Information System (INIS)

    Tree species composition estimations are important to sustain forest management. This study estimates relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of tree species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying tree species composition

  16. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  17. Subtractive hybridization identifies chick-cripto, a novel EGF-CFC ortholog expressed during gastrulation, neurulation and early cardiogenesis.

    Science.gov (United States)

    Colas, J F; Schoenwolf, G C

    2000-09-19

    EGF-CFC genes encode a novel class of extracellular, membrane-associated proteins that notably play an important role during vertebrate gastrulation. Whereas the two cysteine-rich domains that characterize these proteins, namely the extracellular EGF-like and the CFC domain, are known to be encoded by two evolutionarily conserved exons, it is generally assumed, based on weak primary sequence identity, that the remaining parts of the protein differ among vertebrates, suggesting that known members of the EGF-CFC family do not represent true orthologs. Here, by characterizing the full cDNA and genomic sequences of a new EGF-CFC gene in chick, and by comparing them with their counterparts in human (CRIPTO), mouse (cripto and cryptic), Xenopus (FRL-1) and zebrafish (one-eyed pinhead), we show that all EGF-CFC genes share an identical genomic organization over the entire coding region. Not only are the central two exons (coding for the EGF-like and CFC motifs) conserved, but also conserved are the total number of exons, their size, their intron phase and their correlation with discrete protein modules, in particular those modules that allow the EGF-CFC motif to become membrane-associated. Therefore, despite apparent divergence between their 5' and 3'-terminal exons, all known CRIPTO-related genes are structurally orthologous. We named this novel ortholog in bird, chick-cripto. We report the mRNA distribution of chick-cripto, which begins in the epiblast of the gastrula, with a pattern similar to EGF-CFC genes of other vertebrates.

  18. Leak monitoring for CFC's, HCFC's, HFC's and oxygen depletion: Recent developments

    International Nuclear Information System (INIS)

    The implementation of the Montreal Protocol and Title VI of the Clean Air Act of 1990 are having significant effects on the supply and cost of halocarbon refrigerants. In the US, there will be no new CFC's produced after 1995. Conservation measures which include recovery and recycling are enhanced by continuous monitoring for leaks in refrigeration systems. Some of the non-ozone depleting substitutes for CFC's have toxicity and flammability properties which require continuous monitoring for health and safety. Both economic and safety considerations have led to an increased use of monitoring instruments for halocarbon refrigerant emissions. Halocarbon refrigerants are colorless, odorless and, in general, boil at or below room temperature. In addition, they are high molecular weight compounds with vapor densities three to five times that of air. When refrigerants escape from closed systems, they can be expected to settle into low lying areas (in the absence of air movement)

  19. CFC substitutes for refrigeration engineering. FCKW-Substitute fuer die Kaeltetechnik

    Energy Technology Data Exchange (ETDEWEB)

    Henrici, R. (Hoechst AG, Forschung und Entwicklung Chemikalien, Frankfurt am Main (Germany))

    1993-12-01

    The international attempts ot protect the earth atmosphere have accelerated the world-wide search for CFC substitutes. Enormous efforts have been undertaken in the last few years to solve the problems occurring with new refrigerants and to find suitable lubricants. The article discusses the following subjects: Requirements on future refrigerants, effects on the ''greenhouse problem'', toxicological properties, problems in practical application, trends of development, refrigerant mixtures, conversion of older plants, recycling of refrigerants. (SR)

  20. Replacement of CFCs in thermodynamical systems; Remplacement des C.F.C. dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    Fleurance, M.

    1996-12-31

    Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)

  1. Manufacturing and testing of a copper/CFC divertor mock-up for JET

    International Nuclear Information System (INIS)

    An actively cooled divertor is a possible option for future developments at The Joint European Torus (JET). A proof of principle actively cooled tile has been produced in order to qualify the relevant manufacturing technologies and the non destructive control processes. In this frame Ansaldo Ricerche (ARI) has been involved in the construction of a mock-up comprising 6 OFHC copper tubes for water cooling that are brazed to a plate made out of carbon fibre composite (CFC). The final objective was the high heat flux testing of the mock-up at JET in order to evaluate the general behaviour of the component under relevant operating conditions. The key point of the work was the realisation of a sound joint by adapting the expertise gained in ARI in previous R and D activities on brazing heterogeneous materials. Reliable methods for ultrasonic examinations of the pieces were also set up. For successful application to the JET pumped divertor a water-cooled CFC target plate must show surface temperatures of 2. Furthermore, global hydraulic considerations specific to JET limit the system pressure to 0.7 MPa. In such a design, critical heat flux is not the key limit, rather the reliability of the CFC-copper joint in terms of extent of wetting. First tests in the neutral beam test bed at JET show an adequate response for fluxes up to 15 MW/m2. (orig.)

  2. Issues and recommendations related to replacement of CFC-114 at the uranium enrichment gaseous diffusion plant

    International Nuclear Information System (INIS)

    The operating uranium enrichment gaseous diffusion plants (GDPs) in Portsmouth, Ohio and Paducah, Kentucky, which are operated for the United States Department for Energy by Martin Marietta Energy Systems (MMES), currently use a chlorofluorocarbon (CFC-114) as the primary process stream coolant. Due to recent legislation embodied in the Clean Air Act, the production of this and other related chlorofluorocarbons (CFCS) are to be phased out with no production occurring after 1995. Since the plants lose approximately 500,000 pounds per year of this process stream coolant through various leaks, the GDPs are faced with the challenge of identifying a replacement coolant that will allow continued operation of the plants. MMES formed the CFC Task Team to identify and solve the various problems associated with identifying and implementing a replacement coolant. This report includes a review of the work performed by the CFC Task Team, and recommendations that were formulated based on this review and upon original work. The topics covered include; identifying a replacement coolant, coolant leak detection and repair efforts, coolant safety concerns, coolant level sensors, regulatory issues, and an analytical decision analysis

  3. CFC-11 destruction by microwave torch generated atmospheric-pressure nitrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Jasinski, Mariusz; Mizeraczyk, Jerzy; Zakrzewski, Zenon [Centre for Plasma and Laser Engineering, Institute of Fluid Flow Machinery, Polish Academy of Sciences, Gdansk (Poland); Ohkubo, Toshikazu [Department of Electrical and Electronic Engineering, Oita University, Oita (Japan); Chang Jenshih [Department of Engineering Physics, McMaster University, Hamilton, ON (Canada)

    2002-09-21

    A novel plasma method and its application for destruction of Freons using a moderate-power (several hundred watts) microwave torch discharge (MTD) in atmospheric-pressure flowing nitrogen are presented. The capability of the MTD to decompose Freons is demonstrated using a chlorofluorocarbon CCl{sub 3}F (Freon CFC-11) as an example. The gas flow rate and microwave power (2.45 GHz) delivered to the MTD were 1-3 litre min{sup -1} and 200-400 W, respectively. Concentration of the CFC-11 in the nitrogen was up to 50%. The results show that the decomposition efficiency of CFC-11 is up to 100% with the removal rate of several hundred g h{sup -1} and energy efficiency of about 1 kg kWh{sup -1}. This impressive performance, superior to that of other methods, is achieved without generating any significant unwanted by-products. As a result of this investigation, a relatively low-cost prototype system for Freon destruction based on a moderate-power MTD and a scrubber is proposed. (author)

  4. Effects of acoustic hood on noise, CFC-11, and particulate matter in a recycling system for waste refrigerator cabinet.

    Science.gov (United States)

    Guo, Jie; Fang, Wenxiong; Yang, Yichen; Xu, Zhenming

    2014-11-01

    The mechanical-physical process was proven to be technologically feasible for waste refrigerator recycling and has been widely used in the typical e-waste recycling factories in China. In this study, effects of the acoustic hood on the reduction of noise level, CFC-11, and heavy metals (Cr, Ni, Cu, Cd, and Pb) in particulate matter (PM) were evaluated. For noise pollution, the noise level inside and outside the acoustic hood was 96.4 and 78.9 dB, respectively. Meanwhile, it had a significant effect on A-weighted sound level with a reduction from 98.3 to 63.6 dB. For CFC-11 exposure, abundant CFC-11 (255 mg/m(3)) was detected in the acoustic hood. However, the mean concentration of CFC-11 at the outline of polyurethane foam collection was obviously diminished to 14 mg/m(3), and no CFC-11 was monitored around the acoustic hood. The concentrations of PM and heavy metals in PM outside the acoustic hood were lower than those inside the acoustic hood due to the physical barriers of the acoustic hood. Based on the risk assessment, only adverse health effect caused by Pb might likely appear. All the results can provide the basic data for pollution control and risk assessment in waste refrigerator recycling system. PMID:24965005

  5. National action plan for recovery, recycling and reclamation of chlorofluorocarbons (CFC's); Part 1. Piano operativo nazionale per il recupero, il riciclaggio, il trattamento dei clorofluorocarburi (CFC); Parte prima

    Energy Technology Data Exchange (ETDEWEB)

    1993-02-01

    This report develops a plan for the recovery recycling, and reclamation of chlorofluorocarbons (CFC's) for reuse in Canada to ensure that the large consumer and marketplace inventory of these compounds does not enter the atmosphere. Reuse is further necessary for future operation of equipment when the production and importation of CFC's becomes severely restricted or is eliminated. The report also deals with the need to recover hydrochlorofluorocarbons (HCFC's) for reuse. A harmonized national action plan containing a set of agreed-upon objectives and tasks is developed to provide a basis for federal and provincial programs, regulatory action, and data development.

  6. CFCl3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime Uncertainty

    Science.gov (United States)

    McGillen, M.; Fleming, E. L.; Jackman, C. H.; Burkholder, J. B.

    2013-12-01

    CFCl3 (CFC-11) is both a major ozone-depleting substance and a potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95-230 nm) and temperature (216-296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using the NASA Goddard Space Flight Center 2-D coupled chemistry-radiation-dynamics model and the spectrum parameterization developed in this work. The modeled global annually averaged lifetime was 58.1 × 0.7 years (2σ uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current UV spectrum recommendations. CFCl 3 (CFC-11) 2-D model results: Left: Global annually averaged loss rate coefficient (local lifetime) and photolysis and reaction contributions (see legend). Middle: Molecular loss rate and uncertainty limits; the slow and fast profiles were calculated using the 2σ uncertainty estimates in the CFC-11 UV absorption spectrum from this work. Right: CFC-11 concentration profile. CFC-11 loss process contribution to the overall local lifetime uncertainty (2σ) calculated using the 2-D model (see text). Left: Results obtained from this work. Right: Results obtained using model input from Sander et al. [2011] and updates in SPARC [2013].

  7. Behaviour of Silicon-Doped CFC Limiter under High Heat Load in TEXTOR-94

    Science.gov (United States)

    Huber, A.; Philipps, V.; Hirai, T.; Kirschner, A.; Lehnen, M.; Pospieszczyk, A.; Schweer, B.; Sergienko, G.

    In order to study the impurity production, recycling and power deposition a Si doped CFC test limiter (NS31) was used in TEXTOR-94. The release of impurities (C, Si, O, Cr, CD radicals) was measured spectroscopically. A reduced methane production was found in the Si doped graphite when compared to a pure graphite limiter. A smaller decrease of the carbon fluxes could also be observed. The limiter contained about 1%-1.5% of Si, but a relative Si flux (Si/D) from the Si doped CFC surface between 0.12% and 0.4% has been measured. A chemical erosion of Si due to formation of SiDx has not been observed. Silicon evaporated from the surface at temperatures above 1500°C. This led to an increase of Si concentration and total radiation losses from the plasma. Surface analysis shows the formation of microcracks and holes on the plasma exposed limiter surface. The released Si was deposited in the vicinity of the tangency point of the limiter. Whereas a Si depletion was observed in the area of highest power loading with values reaching in and in-between fibres values of 0.03% and 0.02% respectively.

  8. Fluorinated ethers: A new series of CFC substitutes. Rept. for Aug 88-Oct 91

    International Nuclear Information System (INIS)

    The paper discusses fluorinated ethers, a new series of chlorofluorocarbon (CFC) substitutes. Compounds synthesized to produce substances with suitable refrigerant properties have generally left out sulfur, nitrogen, and oxygen. The general result is that all currently proposed substitutes for CFC and halon replacements have been alkanes. Because of the limited number of compounds of these elements having suitable properties and the current decision to phase out CFCs and (eventually) hydrochlorofluorocarbons (HCFCs), restricting the search to alkanes only is no longer tenable. Consideration of fluorinated ethers effectively doubles the potential list of contenders. The fact that divalent oxygen in a fluorocarbon chain has only a modest effect on vapor pressure, compared to the alkane of similar carbon number and substitution, should be a strong incentive to investigate these compounds. Several new fluorinated compounds have been synthesized and characterized. Additionally, several compounds for which data were not available were synthesized. These compounds, both new and two 'revisited' ones, could function as replacement working fluids in many applications requiring similar properties. Without chlorine, all have zero ozone depletion potential

  9. CFC (Comment-First-Coding)--A Simple yet Effective Method for Teaching Programming to Information Systems Students

    Science.gov (United States)

    Sengupta, Arijit

    2009-01-01

    Programming courses have always been a difficult part of an Information Systems curriculum. While we do not train Information Systems students to be developers, understanding how to build a system always gives students an added perspective to improve their system design and analysis skills. This teaching tip presents CFC (Comment-First-Coding)--a…

  10. Partitioning sources of recharge in environments with groundwater recirculation using carbon-14 and CFC-12

    Science.gov (United States)

    Bourke, Sarah A.; Cook, Peter G.; Dogramaci, Shawan; Kipfer, Rolf

    2015-06-01

    Groundwater recirculation occurs when groundwater is pumped from an aquifer onto the land surface, and a portion of that water subsequently infiltrates back to the aquifer. In environments where groundwater is recirculated, differentiation between various sources of recharge (e.g. natural rainfall recharge vs. recirculated water) can be difficult. Groundwater age indicators, in particular transient trace gases, are likely to be more sensitive tracers of recharge than stable isotopes or chloride in this setting. This is because, unlike stable isotopes or chloride, they undergo a process of equilibration with the atmosphere, and historical atmospheric concentrations are known. In this paper, groundwater age indicators (14C and CFC-12) were used as tracers of recharge by surplus mine water that is discharged to streams. Ternary mixing ratios were calculated based on 14C and CFC-12 concentrations measured along three transects of piezometers and monitoring wells perpendicular to the creeks, and from dewatering wells. Uncertainty in calculated mixing ratios was estimated using a Monte Carlo approach. Ternary mixing ratios in dewatering wells suggest that recharge by mine water accounted for between 10% and 87% of water currently abstracted by dewatering wells. The calculated mixing ratios suggest that recharge by mine water extends to a distance of more than 550 m from the creeks. These results are supported by seepage flux estimates based on the water and chloride balance along the creeks, which suggest that 85-90% of mine water discharged to the creeks recharges the aquifer and recharge by mine water extends between 110 and 730 m from the creeks. Mixing calculations based on gaseous groundwater age indicators could also be used to partition recharge associated with agricultural irrigation or artificial wetland supplementation.

  11. Tritiated thymidine and deoxycytidine suicide of mouse hemopoietic colony forming cells (CFC)

    International Nuclear Information System (INIS)

    Significant enhancement of tritiated dCyd suicide occurred when unlabelled dThd was added to cultures of mouse monocytic colony-forming cells. Incorporation experiments supported the suicide experiments in that incorporation of tritiated dCyd into DNA was significantly increased. One hundred micromolar dCyd significantly reduced the radiotoxicity of 0.3 μCi of tritiated dThd; incorporation experiments indicated a dose-related reduction in the incorporation of tritiated dThd into DNA with the addition of 1-100 μM unlabelled dCyd. The addition of 1 μM aminopterin reversed the effect of 100 μM deoxycytidine; viz., incorporation of dThd into DNA was 90% of controls. Aminopterin had a similar effect on deoxyuridine reversal of tritiated dThd incorporation into DNA. Aminopterin had no effect on the reduction of tritiated dThd incorporation into DNA due to the addition of 100 μM unlabelled thymidine. Unlabelled ribonucleosides, Urd and Cyd, did not significantly affect the suicide pattern of tritiated dThd or dCyd when they were added to CFC cultures. Unlabelled deoxyribonucleosides, dThd or dCyd, did not significantly affect the suicide pattern of either tritiated Cyd or Urd when they were added to cultures containing tritiated ribonucleosides. Unlabelled Urd or Cyd was effective in reversing the suicide due to tritiated Urd or Cyd. (author)

  12. Atmospheric lifetimes, infrared absorption spectra, radiative forcings and global warming potentials of NF3 and CF3CF2Cl (CFC-115)

    Science.gov (United States)

    Totterdill, Anna; Kovács, Tamás; Feng, Wuhu; Dhomse, Sandip; Smith, Christopher J.; Gómez-Martín, Juan Carlos; Chipperfield, Martyn P.; Forster, Piers M.; Plane, John M. C.

    2016-09-01

    Fluorinated compounds such as NF3 and C2F5Cl (CFC-115) are characterised by very large global warming potentials (GWPs), which result from extremely long atmospheric lifetimes and strong infrared absorptions in the atmospheric window. In this study we have experimentally determined the infrared absorption cross sections of NF3 and CFC-115, calculated the radiative forcing and efficiency using two radiative transfer models and identified the effect of clouds and stratospheric adjustment. The infrared cross sections are within 10 % of previous measurements for CFC-115 but are found to be somewhat larger than previous estimates for NF3, leading to a radiative efficiency for NF3 that is 25 % larger than that quoted in the Intergovernmental Panel on Climate Change Fifth Assessment Report. A whole atmosphere chemistry-climate model was used to determine the atmospheric lifetimes of NF3 and CFC-115 to be (509 ± 21) years and (492 ± 22) years, respectively. The GWPs for NF3 are estimated to be 15 600, 19 700 and 19 700 over 20, 100 and 500 years, respectively. Similarly, the GWPs for CFC-115 are 6030, 7570 and 7480 over 20, 100 and 500 years, respectively.

  13. Microstructure characterization of advanced protective Cr/CrN+a-C:H/a-C:H:Cr multilayer coatings on carbon fibre composite (CFC).

    Science.gov (United States)

    Major, L; Janusz, M; Lackner, J M; Kot, M; Major, B

    2016-06-01

    Studies of advanced protective chromium-based coatings on the carbon fibre composite (CFC) were performed. Multidisciplinary examinations were carried out comprising: microstructure transmission electron microscopy (TEM, HREM) studies, micromechanical analysis and wear resistance. Coatings were prepared using a magnetron sputtering technique with application of high-purity chromium and carbon (graphite) targets deposited on the CFC substrate. Selection of the CFC for surface modification in respect to irregularities on the surface making the CFC surface more smooth was performed. Deposited coatings consisted of two parts. The inner part was responsible for the residual stress compensation and cracking initiation as well as resistance at elevated temperatures occurring namely during surgical tools sterilization process. The outer part was responsible for wear resistance properties and biocompatibility. Experimental studies revealed that irregularities on the substrate surface had a negative influence on the crystallites growth direction. Chromium implanted into the a-C:H structure reacted with carbon forming the cubic nanocrystal chromium carbides of the Cr23 C6 type. The cracking was initiated at the coating/substrate interface and the energy of brittle cracking was reduced because of the plastic deformation at each Cr interlayer interface. The wear mechanism and cracking process was described in micro- and nanoscale by means of transmission electron microscope studies. Examined materials of coated CFC type would find applications in advanced surgical tools.

  14. Potential groundwater age tracer found: Halon-1301 (CF3Br), as previously identified as CFC-13 (CF3Cl)

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2014-09-01

    Groundwater dating using anthropogenic and natural tracer substances is a powerful tool for understanding groundwater dynamics for improved management of groundwater resources. Due to limitations in individual dating methods, often multiple tracers are used to reduce ambiguities. It is commonly accepted that there is a need for further complementary age tracers, in addition to current ones (e.g., tritium, SF6, and CFCs). We propose a potential new groundwater age tracer, Halon-1301 (CF3Br), which can easily be determined using gas chromatography with an attached electron capture detector (GC/ECD) developed by Busenberg and Plummer (2008). Its peak was noted by Busenberg and Plummer (2008), but they believed it to be CFC-13 (CF3Cl) at that time. We performed rigorous tests on gases containing or excluding Halon-1301 and CFC-13 and modern water samples and concluded that the two compounds have extremely similar retention times. Additionally, we found that the ECD response of CFC-13 is far too low to be detected in groundwater or air using standard volumes and sampling techniques. However, the peak areas and concentrations Busenberg and Plummer (2008) reported are in line with what would be expected for Halon-1301. Thus, we are confident that the peak formerly identified as CFC-13 is actually Halon-1301. Busenberg agrees with our findings. We further suggest that Halon-1301 has potential as a (complementary) age tracer, due to its established atmospheric history, and could hypothetically be used to date groundwater recharged in the 1970s or onward. We discuss known relevant properties, such as solubility and stability of Halon-1301 in the context of how these effect its potential application as a groundwater age tracer. Some open questions remain concerning how conservative Halon-1301 is—is it subject to degradation, retardation, and/or local contamination in groundwater. We are confident that Halon-1301 possesses important tracer relevant properties, but further

  15. Two-phase flows during draining of liquefied gases initially undersaturated. Validation by water and CFC11; Ecoulements diphasiques lors de la vidange de gaz liquifies initialement sous satures. Validation par l`eau et le CFC11

    Energy Technology Data Exchange (ETDEWEB)

    May, L.

    1996-12-11

    In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.

  16. Consistent sets of atmospheric lifetimes and radiative forcings on climate for CFC replacements: HCFCs and HFCs

    Science.gov (United States)

    Naik, Vaishali; Jain, Atul K.; Patten, Kenneth O.; Wuebbles, Donald J.

    2000-03-01

    Recognition of deleterious effects of chlorine and bromine on ozone and climate over the last several decades has resulted in international accords to halt the production of chlorine-containing chlorofluorocarbons (CFCs) and bromine-containing halons. It is well recognized, however, that these chemicals have had important uses to society, particularly as refrigerants, as solvents, as plastic blowing agents, as fire retardants and as aerosol propellants. This has led to an extensive search for substitute chemicals with appropriate properties to be used in place of the CFCs and halons. The purpose of this study is to evaluate in a consistent manner the atmospheric lifetime and radiative forcing on climate for a number of replacement compounds. The unique aspect of this study is its attempt to resolve inconsistencies in previous evaluations of atmospheric lifetimes and radiative forcings for these compounds by adopting a uniform approach. Using the latest version of our two-dimensional chemical-radiative-transport model of the global atmosphere, we have determined the atmospheric lifetimes of 28 hydrohalocarbons (HCFCs and HFCs). Through the comparison of the model-calculated lifetimes with lifetimes derived using a simple scaling method, our study adds to earlier findings that consideration of stratospheric losses is important in determining the lifetimes of gases. Discrepancies were found in the reported lifetimes of several replacement compounds reported in the international assessment of stratospheric ozone published by the World Meteorological Organization [Granier et al., 1999] and have been resolved. We have also derived the adjusted and instantaneous radiative forcings for CFC-11 and 20 other halocarbons using our radiative transfer model. The sensitivity of radiative forcings to the vertical distribution of these gases is investigated in this study and is shown to be significant. The difference in the global radiative forcing arising from the assumption of a

  17. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    Directory of Open Access Journals (Sweden)

    I MADE RASTA

    2015-06-01

    Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.

  18. Laboratory test results on the thermal resistance of polyisocyanurate foamboard insulation blown with CFC-11 substitutes: A cooperative industry/government project

    Energy Technology Data Exchange (ETDEWEB)

    McElroy, D.L.; Graves, R.S.; Yarbrough, D.W.; Weaver, F.J.

    1991-09-01

    The fully halogenated chlorofluorocarbon gases (CFC-11 and CFC-12) are used as blowing agents for foam insulations for building and appliance applications. The thermal resistance per unit thickness of these insulations is greater than that of other commercially available insulations. Mandated reductions in the production of these chemicals may lead to less efficient substitutes and increase US energy consumption by one quad or more. This report describes laboratory thermal and aging tests on a set of industry-produced, experimental polyisocyanurate (PIR) laminate boardstock to evaluate the viability of hydrochlorofluorocarbons (HCFSs) as alternative blowing agents to chlorofluorcarbon-11 (CFC-11). The PIR boards were blown with five gases: CFC-11, HCFC- 123, HCFC-141b, and 50/50 and 65/35 blends of HCFC-123/HCFC-141b. These HCFC gases have a lower ozone depletion potential than CFC-11 or CFC-12. Apparent thermal conductivity (k) was determined from 0 to 50{degrees}C. Results on the laminate boards provide an independent laboratory check on the increase in k observed for field exposure in the Roof Thermal Research Apparatus (RTRA). The measured laboratory increase in k was between 8 and 11% after a 240-d field exposure in the RTRA. Results are reported on a thin-specimen, aging procedure to establish the long-term thermal resistance of gas-filled foams. These thin specimens were planed from the industry-produced boardstock foams and aged at 75 and 150{degrees}F for up to 300 d. The resulting k-values were correlated with an exponential dependency on (diffusion coefficient {times} time){sup {1/2}}/thickness and provided diffusion coefficients for air components into, and blowing agent out of, the foam. This aging procedure was used to predict the five-year thermal resistivity of the foams. The thin-specimen aging procedure is supported with calculations by a computer model for aging of foams. 43 refs., 33 figs., 25 tabs.

  19. WO3/ZrO2 Strong Acid as a Catalyst for the Decomposition of Chlorofluorocarbon (CFC-12)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction Chlorofluorocarbons (CFCs) diffusing to the stratosphere is a major reason for ozone depletion[1]. Also CFCs has been claimed to be notorious for its greenhouse effect[2]. So, recently it has become very important to eliminate CFCs as far as protecting the ozone layer surrounding the earth is concerned. Among various kinds of approaches to do destruction to CFCs, the catalytic decomposition seems to be the most practical and energetically favorable one, especially for treating small amounts of CFCs[3,4]. Recently, Fu et al.[3] reported that TiO2 modified with H2SO4 was much more active than TiO2 for the decomposition of CFC-12 in the presence of water vapor, and they attributed this tremendous enhancement in activity to the superacidic property of the sulfated catalyst. Their research results substantially stimulate us to investigate the catalytic decomposition of CFC-12 in the presence of water vapor over WO3/ZrO2 strong acid, which is more thermally stable than the sulfated oxides superacids[5].

  20. Refrigerating and air conditioning systems in the Republic of Macedonia regarding to the use of CFC fluids

    International Nuclear Information System (INIS)

    Classification of refrigerating systems and their condition in the Republic of Macedonia, by the capacity and application. Review of the subjects involved in refrigeration in the Republic of Macedonia: manufactures of refrigerating systems, distributors of refrigerating equipment, distributors of (CFC) refrigerants, maintenance and servicing of refrigerating systems regarding to the quality and the weak points. Measures and projects in the Republic of Macedonia in the field of the protection of the ozone layer. Regulations by the Montreal protocol. Regulations in the Republic of macedonia concerning refrigerating systems and CFC fluids in them. Country programme of the Republic of Macedonia and institutional activities. Projects in 'Frinko; and 'Sileks' where the manufacturing technologies are changed. Project 'Refrigerant management plan' in which are included: forming of training centers, training of service technicians and engineers involved in refrigeration and air conditioning, equipping of services and companies with on equipment for good practice in refrigeration and refrigerant's recovery, forming of recycling centers for purification of used refrigerants, training of custom officers. (Author)

  1. Micro-chemical analysis of high heat loaded CFC-Cu interfaces from Tore Supra and Wendelstein 7-X

    International Nuclear Information System (INIS)

    A comparison of high-heat-flux tested carbon-fiber reinforced carbon (CFC)/Cu materials of Tore Supra and Wendelstein 7-X plasma-facing components is made in order to understand the different fatigue behavior of the bonding interfaces, in particular for the Tore Supra materials. The elemental distribution around the bonding layer and the chemical composition of the active element titanium are characterized by secondary ion mass spectrometry and x-ray photoelectron spectroscopy. The results show that the improved bonding of the Wendelstein 7-X target elements compared to the Tore Supra pump limiter elements is due to a modified silicon and titanium distribution at the bonding interface. However, the difference in fatigue behavior between the two Tore Supra components cannot be attributed to the bonding interface, since the elemental distribution and chemistry of these components are identical and no degradation is observed after an extended heat flux exposure.

  2. Influence of wind fields on the uptake of CFC-11 in the global ocean model%风场对全球海洋CFC-11吸收的影响

    Institute of Scientific and Technical Information of China (English)

    方怡; 徐永福; 李阳春; 覃军

    2014-01-01

    为了在中国科学院大气物理研究所的全球海洋模式(LASG/IAP Climate Ocean Model, LICOM)中研究不同的风场引起的海气传输速度对三氯一氟甲烷(CFC-11)在海洋中的分布和吸收产生的影响,同时选出更适用于 LICOM 模式模拟海洋对气体吸收的风场,本文做了4组对比实验,即传输速度为常数(实验-C)以及依赖3个不同风场(Esbensen and Kushnir观测风场(实验-EK)、National Centers for Environmental Prediction(NCEP)再分析风场(实验-NP)、QuikSCAT卫星风场(实验-QS))的实验。在对比分析中重点考察了CFC-11的海气通量、海表浓度、水柱总量、传输过程等。结果显示,不同风场带来的传输速度差异会造成模拟结果在局部海域存在显著差异,但在大部分海域的差异并不显著。而且随着积分时间的增加,从海气通量、存储量两方面可以看出,不同模拟结果之间的差异有着减小的趋势。如1955年1月北大西洋局部地区,不同的风场下的海气通量模拟结果间的差异达到20%左右,到了1995年1月这种差异下降到15%左右。此外,传输速度的选取依赖风场计算值的全球平均值(试验-C)会造成模拟结果相对偏小,而风速相对较大的QuikSCAT卫星风场资料在一定程度上使得模式模拟结果与观测资料更为接近。%Using a global ocean general circulation model (LICOM) developed by the Institute of Atmospheric Physics (IAP) of the Chinese Academy of Sciences, we conducted four numerical experiments to investigate the influence of different wind fields on the uptake and transport of CFC-11 in the global ocean. Three experiments were performed using the same formula of the air-sea gas transfer velocity that is dependent on wind speed, in which wind speeds were from Esbensen and Kushnir (Exp-EK), NCEP (Exp-NP) and QuickSCAT (Exp-QS). An-other experiment is called Exp-C, in which the transfer velocity is a space-independent constant of 14.5 cm

  3. Dating of groundwater using anthropogenic gaseous tracers (SF6, SF5CF3, CFC-12, HC-1311): methodological aspects

    Science.gov (United States)

    Bartyzel, J.; Rosiek, J.; Śliwka, I.; Rozanski, K.

    2012-04-01

    Groundwater is an important source of potable water in many countries. Nowadays, this strategic resource is at risk due to anthropogenic pollutants of various nature entering shallow aquifers. Proper management of groundwater resources requires precise understanding of groundwater dynamics on time scales characteristic for the history of pollutant input to groundwater. Several anthropogenic trace substances present in the atmosphere, such as freons (CFC-11, CFC-12) and sulfur hexafluoride (SF6) play an increasingly important role as environmental tracers allowing a better insight into the dynamic of groundwater systems. The concentration of SF6 in the atmosphere is increasing steadily, with the growth rate in the order of 5% per year. Recently, a new trace gas (trifluoromethyl sulphur pentafluoride - SF5CF3) has been discovered in the atmosphere. The atmospheric concentrations of SF5CF3 reconstructed from archive air samples have been increasing during the late 1980s and 1990s with the growth of ca. 6 % per year, with the sings of leveling-off during the last decade. We present here a dedicated analytical system capable to determine environmental levels of several gaseous tracers (SF6, SF5CF3, CFC-12, HC-1311) in air and water, with the precision and accuracy sufficiently low do use them for groundwater dating. In addition, the system is capable to measure in the same water sample the concentrations of Ne and Ar. This allows corrections for excess air to be made and the calculations of recharge temperatures. The field sampling system is based on a dynamic head-space method. The analysed water is pumped continuously through the extraction system where the dynamic head-space is created. Approximately 100 liters of water has to be pumped through the system before the dynamic equilibrium is reached in the head-space volume. Then, gaseous sample is collected from the head-space volume (ca. 200 ml) and transferred to the laboratory. The mixing ratio measurements are

  4. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    OpenAIRE

    I MADE RASTA; I.W. Kasa; I Gede Mahardika

    2015-01-01

    CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 co...

  5. Microstructure and properties of SiC gradiently coated Cf/C composites prepared by a RCLD method

    Institute of Scientific and Technical Information of China (English)

    Jun-hua Chen; Cuang-li Chen; Hao-ran Geng; Yan Wang

    2009-01-01

    The SiC gradiently coated carbon fiber/carbon (Cf/C) composites were prepared by a two-step rapid chemical liquid depo-sition (RCLD) method. The microstructure and properties of the composites were investigated using X-ray diffraction, scanning elec-tron microscopy together with energy dispersive X-ray analysis, bending tests, and oxidation tests. The experimental results show that the surface layer of the composites is composed of SiC, pyrocarbon, and carbon fibers. Their inner area consists of pyrocarbon and carbon fibers. The SiC content gradiently decreases with increasing distance from the outer surface to the center of the compos-ites. Furthermore, the thickness of the SiC layer increases with increasing tetraethylorthosilicate content and deposition time. SiC coatings have no significant influence on the bending strength of the composites. However, the oxidation resistance of the compos-ites increases with increasing thickness of the SiC layer.

  6. Stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O from measurements made by the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS

    Directory of Open Access Journals (Sweden)

    P. F. Bernath

    2013-02-01

    Full Text Available Long lived halogen-containing compounds are important atmospheric constituents since they can act both as a source of chlorine radicals, which go on to catalyse ozone loss, and as powerful greenhouse gases. The long term impact of these species on the ozone layer is dependent on their stratospheric lifetimes. Using observations from the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS we present calculations of the stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O. The lifetimes were calculated using the slope of the tracer-tracer correlation of these species with CFC-11 at the tropopause. The correlation slopes were corrected for the changing atmospheric concentrations of each species based on age of air and CFC-11 measurements from samples taken aboard the Geophysica aircraft – along with the effective linear trend of the VMR from tropical ground-based AGAGE sites. Stratospheric lifetimes were calculated using a CFC-11 lifetime of 45 yr. These calculations produced values of 113 + (− 26 (18 yr (CFC-12, 35 + (− 11 (7 yr (CCl4, 195 + (− 75 (42 yr (CH4, 69 + (− 65 (23 yr (CH3Cl and 123 + (− 53 (28 yr (N2O. The errors on these values are the weighted 1-σ non-systematic errors. The stratospheric lifetime of CH3Cl represents the first calculations of the stratospheric lifetime of CH3Cl using data from a space based instrument.

  7. Post-coring entrapment of modern air in polar ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and shallow ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-01-01

    Full Text Available In this study, we report the first measurements of CFC-12 (CCl2F2 in air extracted from shallow ice cores along with firn air CFC-12 measurements from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for presence of modern air entrapped in shallow ice core samples. We propose that this is due to closure of open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our measurements reveal the presence of open porosity below the depth at which firn air samples can be collected and demonstrate how the composition of bubble air in shallow ice cores can be altered during the post-drilling period through purely physical processes. These results have implications for investigations involving trace gas composition of bubbles in shallow ice cores.

  8. Post-coring entrapment of modern air in some shallow ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-06-01

    Full Text Available In this study, we report measurements of CFC-12 (CCl2F2 in firn air and in air extracted from shallow ice cores from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, some of the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for the presence of modern air entrapped in the shallow ice core samples that likely contained open pores at the time of collection. We propose that this is due to closure of the open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our results reveal that open porosity can exist below the maximum depth at which firn air samples can be collected, particularly at sites with lower accumulation rates. CFC-12 measurements demonstrate that post-drilling closure of open pores can lead to a change in the composition of bubble air in shallow ice cores through purely physical processes. The results have implications for investigations involving trace gas composition of bubbles in shallow ice cores collected near the firn-ice transition.

  9. Evaluation of the Erosion on the CFC tiles of the ITER Divertor by means o f FE calculations

    International Nuclear Information System (INIS)

    Full text of publication follows: The vertical target of the ITER divertor is armoured with Carbon Fibre Composite (CFC) mono-blocks in the lower part. This part is subjected to the maximum power and particles loads and, consequently, has a risk of high erosion and a significant risk of failure. In order to calculate the erosion during operation an original methodology has been developed using the CASTEM CEA finite element code. The calculation is based on a series of steady states the mesh being updated at each step of the iteration taking into account the rate of erosion between two steps. The model was developed thanks to the routines developed 10 years ago for the toroidal pump limiter of Tore Supra and takes into account shadowing effect and possible penetration of power into the gap between two mono-blocks. Both physical and chemical sputtering together with sublimation have been included in the code to describe the loss of material by the thermal and particle loads envisaged for ITER normal operation regime. This model has been validated by comparison with analytical or other code results. As erosion instability in normal operation in case of one faulty mono-block besides good ones due to the balanced rate between the various erosion mechanisms at different temperatures can be expected, coherent plasma parameters, which represent the worse cases of erosion in normal operation, have been taken into account to analyse the erosion behaviour of the mono-blocks. The aim of the study was also to evaluate the influence of a mono-block defect on erosion behaviour and the impact of these phenomena on the mono-block acceptance criteria. The calculations have pointed out the occurrence of some erosion instabilities for the studied cases (neighbour mono-block with reduced conductivity or with 90 deg. defects). Moreover it was shown that, when applying 20 MW/m2 to the erosion model already subjected to the normal condition loads for 10,000 s, the plasma shaping of the

  10. Stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O from measurements made by the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS

    Directory of Open Access Journals (Sweden)

    A. T. Brown

    2013-07-01

    Full Text Available Long lived halogen-containing compounds are important atmospheric constituents since they can act both as a source of chlorine radicals, which go on to catalyse ozone loss, and as powerful greenhouse gases. The long-term impact of these species on the ozone layer is dependent on their stratospheric lifetimes. Using observations from the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS we present calculations of the stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O. The lifetimes were calculated using the slope of the tracer–tracer correlation of these species with CFC-11 at the tropopause. The correlation slopes were corrected for the changing atmospheric concentrations of each species based on age of air and CFC-11 measurements from samples taken aboard the Geophysica aircraft – along with the effective linear trend of the volume mixing ratio (VMR from tropical ground based AGAGE (Advanced Global Atmospheric Gases Experiment sites. Stratospheric lifetimes were calculated using a CFC-11 lifetime of 45 yr. These calculations produced values of 113 + (− 26 (18 yr (CFC-12, 35 + (− 11 (7 yr (CCl4, 69 + (− 65 (23 yr (CH3Cl, 123 + (− 53 (28 yr (N2O and 195 + (− 75 (42 yr (CH4. The errors on these values are the weighted 1σ non-systematic errors. Systematic errors were estimated by recalculating lifetimes using VMRs which had been modified to reflect differences between ACE-FTS retrieved VMRs and those from other instruments. The results of these calculations, including systematic errors, were as follows: 113 + (− 32 (20 for CFC-12, 123 + (− 83 (35 for N2O, 195 + (− 139 (57 for CH4, 35 + (− 14 (8 for CCl4 and 69 + (− 2119 (34 yr for CH3Cl. For CH3Cl & CH4 this represents the first calculation of the stratospheric lifetime using data from a space based instrument.

  11. Manufacturing and high heat-flux testing of brazed actively cooled mock-ups with Ti-doped graphite and CFC as plasma-facing materials

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Rosales, C; Ordas, N; Lopez-Galilea, I [CEIT and Tecnun (University of Navarra), 20018 San Sebastian (Spain); Pintsuk, G; Linke, J [Forschungszentrum Juelich GmbH, EURATOM Association, 52425 Juelich (Germany); Gualco, C; Grattarola, M; Mataloni, F [Ansaldo Ricerche S.p.A., I-16152 Genoa (Italy); Ramos Fernandez, J M; MartInez Escandell, M [Departamento de Quimica Inorganica, University of Alicante, E-03690 Alicante (Spain); Centeno, A; Blanco, C [Instituto Nacional del Carbon (CSIC), Apdo. 73, E-33080 Oviedo (Spain)], E-mail: cgrosales@ceit.es

    2009-12-15

    In the frame of the EU project ExtreMat new Ti-doped isotropic graphites and carbon fibre-reinforced carbons (CFCs) with high thermal conductivity and reduced chemical erosion were brazed to a CuCrZr heat-sink to produce flat-tile actively cooled mock-ups (MUs). Brazing was done using a low CTE interlayer to shift the stresses to the metal-metal interface. These MUs were exposed to high heat-fluxes in the electron beam facility JUDITH. Screening tests were conducted increasing the heat load stepwise up to 15 MW m{sup -2}, followed by 100 cycles at 15 MW m{sup -2}, subsequent screening up to 20 MW m{sup -2} and 100 cycles at 20 MW m{sup -2}. All MUs withstood screening at 15 MW m{sup -2} and most of them survived screening at 20 MW m{sup -2}. Ti-doped CFC MUs showed a significant improvement compared with the undoped reference CFC, surviving several cycles at 20 MW m{sup -2} on all tiles. One of the Ti-doped graphite MUs withstood 100 cycles at 20 MW m{sup -2} on one tile, representing a promising result.

  12. Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential

    Energy Technology Data Exchange (ETDEWEB)

    Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)

    1995-12-31

    Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)

  13. Interpretation of groundwater age tracers (CFC-12, 14C, 4He) in a mining-influenced stream-aquifer system with transient recharge dynamics.

    Science.gov (United States)

    Bourke, Sarah; Cook, Peter; Kipfer, Rolf; Dogramaci, Shawan

    2014-05-01

    Interpretation of groundwater age tracers often requires consideration of the mixing of groundwater with varying residence times. Quantification of mixing can be approached through measurement of multiple groundwater age indicators with varying ranges of temporal sensitivity, and their interpretation using lumped parameter models. However, in systems altered by mining, where recharge mechanisms are highly transient in space and time, lumped parameter models do not adequately represent the complexity of the system. In the Pilbara region of Western Australia, water abstracted during dewatering of ore-body aquifers is disposed of by discharging it into ephemeral streams and allowing it to recharge the aquifer. Because this water is essentially being recycled, stable isotopes and chloride are not useful tracers of the impact of this dewatering discharge. In contrast, gas tracers that respond rapidly to exposure to the atmosphere are more useful tracers for constraining the influence of dewatering discharge on the aquifer water balance. In this study we measured CFC-12, 14C and noble gases in production wells and transects of piezometers perpendicular to the stream. Even in samples from wells screened over intervals of 1 m, we observe combinations of tracer concentrations that indicate mixing of groundwater with contrasting residence times. For example, all samples contained measureable CFC-12 concentrations, including those with appreciable terrigenic 4He. Interpretation of these data requires consideration of the history of mining activity in the area. Stream 14C activities, which now range from 50 to 75 pMC, are a function of the dewatering discharge, and are no longer in equilibrium with the atmosphere. As a result, groundwater that recharged prior to mining operations can have higher 14C activities than groundwater that recharged through the stream in the last 10 years. The dewatering discharge has caused the stream to transition from a disconnected ephemeral

  14. Materials Compatibility and Lubricants Research of CFC-refrigerant substitutes. Quarterly technical progress report, 1 April 1993--30 June 1993

    Energy Technology Data Exchange (ETDEWEB)

    Godwin, D.S.; Hourahan, G.C.; Szymurski, S.R.

    1993-07-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The DCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. Under the current MCLR program the Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) is contracting and managing multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each researcher.

  15. The impact of thermal fatigue and carbidization on the W coatings deposited on CFC tiles for the ITER-like Wall project at JET

    International Nuclear Information System (INIS)

    Highlights: ► Degradation curves of the W coatings depend on temperature and number of pulses. ► Thermo-mechanical properties of the W coatings are associated with degradation curves. ► Thermal fatigue and carbidization affect the interface between CFC and W. ► A pore structure was detected at the interface by SEM examination. -- Abstract: Since August 2011 JET operates with the ITER-like wall comprising bulk Be tiles, bulk W tiles and W coated CFC tiles with a thickness of 10–15 μm and 20–25 μm. In order to evaluate behavior of the W coatings to a cyclic thermal loading relevant to JET operation, high heat flux (HHF) tests have been carried out up to 5100 pulses with an electron beam facility at peak temperatures of 1000 °C, 1250 °C and 1450 °C. The pulse duration was 24 s. Optical inspections of the W layer performed periodically by interrupting the test revealed small delaminations with the size of 50–500 μm. The dependence of the delamination percentage on the number of pulses can be seen as a degradation curve for each particular W coating. In this way the thermo-mechanical properties of the W coatings can be characterized quantitatively. Thermal fatigue and carbidization of the tungsten due to the diffusion of the carbon from the substrate have been recognized as mechanisms for degradation of the coatings. Tungsten carbides have been identified by using TEM (transmission electron microscopy) diffraction analysis on FIB (focused ion beam) prepared cross-section samples subjected to HHF tests. Nano-pores developed at the CFC–Mo and Mo–W interfaces during the tests might be also responsible for the degradation of the coating

  16. Multi-tracer approach (18O, 3H/3He, CFC, SF6, 35S) to find the best emergency drinking water supply, Vorarlberg, Austria

    Science.gov (United States)

    Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley

    2016-04-01

    To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (water supply. In general, the combination of tracers

  17. The CFC-ozone problem and possibilities for reducing emissions of chlorofluorocarbons in refrigeration engineering, air conditioning, and heat pump engineering. 2. ed. Das FCKW-Ozon-Problem und Moeglichkeiten der Emissionsreduzierung von Fluorchlorkohlenwasserstoffen fuer die Kaelte-, Klima- und Waermepumpentechnik

    Energy Technology Data Exchange (ETDEWEB)

    1988-03-01

    Political activities under way world-wide aim to cut down on the production of chlorofluorocarbons as a prophylactic means to reduce emissions from their application before hand, for the benefit of the ozone layer - in the sectors of aerosol technology (spray-cans), polyurethane foam and expanded foam (for instance for thermal insulation purposes and for packaging), refigerants in refrigeration engineering, or solvents in dry cleaning. The factors to be considered in refrigeration engineering, and viable possibilities are explained in this status report. The advantageous properties of CFC 11 and 12, often referred to by the household term of 'safety refrigerants', as compared to refrigerants formerly used, are described; so is their use in the comprehensive spectrum of refrigeration technology, whose importance in modern life is also briefly dealt with. - The second part of the status report is concerned with the conributions of refrigeration engineering towards cutting down CFC emissions. First of all, the question of substitutes is dealt with. A further point of emphasis consists in the reduction of CFC emissions from technical plants - considering the 'code of good pratices' published in 1984 - and the rules to adhere by when accepting used refrigerants, as well as the possibilities for their disposal. - The report is rounded off by some production figures on CFCs and explanations regarding the safety precautions to be taken at refrigerators, heat pumps, and cooling appliances, which are to be observed when using different refrigerants including CFCs. (orig./UA).

  18. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems.

  19. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems. PMID:26863003

  20. International Tax Havens, CFC Rules and the Chinese Economy%国际避税地、CFC法规与中国经济

    Institute of Scientific and Technical Information of China (English)

    张巍; 黄莹

    2012-01-01

    The relationship between international tax havens and China's economic development is getting closer. China has begun to establish anti- tax framework for the economic model of international tax havens. This paper estimates the scale of FDI connected with the international tax havens in China, summarizing the tax legislation for international tax havens, and discusses the CFC rules in the balance of the two rival policies.%国际避税地与中国经济发展关系越来越紧密。针对国际避税地经济模式的税收法制框架在我国已经初具模型。本文估测了国际避税地对中国FDI的影响规模,总结了针对国际避税地的中国税收立法情况,探讨了中国受控外国公司(Controlted Foreign Corporation。以下简称CFC)法规在两大竞争性政策中的平衡问题。

  1. O perfil do contador e os níveis de habilidades cognitivas nos exames Enade e suficiência do CFC: uma análise sob a perspectiva da taxonomia de Bloom

    OpenAIRE

    Francisco Marton Gleuson Pinheiro; José Maria Dias Filho; Raimundo Nonato Lima Filho; Laerson Morais Silva Lopes

    2013-01-01

    This research identifies if the levels of cognitive skills demanded by ENADE and sufficiency exam of the CFC are adherent to the accountant profile required by the National Education Council (CNE) from the perspective of Bloom’s Taxonomy. We analyzed two editions of ENADE and the last two editions of the sufficiency exams as well as the Accountants professional profile required of by Resolution CNE/CES 10/2004. The exam questions and professional profile required by the CNE were classified in...

  2. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2007-05-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 years, and CFC-11 measurements, give a mean residence time of 8 years for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 years and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water, with mean age 1.2 years and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusive below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs

  3. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2008-01-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 yr, and CFC-11 measurements, give a mean residence time of 8 yr for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 yr and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water with mean age 1.2 yr and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusion below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs and allows

  4. Research of Curative Effect to Chronical Functional Constipation(CFC)with Different Processed Products of Plantain Seed%车前子不同炮制品对慢性功能性便秘的疗效

    Institute of Scientific and Technical Information of China (English)

    刘川玉; 周劲刚; 何洁; 唐建红

    2011-01-01

    Objective: It has been observed the curative effect to Chronical Functional Constipation (CFC)with the different processed products of Plantain Seed.Method: It had been chosen ninty examples of patients with the chronical functional constipation (CFC), they had been divided into three groups randomly.Then they had been treated with the stir-frying with salt-water of Plantain Seed, the simple stir-frying of Plantain Seed and the raw powder of Plantain Seed differently, and it had been compared and researched the curative effects and the recurrence rates.Result: The comparation of curative effects of these three groups of patients had significant difference (P < 0.05 ), and the curative effect in the group of the raw powder of Plantain Seed had been the most significant among the total, its effective power (96.67% ) and cure rate (90%) had been higher the other two groups, and its recurrence rate of patients' post-recovery had been the lowest (3.66%).Conclusion: The curative effect to the chronical functional constipation (CFC) with the raw powder of Plantain Seed has been certain and significant, and it has the low recurrence rate.So that the raw powder of Plantain Seed has the value of developing,extending and utilizing extremely.%目的:观察车前子不同炮制品对慢性功能性便秘的疗效.方法:选择慢性功能性便秘患者90例,随机分成3组,分别用盐制车前子、清炒车前子和车前子生粉进行治疗,对其疗效和复发率进行比较研究.结果:3组患者的疗效比较具有显著性差异(P<0.05),车前子生粉组的疗效最为显著,有效率(96.67%)和治愈率(90%)均高于其他两组,患者愈后复发率最低(3.66%).结论:车前子生粉对慢性功能性便秘疗效确切显著,复发率低,极具开发推广应用价值.

  5. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2010-11-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments (e.g., enhancements of 13 pptv and 11 pptv for CFC-11 and CFC-12, respectively. Emissions estimates of HFC-152a (0.98±0.05 Gg and HFC-134a (1.40±0.11 Gg in LA County for 2008 were obtained using the observed HFC:CO enhancement ratio. The emission rates were extrapolated to the SoCAB (1.48±0.07 Gg for HFC-152a and 2.12±0.17 Gg for HFC-134a and US (30.1±1.5 Gg for HFC-152a and 43.0±3.4 Gg for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB also were calculated by a second method that utilizes air quality modeling. Estimates obtained using both methods agree well.

  6. O perfil do contador e os níveis de habilidades cognitivas nos exames Enade e suficiência do CFC: uma análise sob a perspectiva da taxonomia de Bloom

    Directory of Open Access Journals (Sweden)

    Francisco Marton Gleuson Pinheiro

    2013-11-01

    Full Text Available This research identifies if the levels of cognitive skills demanded by ENADE and sufficiency exam of the CFC are adherent to the accountant profile required by the National Education Council (CNE from the perspective of Bloom’s Taxonomy. We analyzed two editions of ENADE and the last two editions of the sufficiency exams as well as the Accountants professional profile required of by Resolution CNE/CES 10/2004. The exam questions and professional profile required by the CNE were classified into two levels of cognitive skills in Bloom’s Taxonomy: the first, considering a lower cognitive level; and the second, considering a higher level. The significance test for proportions indicated that levels of cognitive skills required by ENADE and the proficiency exams are not adherent to the accountant profile provided by the CNE. Regarding the frequency of issues, it was not charged higher cognitive level, although in 2009 the ENADE has not presented significant difference between issues.

  7. 76 FR 72452 - CFC-50 Commission

    Science.gov (United States)

    2011-11-23

    ...'' groups. The Commission is co-chaired by Thomas Davis and Beverly Byron. The meeting is open to the public... INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign, U.S. Office of...

  8. 77 FR 10004 - CFC-50 Commission

    Science.gov (United States)

    2012-02-21

    ...'' groups. The Commission is co- chaired by Thomas Davis and Beverly Byron. The meeting is open to the..., 78205. FOR FURTHER INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign,...

  9. 76 FR 53159 - CFC-50 Commission Meeting

    Science.gov (United States)

    2011-08-25

    ... ``watchdog'' groups. The Commission is co- chaired by Thomas Davis and Beverly Byron. The meeting is open to... 20415. FOR FURTHER INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign,...

  10. MANUAL FOR NON-CFC AEROSOL PACKAGING: CONVERSION FROM CFC TO HYDROCARBON PROPELLANTS

    Science.gov (United States)

    The report provides technical assistance to aerosol product marketers and fillers in other nations now faced with eliminating chlorofluorocarbons (CFCs) under the terms of the Montreal Protocol. t addresses the issues of hydrocarbon propellant supply, product reformulation, equip...

  11. Dicty_cDB: CFC438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TEINASE. Sitophilus zeamais (maize weevil), mRNA sequence. 50 2e-06 3 dna update 20...d_04H08_TEXF1 Psoroptes ovis mixed Psoroptes ovis cDNA clone Po_ad_04H08 5' similar to O46030 CYSTEINE PRO

  12. Dicty_cDB: CFC309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available shock pr... 239 1e-61 AF006542_1( AF006542 |pid:none) Drosophila pseudoobscura bogotana ... 238 3e-61 AF0065...osophila pseudoobscura bogotana ... 238 3e-61 ( O16087 ) RecName: Full=Heat shock

  13. Dicty_cDB: CFC256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions... for synthesis of longfatty acids in plants. 1306 0.0 1 BD082645 |BD082645.1 Methods and compositions for sy...nthesis of long chain polyunsaturated fatty acids. 1306 0.0 1 BD082630 |BD082630.1 Methods and compositions

  14. Dicty_cDB: CFC796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 58 9e-07 2 CF806266 |CF806266.1 psHB007xC07f USDA-IFAFS:Expression of Phytophthora sojae genes during infection and propaga...tion Phytophthora sojae cDNA clone sHB007C07 5, mRNA seq

  15. Dicty_cDB: CFC102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 4e-12 2 D88434 |D88434.1 Malus domestica mRNA for protein abundantly expressed during apple fruit develo...pment, complete cds. 72 1e-08 1 AY034889 |AY034889.1 Tortula ruralis aldehyde dehyd

  16. Dicty_cDB: CFC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...nts: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  17. Strength and fatigue measurements for CfC materials

    International Nuclear Information System (INIS)

    CfC-materials are considered as candidate materials for the divertors of fusion reactors as well as for protecting tiles of the first wall. As a consequence of cyclic thermal loading the mechanical failure modes will be spontaneous failure due to exceeding of the limit of strength and failure caused by cyclic fatigue. These two failure modes are of main interest to the experimental investigations on CfC-materials. The mechanical behaviour of several CfC-materials was studied applying different types of testing: strength measurements, determination of fatigue and recording of crack-resistance curves. (orig.)

  18. Dicty_cDB: CFC203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a ... 40 0.17 EF084406_1( EF084406 |pid:none) Picea sitchensis clone WS02712_K12... 39 0.38 ( P56873 ) RecName: Full=Sjoe... days embryo whole ... 37 1.4 ( O60232 ) RecName: Full=Sjoegren syndrome/scleroderma autoantigen... 36 1.9 B

  19. High-temperature brazing for reliable tungsten-CFC joints

    International Nuclear Information System (INIS)

    The joining of tungsten and carbon-based materials is demanding due to the incompatibility of their chemical and thermophysical properties. Direct joining is unfeasible by the reason of brittle tungsten carbide formation. High-temperature brazing has been investigated in order to find a suitable brazing filler metal (BFM) which successfully acts as an intermediary between the incompatible properties of the base materials. So far only low Cr-alloyed Cu-based BFMs provide the preferential combination of good wetting action on both materials, tolerable interface reactions, and a precipitation free braze joint. Attempts to implement a higher melting metal (e.g. Pd, Ti, Zr) as a BFM have failed up to now, because the formation of brittle precipitations and pores in the seam were inevitable. But the wide metallurgical complexity of this issue is regarded to offer further joining potential

  20. Dicty_cDB: CFC186 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 67470-3108875 strain AX4, complete sequence. 38 1.4 11 AJ537965 |AJ537965.1 Timarcha balearica EST, clone Timarcha...5F6. 44 2.1 1 AJ537906 |AJ537906.1 Timarcha balearica EST, clone Timarcha4H

  1. Dicty_cDB: CFC647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available boxylase isozyme 3 mRNA, complete cds. 58 2e-07 2 CK273593 |CK273593.1 EST719671 potato abiotic stress cDNA ...', mRNA sequence. 64 2e-07 2 CD008053 |CD008053.1 VVB082D05_335234 An expressed sequence tag database for abiotic... VVB082D05 5, mRNA sequence. 64 4e-07 2 CD006712 |CD006712.1 VVB066D06_332552 An expressed sequence tag database for abiotic...NA sequence. 64 4e-07 2 CD719214 |CD719214.1 VVB158G03_410335 An expressed sequence tag database for abiotic

  2. Dicty_cDB: CFC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' sim...12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 ...9d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O6574...cima018l21, 5'end, single read. 46 7e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...quence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  3. Refrigeration CFC's recovery, reuse, alternatives and new legislation

    International Nuclear Information System (INIS)

    The industrialized nations of the world met in 1986 in Vienna, Austria, to discuss curbs on the production of chlorofluorocarbons (CFCs). Scientists had determined that these compounds, typically used as refrigerants, were accumulating in the upper layers of the earth's atmosphere. The chlorine atoms in the compounds were catalytically converting ozone in the stratosphere to oxygen, effectively reducing ozone levels. Ozone in the stratosphere serves as a protective shield, reflecting ultraviolet radiation (UV) from the sun from striking the earth's surface. The loss of this protective shield would result in increased UV radiation levels. Plant growth on land and plankton production in the seas would be stunted, altering the food chain. Severe climatic changes would also result. At the initial meeting in Vienna, and at a subsequent meeting in Montreal, the industrialized nations agreed to limit the production of CFCs based on 1986 worldwide production levels. This paper examines alternatives to the use of CFCs, their recovery and reuse, and new legislation governing their use

  4. Dicty_cDB: CFC585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PKPITXXA TTTXAAAVQLLQQXGFDQLPVVSESKKVLGQLTLGNLLSHIASKKAVPTDAXSKVMXRFX KNEKYIPITQS...*lnqplvtlvlv*h *qqpskvtk*slhsqrkchkrklms*KHWEQRSFVHQLKQHFDAPESHIGVAKK--- ---ixrfhxklydqtfk**lvsrqwfr*srxqn*r...DQQEEEKYHGAXVKXLTLPKPITXXA TTTXAAAVQLLQQXGFDQLPVVSESKKVLGQLTLGNLLSHIASKKAVPTDAXSKVMXRFX KNEKYIPITQSTSLATLSKF

  5. Dicty_cDB: CFC385 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LAGHMPSDTDAQVPELNV--- ---VSYXPQKXDPKXPGSVRELINKRICNTFLHXQFQSDVVKPLNIENIIDNQVLNLSGG ELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIIVSKVIXRF...NMRFR KDALTFKFSETAENEEEIKKHCNYKYPNMTKTMGTFKLEIKAGQFTDSEIIVMLGQNGTG KTTFIRMLAGHMPSDTDAQVPELNV--- ---cqlqxtkxrskixrf...- ---VSYXPQKXDPKXPGSVRELINKRICNTFLHXQFQSDVVKPLNIENIIDNQVLNLSGG ELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIIVSKVIXRF

  6. Dicty_cDB: CFC509 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dpm*ylnpscprktnphw*rrryss*inw*scqrsndptc*pnppq*rsc hhsrsplkcwwchciil*mvkesfsrsfrsfeqemgrilkeiiiric*isrqqeiir...ptryfh*fprch qhcrlcqslrdpm*ylnpscprktnphw*rrryss*inw*scqrsndptc*pnppq*rsc hhsrsplkcwwchciil*mvkesfsrsfrsfeqemgrilke

  7. Dicty_cDB: CFC343 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-20 3 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen ...for suppressing growth of plasmodium. 58 1e-18 6 BD183625 |BD183625.1 Material for diagnosing malaria and im

  8. Dicty_cDB: CFC754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NNNNINQNHQHQHQHHHHQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQXYGESTTSTXMIPPSITTSLTPLTPTLSSQPQN IQQQQQQXHHHQQQHHHH--- --...Frame A: TVGLLDINWGHYMIMTTNNNSNNNNNNNNNNNNNNNNNNNNNINQNHQHQHQHHHHQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQXYGESTTSTXM

  9. Dicty_cDB: CFC685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne*rkr*ti*rfrincl*kfyiks sygsiritfyk*icrrlsrfkilwwyrsc**irnslskesiesipfg*e*mgc*cstiqw *ssqfrslhsiikttrsyngfrftir...KKKISASSIFFESMPYQIGADGLI DYQRLEENA--- ---lfnv*ygslqwfsscsiigftirll*cchqyhs*nlkrttfrnhll*kr*ksrw*w* rn*rvrh*i

  10. Dicty_cDB: CFC757 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qaqahhqaaqahqaahhhhhqaaqvhhlqalhqaqvaqalh qaqaaqalh--- ---*ssssssssssssxxxx*sssxxx**sssxxxx***xxxrxxx...rxxsxxxx*xxxxx ssssxrxxxsss*xssxxrxxxcssxxxxxxcxxxxxsxxxxxxxxxxxxxxxxsxxxxs xxxx*xxxxxxxxxxsxxxxxxxxxxxxxxxxxxxx...ssxxxxxsxxxsssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssssssss...SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSS--- ---iiiiiiiiiiiixkxkxiiixxxmmiiixxxxxmmxxxkxxxkxxixkxxxxxxxx...i iiixkxxxiiimxxixxkkxxlfixxxxxxxxxxxxxxmxxxxlxxxxxlxxxxlxxxlx xxxxxxqxxxxlxxxqxxxxlxxxlxxxxxxxxxllxxxxllxxxxx

  11. Dicty_cDB: CFC748 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AETNKKLERLLISLNLLGGLIGGTNGPPIAASINTQNEPDNRQNAPIAQNFQQYQQNQPI PNQNQISNQNQISNQNQNQNQNQNQ--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxixkxxxkxxxxx...xxiignxxixvxxxkkxv xxhwxfxxxwkxxxmkxikrnlmnlxqf*mrfqifqf...ikikfqikikfqikikikikiki--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxnxxxl*gxxxxxxnxxkxxf xcigxsxxigkxxx

  12. Dicty_cDB: CFC703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence (All Frames) Frame A: ---ssxsssssssx*xxxxssxrxxxsssxrx**xxss*xxxxxxxxxxxx*xxx*xsss sxrxx*xss*xxx...**xrxxxxxxxxxxxcxxxxxsxxxxxcxxxxxxxxxxxxxxxxxxs xxxxxxxxxxxxsxxxxxxxxsxxxxxxxsxxxxsxxxxx...HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHQAQAAHQVQAQAVLAQAV LVQGRKXI*xi* Frame C: ---ixiiiiiiixmxxxxiixkxxxiiixkxmmxxiimxxxxxxxxmxxxxxxxxx...iiii xkxxmxiimxxxmmxkxxxxxxxxxxxxxxmxxxxmxxxxxxxxxxlxxxqxxxxlxxxq xxxxxxxxlxxxqxxxxlxxxlxxxxxxxxxllxxxxlxxxx...xxiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

  13. 77 FR 28639 - Meeting of the CFC-50 Commission

    Science.gov (United States)

    2012-05-15

    ...'' groups. The Commission is co-chaired by Thomas Davis and Beverly Byron. The meeting is open to the public... CONTACT: Keith Willingham, Director, Combined Federal Campaign, U.S. Office of Personnel Management,...

  14. Dicty_cDB: CFC518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxdnkkxvetxrcvsithvlhy*lnn Translated Amino Acid sequ...ence (All Frames) Frame A: ---ervkfknt*istmvxvfnxsp*slitslxlsqn*dlvvslssxfqkhtihhsxrnyn xlh*klkxxwtl*rnytf*x...YTSLRXKLQX SSLEIKEXLDTLEKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxd

  15. Early work on the stratospheric ozone depletion-CFC issue

    Science.gov (United States)

    Molina, M.

    2012-12-01

    I became involved with the atmospheric chemistry of chlorofluorocarbons (CFCs) shortly after joining Sherry Rowland's research group at the University of California, Irvine, in 1973. CFCs had been detected in the troposphere by James Lovelock in 1971, and the question we set out to answer was the fate of these compounds of industrial origin in the environment, as well as possibly identifying any consequences of their accumulation in the atmosphere. After examining many potential sinks for these compounds we realized that because of their unusual stability the most likely destruction process was photolysis in the stratosphere. I carried out measurements of the absorption spectra of these compounds in the near ultraviolet; previous work involved only spectra in the far ultraviolet, not relevant for atmospheric chemistry. The results indicated that photolysis would take place in the upper stratosphere. I subsequently carried out calculations using one-dimensional atmospheric models to estimate their atmospheric residence times, which turned out to be many decades. We realized that the chlorine atoms generated by photolysis of the CFCs would participate in a catalytic chain reaction that would efficiently destroy ozone. Furthermore, we estimated that the amount of CFCs produced industrially was comparable to the amount of nitric oxide produced naturally in the stratosphere by the decomposition of nitrous oxide; work by Paul Crutzen and Harold Johnston had indicated that the abundance of ozone in the stratosphere was controlled by nitric oxide. We then formulated the hypothesis that the continued release of CFCs to the environment posed a threat to the stability of the ozone layer, and published our results in the journal Nature in 1974. The publication was noticed almost exclusively by the community of experts in stratospheric chemistry, and hence Sherry Rowland and I decided at that time that it was our responsibility to communicate this finding to society at large, and particularly to decision makers in government, while at the same time promoting additional scientific research to test the validity of our hypothesis.

  16. Percepção dos contadores sobre o Exame de Suficiência do CFC = Accountant's perceptions about the Exam of Sufficiency of CFC

    Directory of Open Access Journals (Sweden)

    Nadielli Galvão

    2016-07-01

    Full Text Available O objetivo deste estudo é verificar a percepção dos contadores quanto à realização do Exame de Suficiência. Os dados foram coletados por meio de um survey com contadores cadastrados em grupos de discussão contábil em uma rede social. O instrumento de coleta de dados foi composto de perguntas acerca do perfil dos respondentes, da sua percepção quanto à realização e à abordagem da prova aplicada, e trouxe a oportunidade dos contadores destacarem sugestões para a melhoria da avaliação. Como principais resultados são destacados o fato de 81,82% dos respondentes acreditarem que o exame proporciona valorização profissional e 82,73% perceberem que o exame ajuda a selecionar os profissionais mais capacitados. 89,55% dos respondentes são a favor da continuidade da avaliação, 53,61% acreditam que esta avaliação necessita de algumas melhorias. A principal recomendação apontada pelos participantes foi a necessidade de uma melhor adequação da prova à realidade empresarial. The purpose of this study was to verify the accountant's perceptions about the realization of exam of sufficiency. The data was collected by a survey with accountants cadastrated in a group of accounting discussion in a social network. The instrument of collect data was compost with questions about the profile of respondents, their perceptions about the realization and test approach, as well as brought the opportunity of accountants stand out suggestions for improving evaluation. How main results are outstanding the fact that 81,82% of respondents believe that the exam bring professional valorization and 82,73% realize the exam help to select the professionals more qualified. 89,55% of answerer are in favor that the continuity of exam, but 53,61% believe that is necessary some improvements. The main recommendation indicated by respondents was the necessity a better adequation of the test to reality of organizations.

  17. Raman study of CFC tiles extracted from the toroidal pump limiter of Tore Supra

    OpenAIRE

    Pardanaud, C.; Giacometti, G.; Martin, C; Ruffe, R.; Angot, T.; Areou, E.; Pegourie, B.; Tsitrone, E.; Dittmar, T.; Hopf, C.; Jacob, W.; Schwarz-Selinger, T.; Roubin, P.

    2011-01-01

    The structure of six tiles extracted from the erosion and deposition zones (thin and thick deposition) of the Tore Supra toroidal pump limiter (TPL) have been analysed in the framework of the DITS campaign using micro-Raman spectroscopy. This post-mortem analysis gives information on both carbon structure and D content. We have found that the carbon structure is most often similar to that of plasma-deposited hard amorphous carbon layers. The role of the surface temperature during the discharg...

  18. IDENTIFICATION OF CFC AND HCFC SUBSTITUTES FOR BLOWING POLYURETHANE FOAM INSULATION PRODUCTS

    Science.gov (United States)

    The report gives results of a cooperative effort to identiry chlorofluorocarbons and hydrochlorofluorocarbon substitutes for blowing polyurethane foam insulation products. The substantial ongoing effort is identifying third-generation blowing agets for polyurethane foams to repla...

  19. Moving Advanced Desiccant Materials into Mainstream Non-CFC Cooling Products

    Energy Technology Data Exchange (ETDEWEB)

    Sand, J. R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Grossman, T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rice, C. K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Fairchild, P. D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gross, I. L. [Engelhard/ICC, Hatboro, PA (United States). Fresh Air Solutions

    2004-12-30

    Desiccant dehumidification technology is emerging as a technically viable alternative for comfort conditioning in many commercial and institutional buildings. Attempts to improve the indoor air quality of buildings has resulted in increasingly stringent guidelines for occupant outdoor air ventilation rates. Additionally, revised building heating, ventilating, and air-conditioning (HVAC) design criteria based on regional peak dew point data highlight the important of the latent (moisture removal) building load relative to the sensible (temperature) building load.

  20. Thermo-mechanical tests of a CFC divertor mock-up

    Science.gov (United States)

    Cardella, A.; Akiba, M.; Duwe, R.; Di Pietro, E.; Suzuki, S.; Satoh, K.; Reheis, N.

    1994-04-01

    Thermo-mechanical tests have been performed on a divertor mock-up consisting of a metallic tube armoured with five carbon fibre composite tiles. The tube is inserted inside the tiles and brazed with TiCuSil braze (monoblock concept). The tube material is TZM, a molybdenum alloy, and the armour material is SEP CARB N112, a high conductivity carbon-carbon composite. Using special surface preparation consisting of laser drilling, small (˜- 500 μm) holes in the composite have been made to increase the surface wetted by the braze and the resistance. The mock-up has been tested at the JAERI 400 kW electron beam test facility JEBIS. The aim of the test was to assess the performance of the mock-up in screening and thermal fatigue tests with particular attention to the behaviour of the armour to heat sink joint.

  1. Evaporation and vapor shielding of CFC targets exposed to plasma heat fluxes relevant to ITER ELMs

    International Nuclear Information System (INIS)

    Carbon fibre composite NB31 was tested at plasma gun facility MK-200UG by plasma heat fluxes relevant to Edge Localised Modes in ITER. The paper reports the results obtained on the evaporation threshold of carbon fibre composite, the velocity of carbon vapor motion along and across the magnetic field lines, and the parameters of carbon plasma such as temperature, density and ionization state. First experimental results on investigation of the vapor shield onset conditions are presented also. The obtained experimental data are compared with the results of numerical modeling.

  2. Decomposition of CFC and Halon waste gases in normal-pressure plasma reactors

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    The normal-pressure decomposition of CF2Cl2 and CF2ClBr in air by non-equilibrium plasma was studied. The pressure of CF2Cl2 and CF2ClBr was 2.67x103Pa, added the dry air to 1.01 x 105 Pa, discharged by corona or DBD, 11.5% of CF2ClBr was decomposed by corona after 120s discharge, more than 85% of CF2Cl2 and 95% of CF2ClBr was decomposed by DBD after 10s discharge respectively. The main products were CF2O, Cl2 and Br2.

  3. Energy and global warming impacts of CFC alternative technologies for foam building insulations

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCS) have been used as blowing agents in foam insulation, as the working fluids in cooling and refrigeration equipment, and as solvents in general and precision cleaning applications since their introduction in the 1930s. The number of applications and volumes of CFCs used grew at a tremendous pace during the 1960s and 1970s, but in the mid-1980s it was confirmed that these extremely useful chemicals contribute to the destruction of stratospheric zone and that they are the primary cause of the CFCs have also been found to be second only to carbon dioxide as a factor causing increased greenhouse warming. These chemicals are being phased out of use rapidly to protect the ozone layer and it is very important that the replacements for CFCs do not result in a net increase in global warming by introducing less efficient processes that lead to higher energy use and increased carbon dioxide emissions. A study was conducted to identify those alternative chemicals and technologies that could replace CFCs in energy related applications before the year 2000, and to assess the total potential impact of those alternatives on global warming. The analysis for this project included an estimate of the direct effects from the release of blowing agents, refrigerants, and solvents into the atmosphere and the indirect effects of carbon dioxide emissions resulting from energy use for commercial and residential building insulation, household and commercial refrigeration, building and automobile air conditioning, and general metal and electronics solvent cleaning. This paper focuses on those aspects of the study relevant to building insulation. In general the hydrofluorocarbon (HFC) and hydrochlorofluorocarbon alternatives for CFCs lead to large and sometimes dramatic reductions in total equivalent warming impact, lifetime equivalent C02 emissions (TEWI). Most of the reductions result from decreased direct effects without significant changes in energy use

  4. Potential CFC replacements: Tropospheric lifetimes of C 3 hydrofluorocarbons and hydrofluoroethers

    Science.gov (United States)

    Cooper, David L.; Cunningham, Terry P.; Allan, Neil L.; McCulloch, Archie

    Attack by tropospheric hydroxyl radicals results in much shorter residence times for hydrofluorocarbons (HFCs) than for the fully halogenated chlorofluorocarbons (CFCs). Empirical structure-activity relations, previously calibrated for HFCs containing two carbon atoms, are used with semi-empirical and ab initio calculations to provide realistic first estimates of tropospheric lifetimes of various chlorine-free HFCs and hydrofluoroethers (HFEs) containing three carbon atoms. The heavily fluorinated HFEs are of particular interest in that they are likely to possess thermophysical properties which are suited to a range of applications for which CFCs are currently employed. Many of the HFEs are predicted to have shorter lifetimes than HFC-134a (CF 3CH 2F), which is already in large-scale commercial production as an alternative refrigerant. Factors are identified which appear to favour short lifetimes for HFEs.

  5. Replacement of CFCs in thermodynamical systems; Remplacement des CFC dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Some chlorofluorocarbons (CFCs) are well-adapted to coldness production by vapour compression and thus are widely used in the storage of agriculture-food products from the production to the domestic consumer but also in air-conditioning systems and heat pumps. Atmospheric impacts of the use of CFCs (`ozone hole`) led the international community to adopt remedial measures which aim to prohibit the production of CFCs. These constraints led the users of refrigerating fluids to use substitution fluids and to develop new techniques of energy recovery and heat/coldness production. This workshop takes stock of this situation and of the problems encountered by the various actors involved in the replacement of CFCs in thermodynamical systems: evolutions of regulation, point of view of refrigerating fluid producers and of compressors and heat exchangers manufacturers, research studies on substitution fluids, recovery of CFCs and other refrigerating fluids, revival in the use of natural fluids (like ammonia), and use of new thermodynamical systems like compression/absorption (water/ammonia) cycles. (J.S.)

  6. Catalytic Decomposition of CFC-12 over Heteropolyacids%杂多酸催化分解氟里昂-12

    Institute of Scientific and Technical Information of China (English)

    马臻; 华伟明; 唐颐; 高滋

    2000-01-01

    @@ Chlorine atoms from chlorofluorocarbons (CFCs) deplete stratospheric ozone and CFCs are green-house gases too. Owing to these environmental problems, many kinds of CFCs have been banned since the Montreal Protocol and two kinds of cleaning techniques have been developed. One is the synthesis of CFCs alternatives[1,2] and the other is the decomposition of banned CFCs in existing equipments[3,4].

  7. Fluticasone Propionate, 100 µg bid, Using a Non-CFC Propellant, HFA 134a, in Asthmatic Children

    Directory of Open Access Journals (Sweden)

    Brian Lyttle

    2003-01-01

    Full Text Available BACKGROUND: Secondary to phasing out chlorofluorocarbons (CFCs, the fluticasone propionate (FP pressurized metered-dose inhaler has been formulated in a nonozone-depleting propellant, hydrofluoralkane (HFA 134a.

  8. 40 CFR Appendix F to Subpart B of... - Standard for Recover-Only Equipment That Extracts a Single, Specific Refrigerant Other Than CFC...

    Science.gov (United States)

    2010-07-01

    ...—Available from Air Conditioning and Refrigeration Institute, 1501 Wilson Boulevard, Sixth Floor, Arlington... Standard, 49 CFR 173.304—Shippers—General Requirements for Shipments and Packagings. 2.1.5 UL Publications... affect the proper operation of the equipment. Operation manuals must cover information for...

  9. ANÁLISE EXPERIMENTAL DO HIDROCARBONETO R290 PARA A SUBSTITUIÇÃO DO CFC12 EM REFRIGERADOR DOMÉSTICO

    Directory of Open Access Journals (Sweden)

    Jucelino Gomes da Silva

    2011-03-01

    Full Text Available Recentemente, muita atenção tem sido dada aos chamados fluidos naturais, que são menos agressivos ao meio ambiente e também apresentam grande importância na necessidade latente do aumento da eficiência energética dos equipamentos em comparação aos fluidos sintéticos. O presente trabalho trata de uma análise experimental do hidrocarboneto propano (R290 como fluido refrigerante em um bebedouro de água potável projetado para operar com R12 numa estratégia de drop-in. O bebedouro foi preparado através da instalação de um manômetro na linha de alta pressão e um na linha de baixa pressão, termopares em cinco pontos estratégicos do ciclo termodinâmico: sucção do compressor, descarga do compressor, saída do condensador, entrada do evaporador e saída do evaporador, além da medição da temperatura da água e do ambiente. O ensaio de abaixamento de temperatura foi realizado durante 90 minutos sem atuação do termostato. A carga do hidrocarboneto propano (R290 aplicado ao equipamento foi reduzida em 61,5% com relação ao R12. Foram monitorados os dados de pressões de sucção e descarga do compressor, corrente elétrica consumida pelo compressor e temperaturas nos pontos do ciclo de refrigeração. Os parâmetros obtidos do ensaio foram comparados através do uso do software Coolpack, onde os diagramas pressão-entalpia (P-h para os fluidos foram obtidos e as características operacionais de trabalho de compressão, efeito refrigerante, efeito de condensação e coeficiente de performance (COP foram estudadas. Os resultados obtidos demonstraram um consumo de corrente elétrica 30% inferior em relação à operação com R12, porém, com muitas oscilações durante o tempo. As pressões para o R290 se apresentaram maiores em comparação com o R12. A razão de pressões do R290 foi 28% menor que para o R12. Após 16 minutos de funcionamento ocorreu a formação de gelo na serpentina do evaporador. O COP obtido para o R290 foi de 2,60, enquanto que para o R12 foi de 2,43. A utilização do hidrocarboneto se mostrou eficiente para o equipamento de pequeno porte. Sendo compatível com o óleo do compressor e não necessitando de substituição de nenhum componente do sistema além de permitir a redução da quantidade de fluido refrigerante do sistema. PALAVRAS-CHAVE: eficiência energética, propano, refrigerador doméstico; drop-in.

  10. Experimental SF6/-//SF6 and Cl/-//CFC13 electron-attachment cross sections in the energy range 0-200 meV

    Science.gov (United States)

    Chutjian, A.

    1981-01-01

    Experimental cross sections for the electron-attachment processes for SF6(-)/SF6 and Cl(-)/CFl3 are reported in the energy range 0-200 meV by normalizing each attachment line shape to measurement of a thermal rate coefficient. When the same ion states are detected, good agreement is found between present values, for which a monoenergetic electron source is used, and swarm-unfolded results. The present data constitute a new limit for cross sections reported at high resolution at the lowest electron energy.

  11. Greater repertoire and temporal variability of cross-frequency coupling (CFC modes in resting-state neuromagnetic recordings among children with reading difficulties

    Directory of Open Access Journals (Sweden)

    Stavros I Dimitriadis

    2016-04-01

    Full Text Available AbstractCross-frequency, phase-to-amplitude coupling (PAC between neuronal oscillations at rest may serve as the substrate that supports information exchange between functionally specialized neuronal populations both within and between cortical regions. The study utilizes novel algorithms to identify prominent instantaneous modes of cross-frequency coupling and their temporal stability in resting state magnetoencephalography (MEG data from 23 students experiencing severe reading difficulties (RD and 27 age-matched non-impaired readers (NI.Phase coherence estimates were computed in order to identify the prominent mode of PAC interaction for each sensor, sensor pair, and pair of frequency bands (from δ to γ at successive temporal segments of the continuous MEG record. The degree of variability in the characteristic frequency-pair PACf1-f2 modes over time was also estimated. Results revealed a wider repertoire of prominent PAC interactions in RD as compared to NI students, suggesting an altered functional substrate for information exchange between neuronal assemblies in the former group. Moreover, RD students showed significant variability in PAC modes over time. This temporal instability of PAC values was particularly prominent: (a within and between right hemisphere temporal and occipitotemporal sensors and, (b between left hemisphere frontal, temporal, and occipitotemporal sensors and corresponding right hemisphere sites. Altered modes of neuronal population coupling may help account for extant data revealing reduced, task-related neurophysiological and hemodynamic activation in left hemisphere regions involved in the reading network in RD. Moreover, the spatial distribution of pronounced instability of cross-frequency coupling modes in this group may provide an explanation for previous reports suggesting the presence of inefficient compensatory mechanisms to support reading.

  12. Toxicology evaluation and hazard review for non-CFC containing rigid foams BKC 44317 and last-a-foam MSL-02A

    Energy Technology Data Exchange (ETDEWEB)

    Greulich, K.A.; Archuleta, M.M.

    1996-06-01

    New pour-in-place, low density, rigid polyurethane foam kits have been developed to mechanically stabilize damaged explosive ordnance. Although earlier foam systems used chlorofluorocarbons as blowing agents, the current versions rely on carbon dioxide generated by the reaction of isocynates with water. In addition, these kits were developed to manually generate small quantifies of rigid foam in the field with minimal or no protective equipment. The purpose of this study was to evaluate and summarize available hazard information for the components of these rigid foam kits and to provide recommendations for personal protective equipment to be used while performing the manual combination of the components. As with most rigid foam systems, these kits consist of two parts, one a mixture of isocyanates; the other, a combination of polyols, surfactants, and amine catalysts. Once completely deployed, the rigid foam is non-toxic. The components, however, have some important health effects which must be considered when establishing handling procedures.

  13. Residence time distribution in a large unconfined-semiconfined aquifer in the Argentine Pampas using 3H/3He and CFC tracers

    Science.gov (United States)

    Martínez, D. E.; Fourré, E.; Londoño, O. M. Quiroz; Jean-Baptiste, P.; Galli, M. Glok; Dapoigny, A.; Grondona, S. I.

    2016-08-01

    The Pampa region in Argentina includes vast unconfined-semiconfined aquifers that local economies depend upon, but detailed knowledge of the associated water resources is still lacking. The Pampeano aquifer in the Pampa plain of Argentina covers around 1.5 million km2. In order to achieve a better understanding of the hydrogeological system through the estimation of mean residence times (MRT), water samples were taken from 12 monitoring wells, drilled at different depths in four locations, and analyzed for environmental tracers. The concentrations of 3H, tritiogenic 3He and chlorofluorocarbons (CFCs) can be explained by mixtures of young waters adjusted to exponential piston flow models (EPM) or dispersion models (DM), and different proportions of tracer-free waters (dead water). The sampling site located very close to the water divide shows a dominance of young waters: 85 % of water best represented by a DM model with a MRT of 3 years. For the shallow wells at other sites, best-fitting models result in a DM with MRT between 20 and 35 years, and proportions of dead water between 40 and 60 %. These results lead to important updates in the conceptual model of the Pampeano aquifer. Large proportions of dead water at a few meters depth can be the consequence of upward flows in a multilayered aquifer or diffusive retardation in the inter-bedded clay layers.

  14. 40 CFR Appendix E to Subpart B of... - The Standard for Automotive Refrigerant Recycling Equipment Intended for Use With Both CFC-12 and...

    Science.gov (United States)

    2010-07-01

    ... cannot exceed 80% of volume at 21.1 °C of its maximum rating as defined by DOT standards, 49 CFR 173.304... noncondensable gas purging, oil removal, and refrigerant clearing shall not exceed more than 5 percent by weight... serviced has a leak), filter/desiccant replacement, and purging of noncondensable gases (air)....

  15. Diffusion of interstitial Dumbell in FCC concentrated alloys: connection with the percolation; Diffusion du defaut interstitiel dans un alliage concentre de structure CFC: lien avec la percolation

    Energy Technology Data Exchange (ETDEWEB)

    Bocquet, J.L.

    1993-12-31

    The migration mechanism of the interstitial dumbbell in a FCC (face centered cubic) lattice constrains its path on a sublattice with a coordination number of 8. In a random binary alloy AB, in which only species B has a noticeable mobility, the long range migration of the dumbbell defect is possible only if the concentration of B is larger than the percolation threshold {rho}{sub c} on the sublattice. Standard techniques have been employed to get a first evaluation of this threshold: the cluster density n(s) is obtained after an automatic counting of the clusters up to a size of 15 and a d-Log Pade approximants analysis of the various moments of this density function is performed. The use of a recent conjecture concerning the critical behaviour of the moments of n(s) in the neighbourhood of {rho}{sub c} helps us to extract simultaneously from our data reasonable values of the critical exponents {beta} and {alpha}, together with a value of {rho}{sub c} = 0.2780 + 0.0005. (Author). 16 refs., 15 figs., 7 tabs.

  16. 26 CFR 52.4682-3 - Imported taxable products.

    Science.gov (United States)

    2010-04-01

    ... affect tax liability. (iv) Example. The application of this paragraph (c)(3) may be illustrated by the...-113 0.0022 Telephone answering machines 8520.20 CFC-113 0.1 Color video recording/reproducing... 9401 CFC-11 0.30 Foam sofas 9401 CFC-11 0.75 Foam mattresses 9404.21 CFC-11 1.60 Electronic games...

  17. Transport and degradation of chlorofluorocarbons (CFCs) in the pyritic Rabis Creek aquifer, Denmark

    DEFF Research Database (Denmark)

    Hinsby, K.; Hojberg, A.L.; Engesgaard, P.;

    2007-01-01

    Vertical profiles of the chlorofluorocarbons CFC-11, CFC-12, and CFC-113 penetrating aerobic and anaerobic parts of a shallow sandy aquifer show that the CFC gases are degraded in the .... Two-dimensional solute transport simulations with either zero-order or first-order degradation in the anaerobic zone corroborate this interpretation. The transport model was previously calibrated against detailed tritium profiles in the same wells. First-order degradation is found to best match...... the observed CFC profiles yielding an approximate half-life of a few months for CFC-11. Degradation is not as clearly recognized for CFC-12 and CFC-113, but it may occur with rates corresponding to a half-life of a few years or more. Data indicate a geochemical control of the CFC concentration gradient...

  18. Characteristics and treatment of temporal lobe epilepsy with a history of complicated febrile convulsion

    OpenAIRE

    Kanemoto, K.; Takuji, N.; Kawasaki, J.; Kawai, I.

    1998-01-01

    This study aimed to examine the close correlation between complicated febrile convulsions (CFC) and medial temporal lobe epilepsy and to delineate characteristics of temporal lobe epilepsy with CFC. Patients with temporal lobe epilepsy were divided into those with a prior episode of CFC (n=52), those with febrile convulsions other than CFC, and those witout either (n=345). Clinical constellations, neuroimaging, drug resistance, and effects of temporal lobectomy of the three gro...

  19. Pengetahuan, Sikap dan Tindakan Pemilik Bengkel AC Mobil Tentang Pemakaian CFC Sebagai Polutan Gas Rumah Kaca Pada Bengkel AC Mobil di Kelurahan Petisah Tengah Kecamatan Medan Petisah Tahun 2010.

    OpenAIRE

    Nasution, Gabriella Septiani

    2011-01-01

    Atmospheric temperature was determined by the levels of gases called green house gases that could cause the greenhouse effect causing global warming and ozone depletion. Chlorofluorocarbon (CFCs) was one type of greenhouse gases, one of which comes from automobile air conditioner servicing activities. This problem occurred since the use of air conditioner contained freon or refrigerant fake which is unsafe for environment and the occurrence of leaks in car air conditioning servicing process. ...

  20. Dislocations and elementary processes of plasticity in FCC metals: atomic scale simulations; Dislocations et processus elementaires de la plasticite dans les metaux CFC: apports des simulations a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodney, D

    2000-07-01

    We present atomic-scale simulations of two elementary processes of FCC crystal plasticity. The first study consists in the simulation by molecular dynamics, in a nickel crystal, of the interactions between an edge dislocation and glissile interstitial loops of the type that form under irradiation in displacement cascades. The simulations show various atomic-scale interaction processes leading to the absorption and drag of the loops by the dislocation. These reactions certainly contribute to the formation of the 'clear bands' observed in deformed irradiated materials. The simulations also allow to study quantitatively the role of the glissile loops in irradiation hardening. In particular, dislocation unpinning stresses for certain pinning mechanisms are evaluated from the simulations. The second study consists first in the generalization in three dimensions of the quasi-continuum method (QCM), a multi-scale simulation method which couples atomistic techniques and the finite element method. In the QCM, regions close to dislocation cores are simulated at the atomic-scale while the rest of the crystal is simulated with a lower resolution by means of a discretization of the displacement fields using the finite element method. The QCM is then tested on the simulation of the formation and breaking of dislocation junctions in an aluminum crystal. Comparison of the simulations with an elastic model of dislocation junctions shows that the structure and strength of the junctions are dominated by elastic line tension effects, as is assumed in classical theories. (author)

  1. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  2. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase) over the South Coast Air Basin of California

    Science.gov (United States)

    Barletta, B.; Nissenson, P.; Meinardi, S.; Dabdub, D.; Sherwood Rowland, F.; Vancuren, R. A.; Pederson, J.; Diskin, G. S.; Blake, D. R.

    2011-03-01

    This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB), which includes much of Los Angeles (LA) County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg) and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg) in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO) enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr-1 for HFC-152a and 2.12 ± 0.28 Gg yr-1 for HFC-134a) and then extrapolated to the United States (32 ± 4 Gg yr-1 for HFC-152a and 43 ± 6 Gg yr-1 for HFC-134a) using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  3. Evaluation of Environment Impact of Trifluoroacetates from the Degradation of CFC Substitutes%氟里昂替代品降解产物TFA对生态环境的影响评价

    Institute of Scientific and Technical Information of China (English)

    万小春; 胡建信; 张剑波

    2001-01-01

    氟里昂替代品的降解产物三氟乙酸(TFA)可以在水体中稳定存在,无明显的光解和生物降解,TFA以致在一些水体中不断累积.预计到2010年大气中TFA的含量可达到5~20pg/m3,降水中其含量可达到100~160ng/L.累积到一定的浓度时,TFA对生态系统包括动植物的危害是明显的,可抑制植物生长,并对动物造成伤害.

  4. The GEF project of China energy saving and CFC free refrigerator established%GEF节能项目启动中国节能氟时昂替代电冰箱项目正式启动

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ 记者:我刊在今年的第一期曾有过关于中国节能电冰箱项目启动的报道,了解到该项目的总体情况,您是否能具体谈谈该项目的组织机构?项目将如何实施?

  5. CFC-空间的Browder不动点定理及其对重合问题的应用%The Browder Fixed Point Theorem in GFC-Spaces and Its Applications to Coincidence Questions

    Institute of Scientific and Technical Information of China (English)

    文开庭

    2013-01-01

    利用KKM技巧和GFC-空间中的Browder不动点定理,建立了GFC-空间中弱转移紧开值集值映射的极大元定理.作为应用,研究了GFC-空间中Ky Fan截口定理、Ky Fan相交定理和重合定理.我们的结论统一、改进和推广了一些近期文献的已知结果.

  6. MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR

    Science.gov (United States)

    The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...

  7. Study of Dissolved Chlorofluorocarbons in Lake Washington

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Measurements of three chlorofluorocarbons (CFCs): trichlorofluoromethane (CFC-11), dichlorodifluoromethane (CFC-12) and trichlorotrifluoroethane (CFC 113), along with methyl chloroform (CH3CCl3) and carbon tetrachloride (CCl4) were made in water samples from Lake Washington, using Electron Capture Gas Chromatography (EC GC). The samples were collected in mid autumn, a period when the lake's upper layer undergoes rapid cooling. At the time of sampling, a strong vertical temperature gradient was present in the lake, with surface temperatures of ~14℃, and near bottom (50 meters) temperatures of ~8℃. The concentrations of dissolved CFC 12 and CFC 11 increased with depth, as expected from the higher solubilities of these gases at lower temperatures. Atmospheric measurements made at the sampling site at the time of the cruise, showed that CFC 11 and CFC 12 saturations in the near surface samples were 100 % and 106%, respectively. For the deepest sample (52 meters) CFC 11 and CFC 12 saturations were 102 % and 126 %. Because the surface layer of the lake responds to changes in atmospheric CFCs on a time scale of several weeks, the higher than equilibrium concentrations of CFC 12 observed at the time of sampling may reflect earlier episodes of elevated levels of atmospheric CFC 12 in this urban area. High concentrations of dissolved CFCs in runoff or industrial effluent might also lead to elevated CFC levels in the lake. The cold, deep water of Lake Washington is relatively isolated from the effects of surface gas exchange except during winter, and the supersaturations observe in the deep layer may reflect periods of elevated atmospheric CFC 12 levels from the previous winter season. These results were compared to summertime profiles of CFC 11 and CFC 12 made in 1994.

  8. Groundwater recharge and flow on Montserrat, West Indies: Insights from groundwater dating

    Directory of Open Access Journals (Sweden)

    Brioch Hemmings

    2015-09-01

    New hydrological insights: δ2H and δ18O analysis indicates uniform recharge elevations for groundwaters on Montserrat. CFC-11 and CFC-12 analysis reveals age differences between isotopically similar, high elevation springs and low elevation aquifer waters. Low CFC concentrations within a confined low elevation aquifer suggest water ages of ∼45 years. High CFC concentrations in the northern and western springs are explained by rapid infiltration of cool (high CFC concentration rainfall into saturated compartments, with flow through the vadose zone to the phreatic zone dominated by compartment flow. Lower CFC concentrations in a number of aligned warmer springs suggest a contribution from older, warmer waters from depth. Temperatures and CFC concentrations indicate older component supply rates of up to 8 L/s to the highest yielding spring on Centre Hills, with contributions of up to 75% in the warmest spring waters.

  9. X-ray micro-tomography studies on carbon based composite materials for porosity network characterization

    International Nuclear Information System (INIS)

    Quantitative characterization of the porosity structure of the carbon reinforced carbon fibre (CFC) materials is carried out by high resolution cone-beam X-ray micro-tomography (CBμCT). It is shown that CBμCT provides useful information pertaining to the in-depth fuel migration into carbon tiles function of the CFC material structure. The investigated materials comprised two types of non-irradiated CFC samples (former ITER reference CFC NB31 and JET CFC DMS780) and a series of CFC N11 samples in the frame of the Deuterium Inventory in Tore Supra (DITS) post-mortem analysis. A procedure for the quantitative evaluation of the CFC porosity factor has been introduced and tested. Useful information about the pores connectivity as well as the metal impregnation inside the CFC macroscopic pores, in case of heat sink region of the TS CFC, can be retrieved. The method can be used for the quality control monitoring of the new CFC ITER reference materials.

  10. Noaa chlorofluorocarbon tracer program air and seawater measurements: 1986-1989. Data file

    International Nuclear Information System (INIS)

    The NOAA Chlorofluorocarbon (CFC) Tracer Program at PMEL has been measuring the growing burden of these anthropogenic gases in the thermocline waters of the Pacific Ocean since 1980. The central goals of the NOAA CFC Tracer Program are to document the transient invasion of the CFC tracers into the Pacific Ocean, by means of repeat occupations of key hydrographic sections at 5-year intervals, and to interpret these changing distributions in terms of coupled ocean-atmosphere models. Studies are underway to use the CFC observations in model-validation studies, and to help develop predictive capabilities on the decade-to-century timescale. The report includes measurements of trichlorofluoromethane (CFC-11) and dichlorodifluoromethane (CFC-12) dissolved in seawater samples collected in the Pacific Ocean by the NOAA CFC Tracer Program on six cruises during the period of 1986-1989. Measurements of depth, pressure, salinity, temperature, and dissolved oxygen are included with the CFC data. Measurements of CFC-11 and CFC-12 in air samples collected along the cruise tracks are also included in the report. Data from the report are also available from the authors in digital format

  11. Neuroleptic Drugs Revert the Contextual Fear Conditioning Deficit Presented by Spontaneously Hypertensive Rats: A Potential Animal Model of Emotional Context Processing in Schizophrenia?

    OpenAIRE

    Calzavara, Mariana Bendlin; Medrano, Wladimir Agostini; Levin, Raquel; Kameda, Sonia Regina; Andersen, Monica Levy; Tufik, Sergio; Silva, Regina Helena; Frussa-Filho, Roberto; Abílio, Vanessa Costhek

    2008-01-01

    Schizophrenia, bipolar disorder, and attention deficit/hyperactivity disorder (ADHD) present abnormalities in emotion processing. A previous study showed that the spontaneously hypertensive rats (SHR), a putative animal model of ADHD, present reduced contextual fear conditioning (CFC). The aim of the present study was to characterize the deficit in CFC presented by SHR. Adult male normotensive Wistar rats and SHR were submitted to the CFC task. Sensitivity of the animals to the shock and the ...

  12. Updating hydrogen fluoride (HF) FTIR time series above Jungfraujoch: comparison of two retrieval algorithms and impact of line shape models

    OpenAIRE

    Duchatelet, Pierre; Demoulin, Philippe; Hase, Frank; Mahieu, Emmanuel; Bernath, Peter; Boone, Chris; Walker, Kaley

    2010-01-01

    Fluorine enters the stratosphere mainly in the form of chlorofluorocarbons (CFCs; principally CFC-11 and CFC-12) and tetrafluoromethane (CF4), which have been widely emitted at ground level by human activities over the past few decades. In the lower stratosphere, the photolysis of the long-lived CFC-11 (CCl3F) and CFC-12 (CCl2F2), whose emissions from the ground have been progressively phased out by the Montreal Protocol and its successive Amendments and Adjustments, leads to the formation of...

  13. Competition Policy in Mexico

    OpenAIRE

    Ernesto Estrada Gonzalez

    2008-01-01

    The CFC faces significant challenges from cartel activity, prevailing regulatory restrictions on competition, and exclusionary practices undertaken by some of the most powerful corporations in Mexico.

  14. Characteristics and treatment of temporal lobe epilepsy with a history of complicated febrile convulsion.

    Science.gov (United States)

    Kanemoto, K; Takuji, N; Kawasaki, J; Kawai, I

    1998-02-01

    This study aimed to examine the close correlation between complicated febrile convulsions (CFC) and medial temporal lobe epilepsy and to delineate characteristics of temporal lobe epilepsy with CFC. Patients with temporal lobe epilepsy were divided into those with a prior episode of CFC (n=52), those with febrile convulsions other than CFC, and those without either (n=345). Clinical constellations, neuroimaging, drug resistance, and effects of temporal lobectomy of the three groups were compared. A close association between CFC and temporal lobe epilepsy was confirmed. The salient features of temporal lobe epilepsy with CFC were early age at onset of habitual seizures (about 10 years), the predominance of autonomic auras, and a high incidence of MRI evidence of unilateral medial temporal sclerosis. Patients with temporal lobe epilepsy with prior CFC had an excellent outcome after surgery, by contrast with an unfavourable response to drug therapy. The surgical results were discouraging in patients with temporal lobe epilepsy without history of any febrile convulsions and without solid brain tumours. These results indicate surgical intervention as the choice of therapy in a substantial number of patients with temporal lobe epilepsy with a history of CFC. PMID:9489540

  15. The WNT/β-catenin pathway is involved in the anti-adipogenic activity of cerebrosides from the sea cucumber Cucumaria frondosa.

    Science.gov (United States)

    Xu, Hui; Wang, Fei; Wang, Jingfeng; Xu, Jie; Wang, Yuming; Xue, Changhu

    2015-07-01

    Both adipocyte hypertrophy and hyperplasia lead to obesity. Here, we isolated cerebrosides from the sea cucumber Cucumaria frondosa (CFC) and examined its anti-adipogenic activity in vitro. CFC inhibited the lipid accumulation of 3T3-L1 cells and suppressed PPARγ and C/EBPα expressions, proving its anti-adipogenic activity. Furthermore, CFC suppressed lipogenesis in mature adipocytes. The WNT/β-catenin pathway acts as an anti-adipogenic factor. CFC enhanced β-catenin expression, promoted its nuclear translocation and up-regulated the expression of CCND1 and c-myc, two target genes of β-catenin. Moreover, after cells were treated with the β-catenin inhibitor 21H7, β-catenin nuclear translocation and transcription activity can be recovered by CFC. These findings suggested that CFC promoted the activation of the WNT/β-catenin pathway. Besides, CFC enhanced the expressions of Fz1, LRP5 and LRP6, while it had no effect on the expressions of Wnt10b and GSK3β. These findings indicated that CFC exhibits anti-adipogenic activity through enhancing the activation of the WNT/β-catenin pathway, which was mediated by FZ and LRPs. PMID:26091058

  16. Subsidizing "Stayers"? Effects of a Norwegian Child Care Reform on Marital Stability

    Science.gov (United States)

    Hardoy, Ines; Schone, Pal

    2008-01-01

    Since January 1999, all parents in Norway with children aged 1 to 3 years who do not attend publicly subsidized day care are eligible for "cash-for-care" (CFC). One important purpose of the reform is to enable parents to spend more time with their children. We analyze whether the CFC reform has affected marital stability, using individual register…

  17. Neuroleptic drugs revert the contextual fear conditioning deficit presented by spontaneously hypertensive rats: a potential animal model of emotional context processing in schizophrenia?

    Science.gov (United States)

    Calzavara, Mariana Bendlin; Medrano, Wladimir Agostini; Levin, Raquel; Kameda, Sonia Regina; Andersen, Monica Levy; Tufik, Sergio; Silva, Regina Helena; Frussa-Filho, Roberto; Abílio, Vanessa Costhek

    2009-07-01

    Schizophrenia, bipolar disorder, and attention deficit/hyperactivity disorder (ADHD) present abnormalities in emotion processing. A previous study showed that the spontaneously hypertensive rats (SHR), a putative animal model of ADHD, present reduced contextual fear conditioning (CFC). The aim of the present study was to characterize the deficit in CFC presented by SHR. Adult male normotensive Wistar rats and SHR were submitted to the CFC task. Sensitivity of the animals to the shock and the CFC performance after repeated exposure to the task were investigated. Pharmacological characterization consisted in the evaluation of the effects of the following drugs administered previously to the acquisition of the CFC: pentylenetetrazole (anxiogenic) and chlordiazepoxide (anxiolytic); methylphenidate and amphetamine (used for ADHD); lamotrigine, carbamazepine, and valproic acid (mood stabilizers); haloperidol, ziprasidone, risperidone, amisulpride, and clozapine (neuroleptic drugs); metoclopramide and SCH 23390 (dopamine antagonists without antipsychotic properties); and ketamine (a psychotomimmetic). The effects of paradoxical sleep deprivation (that worsens psychotic symptoms) and the performance in a latent inhibition protocol (an animal model of schizophrenia) were also verified. No differences in the sensitivity to the shock were observed. The repeated exposure to the CFC task did not modify the deficit in CFC presented by SHR. Considering pharmacological treatments, only the neuroleptic drugs reversed this deficit. This deficit was potentiated by proschizophrenia manipulations. Finally, a deficit in latent inhibition was also presented by SHR. These findings suggest that the deficit in CFC presented by SHR could be a useful animal model to study abnormalities in emotional context processing related to schizophrenia. PMID:18281713

  18. Emission quantification of refrigerant CFCs, HCFCs and HFCs in megacity Lahore (Pakistan) and contributed ODPs and GWPs

    Indian Academy of Sciences (India)

    Zia Ul-Haq; Muhammad Ali; Syeda Adila Batool; Salman Tariq; Zarmina Qayyum

    2016-08-01

    An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the periodfrom 2005 to 2013. During the production of 6.488 million refrigerator units, the cumulative estimated emissions of CFC-11, CFC-12, HCFC-141b and HFC-134a were 129.7, 6.8, 1257 and 104 mega grams (1 Mg = 106 grams). The estimated GWP (CO2-eq) and ODP (CFC 11-eq) associated with productionphase emissions of these four gases were 616.07, 73.52, 910.96, and 87.36 kilotonnes, and 129.7, 6.8, 139.4, and 0 tonnes, respectively. ODP of HFC-134a is considered to be zero. In addition, the repair and maintenance of 81.2 thousand units resulted in 10.8 Mg emissions of CFC-12 with 10.8 tonnes ODP(CFC11-eq) and 117,802 tonnes GWP (CO2-eq) that were higher than the HFC-134a emissions recorded at 4.3 Mg causing 4563 tonnes GWP(CO2-eq). A decrease in ODP (CFC 11-eq) and GWP (CO2-eq) at the rate of −8.3% and −8.2% per year is observed to be contributed by all the selected ODSs during the study period.

  19. Emission quantification of refrigerant CFCs, HCFCs and HFCs in megacity Lahore (Pakistan) and contributed ODPs and GWPs

    Science.gov (United States)

    Ul-Haq, Zia; Ali, Muhammad; Batool, Syeda Adila; Tariq, Salman; Qayyum, Zarmina

    2016-08-01

    An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the period from 2005 to 2013. During the production of 6.488 million refrigerator units, the cumulative estimated emissions of CFC-11, CFC-12, HCFC-141b and HFC-134a were 129.7, 6.8, 1257 and 104 mega grams (1 Mg = 106 grams). The estimated GWP (CO2-eq) and ODP (CFC 11-eq) associated with production phase emissions of these four gases were 616.07, 73.52, 910.96, and 87.36 kilotonnes, and 129.7, 6.8, 139.4, and 0 tonnes, respectively. ODP of HFC-134a is considered to be zero. In addition, the repair and maintenance of 81.2 thousand units resulted in 10.8 Mg emissions of CFC-12 with 10.8 tonnes ODP(CFC 11-eq) and 117,802 tonnes GWP (CO2-eq) that were higher than the HFC-134a emissions recorded at 4.3 Mg causing 4563 tonnes GWP(CO2-eq). A decrease in ODP (CFC 11-eq) and GWP (CO2-eq) at the rate of -8.3% and -8.2% per year is observed to be contributed by all the selected ODSs during the study period.

  20. The influence of the seasonal mixed layer on oceanic uptake of CFCs

    Science.gov (United States)

    Haine, Thomas W. N.; Richards, Kelvin J.

    1995-06-01

    The issue of the appropriate GFC boundary condition for the interior of the ocean is addressed. A review of observations clearly shows substantial departure from saturation equilibrium and represents the greatest uncertainty in interpreting CFG measurements. A series of simple models is developed to determine the factors which control the CFC-11, CFC-12 and CFC-113 saturations and CFC-113:CFC-12 ratio age.The physical processes of subduction and entrainment have a strong effect; the sequestration of fluid in the seasonal thermocline and spatial variations in the depth of mixing are most important. The uncertainty in the chemical mechanisms has a smaller influence. To the limited extent that the observational database can be compared to the model results, there is good agreement. The model suggests that the variation in CFC-113:CFC-12 age is significantly less than in the saturations of CFCs 11, 12, or 113. However, given a physically realistic seasonal ocean model, the CFC saturation and age boundary condition should be predictable.

  1. Modelo en laboratorio de las reacciones de degradación de los CFC'S, HCFC'S y HFC'S en la atmósfera : su relación con la degradación de la capa de ozono y el efecto invernadero

    OpenAIRE

    Vázquez Dols, José Luis

    1999-01-01

    La concentración de ozono en la estratosfera es producto de un balance de fuerzas creadoras y destructivas. El nivel de ozono en la estratosfera debe mantenerse constante, actuando en régimen permanente. En la estratosfera la concentración de ozono varía ligeramente reflejando ligeras variaciones sobre el punto de equilibrio entre la formación y la destrucción. Estas fluctuaciones son debidas a procesos naturales tales como: ciclos estacionales, erupciones volcánicas, cambios en la intensidad...

  2. Application de la méthode de Laue refocalisée à haute énergie à l'étude des mécanismes de recristallisation après déformation à froid de métaux CFC

    Science.gov (United States)

    Chauveau, Th.; Gerber, Ph.; Bastie, P.; Hamelin, B.; Tarasiuk, J.; Bacroix, B.

    2002-07-01

    In order to determine the kinetics of recystallization process, the Laue diffraction method is apllied here on cold rolled and recrystallized copper materials. Firts, the results obtained from reflexion X-ray diffraction texture measurements are presented. It is shown that the both techniques are complementar, and that the transmission Laue method presents some advantadges. Some previous hypotheses are verified in this work. Especially, the Cube orientation \\{100\\} loses during recrystallization its advantadge of growth, which implies the development of a mixed “deformed-recrystallized” texture at the end of the process. The nucleation step determines the final recrystallized texture. La méthode de Laue haute énergie est appliquée ici dans le but de déterminer les cinétiques de recristallisation de matériaux cuivre après laminages à froid et recuits interrompus. Après présentation des résultats obtenus par mesures classiques en réflexion, une comparaison est effectuée entre les deux techniques permettant de rendre compte des avantages certains qu'offrent des mesures en transmission et de la complémentarité des deux techniques utilisées. Quelques hypothèses sur les mécanismes régissant le processus de recristallisation sont ainsi vérifiées. Au tout début du processus de recristallisation, il a clairement été mis en évidence une perte de l'avantage de croissance des germes d'orientation Cube \\{100\\} au profit des composantes constituant la texture de déformation. Dans ce type de processus, n'est préférentielle que l'étape de germination, dans le sens où elle détermine la texture finale après recristallisation.

  3. Influences of Py C/SiC/TaC Interfaces on Mechanical Properties of 3 D Fine-woven Punctured Cf/C Composites%PyC/SiC/TaC界面对三维细编Cf/C复合材料力学性能的影响

    Institute of Scientific and Technical Information of China (English)

    曾凡浩; 熊翔

    2011-01-01

    采用等温气相沉积方法制备了一种含PyC/SiC/TaC界面的炭/炭复合材料,采用偏光显微镜、X射线衍射和扫描电镜分析了材料的结构和断裂特点,采用单轴拉伸和三点弯曲方法研究了PyC/SiC/TaC界面对炭/炭复合材料力学性能的影响.金相和XRD表明热解炭界面是各向同性炭,TaC界面是NaCl型立方结构,SiC的结构以立方β-SiC为主,有少量的10H-SiC结构.TaC/SiC纤维界面能显著提高复合材料的拉伸、弯曲性能以及Z向压缩性能.整体密度为1.89 g/cm3时,含界面炭/炭材料的抗弯强度达375 MPa,约为无界面材料的4倍,同时材料整体密度的增加也能显著改善其力学性能.分析表明材料总体呈非线性脆断,有一定的假塑性行为.压缩载荷作用下Z向和XY向都为与受力方向成45°的剪切型破坏.%The 3D fine-woven punctured Cf/C-(PyC/SiC/TaC) composites, composed of PyC/SiC/TaC interfaces and pyrocarbon ( PyC) matrix, were synthesized by isothermal chemical vapor infiltration(ICVI) methods. The structure and fracture characteristics of these composites have been examined by polarized light microscopy ( PLM) , scanning electron microscopy (SEM) and X-ray diffraction (XRD). The influences of PyC/SiC/TaC interfaces on the C/C composites were investigated by uniaxial tension and three-point bending methods. It was found that the PyC interface has isotropic( ISO) structure, and the TaC layer has NaCl-type cubic structure, while the SiC layer has few wurtzite type lOH-SiC besides β-SiC structure. The TaC/SiC fiber coating can greatly improve tensile, flexural and z-direction compressive properties of the composites. The maximum of flexural strength are 375 Mpa at density of 1. 89 g/cm3, which are about three times higher than that of samples without TaC/SiC fiber coating. The mechanical properties can be improved obviously by the increase of bulk density of the composites as well. The analysis tells that the composite exhibits a nonlinear brittle failure , indicating a certain pseudoplastic behavior. Failure modes of the samples under compressive load along Z or XY direction present 45° shear fracture.

  4. Activation of human natural killer cells by the soluble form of cellular prion protein

    Energy Technology Data Exchange (ETDEWEB)

    Seong, Yeon-Jae [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Hafis Clinic, Seoul (Korea, Republic of); Sung, Pil Soo; Jang, Young-Soon; Choi, Young Joon [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Bum-Chan [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Park, Su-Hyung [Laboratory of Translational Immunology and Vaccinology, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Young Woo [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Shin, Eui-Cheol, E-mail: ecshin@kaist.ac.kr [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of)

    2015-08-21

    Cellular prion protein (PrP{sup C}) is widely expressed in various cell types, including cells of the immune system. However, the specific roles of PrP{sup C} in the immune system have not been clearly elucidated. In the present study, we investigated the effects of a soluble form of recombinant PrP{sup C} protein on human natural killer (NK) cells. Recombinant soluble PrP{sup C} protein was generated by fusion of human PrP{sup C} with the Fc portion of human IgG{sub 1} (PrP{sup C}-Fc). PrP{sup C}-Fc binds to the surface of human NK cells, particularly to CD56{sup dim} NK cells. PrP{sup C}-Fc induced the production of cytokines and chemokines and the degranulation of granzyme B from NK cells. In addition, PrP{sup C}-Fc facilitated the IL-15-induced proliferation of NK cells. PrP{sup C}-Fc induced phosphorylation of ERK-1/2 and JNK in NK cells, and inhibitors of the ERK or the JNK pathways abrogated PrP{sup C}-Fc-induced cytokine production in NK cells. In conclusion, the soluble form of recombinant PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways. - Highlights: • Recombinant soluble PrP{sup C} (PrP{sup C}-Fc) was generated by fusion of human PrP{sup C} with IgG1 Fc portion. • PrP{sup C}-Fc protein induces the production of cytokines and degranulation from human NK cells. • PrP{sup C}-Fc protein enhances the IL-15-induced proliferation of human NK cells. • PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways.

  5. Implications from the changes in the levels of halocarbons and the compliance with the Montreal Protocol

    Science.gov (United States)

    Chang, Chih-Chung; Wang, Jia-Lin; Lin, Neng-Huei; Liu, Wen-Tzu; Chew, Clock; Ou-Yang, Chang-Feng; Lee, Bo-Ru; Chang, Chih-Yuan

    2013-04-01

    An extensive air sampling made at 51 sites in metropolitan Taipei was conducted in 2012. The results were compared with the sampling made in 1998 using almost identical sampling approach. The goal is to investigate the changes in concentration levels and variability of ozone depleting substances (ODS) in urban atmosphere over the period of 14 years. Seven major halocarbons, i.e., CFC-11 (CCl3F), CFC-12 (CCl2F2), CFC-113 (CCl2FCClF2), CH3CCl3, CCl4, CHCl=CCl2 and CCl2=CCl2, with the latter two being non-ODS but possible carcinogens, were analyzed to assess how successful the transition to an era of ceased emissions of ODS is. After 14 years, the concentrations of CFC-11, CFC-113 and CCl4 were found to be within the proximity of the background levels in the Northern Hemisphere. Moreover, we used concentration variability to imply emissions and usage of ODS. The variability of CFC-11 and CCl4 was less than 4% expressed as one standard deviation, indicating negligible usage for these two ODS in this city of five million residents. Surprisingly, a few samples showed high values for CFC-113, indicating that sporadic usage of CFC-113 still existed. The decline in concentration variability over the 14-year period was particularly dramatic for CFC-12 and CH3CCl3, which may be related to the fact that cars made after mid-1994 were required to use HFC-134a to replace CFC-12 as the air conditioning refrigerant, and other chlorine-free solvents largely replaced CH3CCl3 in the past decade.

  6. Risks in the physical recovery system of waste refrigerator cabinets and the controlling measure.

    Science.gov (United States)

    Ruan, Jujun; Xue, Mianqiang; Xu, Zhenming

    2012-12-18

    Environmental information in physical recovery system of waste refrigerator cabinets was provided in this paper. The system included closed shearing, activated carbon adsorption (ACA), air current separation, magnetic separation, and eddy current separation. Exposures of CFC-11, heavy metals, and noise emitted from the system were assessed. Abundant CFC-11 (>510 mg/m³) was detected in crusher cavity. However, due to the employment of ACA, little CFC-11 (refrigerator cabinets on environmental protection. Meanwhile, it contributed to the knowledge of environmental information of physical technology for recovering e-waste.

  7. Effects of Consideration of Future Consequences and Temporal Framing on Acceptance of the HPV Vaccine Among Young Adults.

    Science.gov (United States)

    Kim, Jarim; Nan, Xiaoli

    2016-09-01

    This study examines how individual difference in consideration of future consequences (CFC) and temporal framing (i.e., present- vs. future-oriented message) interact to influence the persuasive outcomes of a health message promoting human papillomavirus (HPV) vaccination among young adults. Results of an experiment (N = 416) showed a significant interaction effect of CFC and temporal framing on persuasion. The nature of the interaction suggested that individuals with high CFC generally were more persuaded by the present-oriented messages, compared to the future-oriented messages. On the other hand, those with low CFC responded similarly to the present- and future-oriented messages. Implications of the findings for HPV vaccination messaging are discussed. PMID:26799968

  8. Swiss provider of refrigerants opts for natural refrigerants; Traditioneller Kaeltemittelhaendler in der Schweiz setzt auf natuerliche Kaeltemittel

    Energy Technology Data Exchange (ETDEWEB)

    Knus, S.

    2005-10-01

    Friosol, a leading provider of synthetic refrigerant, now opts for natural refrigerants. Friosol has been on the market for more than 55 years, especially in Switzerland, and CFC refrigerants used to be their key line of business. (orig.)

  9. Asthma Inhalers

    Science.gov (United States)

    ... you may be able to receive free and discount drugs if you are unable to aff ord ... than the CFC-containing products they replace. Pharmaceutical companies are committed to ensuring that no patient is ...

  10. Regeneration of hemopoietic precursor cells in spleen organ cultures from irradiated mice: influence of genotype of cells injected and of the spleen microenvironment

    International Nuclear Information System (INIS)

    The regeneration of hemopoietic precursor cells was monitored in spleen organ cultures from lethally irradiated mice injected with 10(7) normal syngeneic or allogeneic bone marrow cells. The important role of the microenvironment in supporting hemopoiesis was confirmed by the failure of mutant Sl/Sld spleens to support CFC regeneration in organ cultures. However, the extent and quality of the CFC regeneration was clearly dependent on the genetic properties of the injected cells. Evidence for this was obtained from the regeneration patterns of various CFC types in organ cultured spleens derived from different mouse donor-recipient strain combinations that maintained the differences in the bone marrow frequency of various CFC types characteristic of the donor strain

  11. Management of C&D waste from generation to final sink - do we forget the volatile harmful substances?

    DEFF Research Database (Denmark)

    Kjeldsen, Peter

    extremely slowly during use. Therefore, the insulation material will still contain large quantities of CFC when the buildings reach the endof-life and are demolished. The management of C&D waste in relation to controlling the CFC releases is basically unregulated in contrast to end-of-life refrigerators...... also containing large quantities of CFC in the insulation material. In the future, the development of new management strategies are highly needed because the quantities of C&D waste containing CFCs will increase. Strategies should focus on minimizing CFC releases during demolishing and recycling......Large quantities of construction and demolition waste (C&D waste) are produced. Buildings in many countries are thermally insulated by insulation foam containing large amounts of CFCs (chlorofluorocarbons), which are both strong ozone depleting substances and greenhouse gases. The CFCs are released...

  12. Central Flyway Duck Banding project : Annual progress report 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Central Flyway Council (CFC) initiated a six year duck banding program in 1996 with emphasis on mallard banding in North Dakota, South Dakota, Montana, and...

  13. The Ozone Layer and Metered Dose Inhalers

    Directory of Open Access Journals (Sweden)

    Louis-Philippe Boulet

    1998-01-01

    Full Text Available The stratospheric ozone layer plays a crucial role in protecting living organisms against ultraviolet radiation. Chlorofluorocarbons (CFC contained in metered-dose inhalers (MDIs contribute to ozone depletion and in accordance with the Montreal Protocol on Substances That Deplete the Ozone Layer established 10 years ago, phase-out strageies have been developed worldwide for this category of agents. Alternatives to CFC-containing inhalers have been developed, such as powder inhalers and those using hydrofluoroalkanes (HFAs as propellants, which have been shown to be as safe and effective as CFC-containing inhalers and even offer interesting advantages over older inhalers. The transition to non-CFC MDIs requires a major effort to make the new products available and to ensure adequate comparision with the previous ones. It also requires a harmonization of actions taken by industry, government, licencing bodies and patients or health professional associations to ensure adequate information and education to the public and respiratory care providers.

  14. COMPOSITION CHANGES IN REFRIGERANT BLENDS FOR AUTOMOTIVE AIR CONDITIONING

    Science.gov (United States)

    Three refrigerant blends used to replace CFC-12 in automotive air conditioners were evaluated for composition changes due to typical servicing and leakage. When recommended service procedures were followed, changes in blend compositions were relatively small. Small changes in b...

  15. Consumerism triggers AC explosion

    Energy Technology Data Exchange (ETDEWEB)

    Lafferty, Richard

    1997-05-01

    The growth in air conditioning in the United Kingdom in recent years is examined in this article, and split systems, the phasing out of CFC and HCFC refrigerants, global warming, and comfort levels are considered. (UK)

  16. Solar production of catalytic filamentous carbon by thermal decomposition of hydrocarbons and carbon monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Kirillov, V.A.; Kuvshinov, G.G.; Mogilnykh, Yu.I. [Boreskov Institute of Catalysis, Novosibirsk (Russian Federation); Reller, A. [University of Hamburg (Germany); Steinfeld, A.; Weidenkaff, A.; Meier, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1999-08-01

    Concentrated solar radiation was used as the clean source of process heat for the production of Catalytic Filamentous Carbon (CFC) by thermal decomposition of gaseous hydrocarbons and by CO disproportionation in the presence of small metal catalyst particles. Depending on the catalyst, two different types of CFC, namely nano tubes and nano fibers, were obtained in solar experiments at the PSI solar furnace. (author) 2 figs., 1 tab., 7 refs.

  17. [Complex febrile crises: should we change the way we act?].

    Science.gov (United States)

    Martinez-Cayuelas, E; Herraiz-Martinez, M; Villacieros-Hernandez, L; Cean-Cabrera, L; Martinez-Salcedo, E; Alarcon-Martinez, H; Domingo-Jimenez, R; Perez-Fernandez, V

    2014-11-16

    Introduccion. Las convulsiones febriles son una de las causas mas frecuentes de consulta. Hasta ahora, los pacientes con convulsiones febriles complejas (CFC) deben ingresar, dado el mayor porcentaje de epilepsia y complicaciones agudas descrito clasicamente. En la actualidad hay estudios que apoyan ser menos invasivos en el abordaje de estos pacientes. Objetivo. Describir las caracteristicas de los pacientes ingresados por CFC y proponer un nuevo protocolo de actuacion. Pacientes y metodos. Analisis retrospectivo de historias clinicas de ingresados por CFC (enero de 2010-diciembre de 2013). Se ofrecen datos epidemiologicos, clinicos, pruebas complementarias y evolucion. Resultados. Las CFC suponian un 4,2% de los ingresos de neuropediatria (n = 67). Edad media al evento: 25 meses. El 47% tenia antecedentes familiares patologicos, y el 31%, antecedentes personales de convulsion febril previa. En el 54% de los pacientes, la CFC duro menos de cinco minutos; hubo recurrencia, la mayoria con un total de dos crisis y durante el primer dia (las CFC por recurrencia son las mas frecuentes). De las pruebas complementarias realizadas, ninguna de ellas sirvio como apoyo diagnostico en el momento agudo. Durante su seguimiento, cinco pacientes presentaron complicaciones. Los pacientes con antecedentes familiares de convulsiones febriles presentan mayor riesgo de epilepsia o recurrencia (p = 0,02), sin diferencias significativas respecto a la edad, numero de crisis, intervalo de fiebre, estado epileptico o tipo de CFC. Conclusiones. Las CFC no asocian mayores complicaciones agudas; las exploraciones complementarias no permiten discriminar precozmente a los pacientes de riesgo. Su ingreso podria evitarse en ausencia de otros signos clinicos y limitarse a casos seleccionados.

  18. Does consideration of future consequences moderate the relationship between aggression and alcohol use in adolescents? Results from the United Kingdom

    OpenAIRE

    McKay, Michael Thomas; Dempster, Martin; Mello, Zena

    2015-01-01

    Background: An increasing body of literature suggests that those who give greater consideration to the future consequences (CFC) of their present behaviours are at a reduced risk of negative health outcomes. The present study examined whether CFC moderated the relationship between four domains of aggression and alcohol use in adolescents in the United Kindgom. Methods: Participants were 1058 adolescents from Northern Ireland. Participants completed questionnaires assessing: Anger; Hostility; ...

  19. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Directory of Open Access Journals (Sweden)

    J. W. Elkins

    2012-09-01

    Full Text Available Since the Montreal Protocol on substances that deplete the ozone layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS, particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. The CFC-11 lifetime of 45 yr, currently recommended in the World Meteorological Organisation (WMO Scientific Assessment of Ozone Depletion, lies at the lower uncertainty bound of our estimates which are 524066 yr (1-sigma uncertainty when AGAGE data were used, and 504066 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is higher than the WMO estimates of 85 yr (10488123 using AGAGE, 10387122 using NOAA. Our estimates of the lifetime of CFC-12 and CH3CCl3 agree well with other recent estimates being 10885137 and 10484135 yr (CFC-12, AGAGE and NOAA, respectively and 5.24.85.6 and 5.24.85.7 yr (CH3CCl3, AGAGE and NOAA, respectively.

  20. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Directory of Open Access Journals (Sweden)

    M. Rigby

    2013-03-01

    Full Text Available Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS, particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. A steady-state lifetime of 45 yr for CFC-11, currently recommended in the most recent World Meteorological Organisation (WMO Scientific Assessments of Ozone Depletion, lies towards the lower uncertainty bound of our estimates, which are 544861 yr (1-sigma uncertainty when AGAGE data were used and 524561 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is significantly higher than the WMO estimates of 85 yr, being 10999121 (AGAGE and 10997124 (NOAA. New estimates of the steady-state lifetimes of CFC-12 and CH3CCl3 are consistent with the current WMO recommendations, being 11195132 and 11295136 yr (CFC-12, AGAGE and NOAA respectively and 5.044.925.20 and 5.044.875.23 yr (CH3CCl3, AGAGE and NOAA respectively.

  1. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Science.gov (United States)

    Rigby, M.; Prinn, R. G.; O'Doherty, S.; Montzka, S. A.; McCulloch, A.; Harth, C. M.; Mühle, J.; Salameh, P. K.; Weiss, R. F.; Young, D.; Simmonds, P. G.; Hall, B. D.; Dutton, G. S.; Nance, D.; Mondeel, D. J.; Elkins, J. W.; Krummel, P. B.; Steele, L. P.; Fraser, P. J.

    2013-03-01

    Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE) and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD) from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. A steady-state lifetime of 45 yr for CFC-11, currently recommended in the most recent World Meteorological Organisation (WMO) Scientific Assessments of Ozone Depletion, lies towards the lower uncertainty bound of our estimates, which are 544861 yr (1-sigma uncertainty) when AGAGE data were used and 524561 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is significantly higher than the WMO estimates of 85 yr, being 10999121 (AGAGE) and 10997124 (NOAA). New estimates of the steady-state lifetimes of CFC-12 and CH3CCl3 are consistent with the current WMO recommendations, being 11195132 and 11295136 yr (CFC-12, AGAGE and NOAA respectively) and 5.044.925.20 and 5.044.875.23 yr (CH3CCl3, AGAGE and NOAA respectively).

  2. Craniofacial and Dental Development in Cardio-facio-cutaneous Syndrome: The Importance of Ras Signaling Homeostasis

    OpenAIRE

    Goodwin, Alice F.; Oberoi, Snehlata; Landan, Maya; Charles, Cyril; Groth, Jessica; Martinez, Anna; Fairley, Cecilia; Weiss, Lauren A.; Tidyman, William E.; Klein, Ophir D.; Rauen, Katherine A.

    2012-01-01

    Cardio-facio-cutaneous syndrome (CFC) is a RASopathy that is characterized by craniofacial, dermatologic, gastrointestinal, ocular, cardiac, and neurologic anomalies. CFC is caused by activating mutations in the Ras/mitogen-activated protein kinase (MAPK) signaling pathway that lies downstream of receptor tyrosine kinase (RTK) signaling. RTK signaling is known to play a central role in craniofacial and dental development, but to date, no studies have systematically examined individuals with C...

  3. Carbon fiber cloth supported Au nano-textile fabrics as an efficient catalyst for hydrogen peroxide electroreduction in acid medium

    Science.gov (United States)

    Yang, Fan; Cheng, Kui; Wang, Guiling; Cao, Dianxue

    2015-09-01

    The size-controlled hierarchical textile-like Au nanostructures supported carbon fiber cloth (Au NTs/CFC) is successfully fabricated through a simple low-cost electrochemical route. The electrodes are characterised by scanning electron microscopy equipped with an energy dispersive X-ray spectrometer, transmission electron microscopy and X-ray diffractometer. Without any conducting carbons and polymer binders, the 3D electrode with unique structure is directly used as the electrocatalyst for H2O2 reduction in acid solution and the catalytic performance is evaluated by voltammetry and chronoamperometry. The Au NTs/CFC electrode exhibits much higher catalytic activity and remarkably improved utilization of Au than Au nanoparticles (Au NPs/CFC) prepared by the same method owing to its unique structure. In the solution of 3.0 mol L-1 H2SO4 + 0.1 mol L-1 H2O2, with the reduction potential of 0 V, the current of -0.72 A cm-2 mg-1 can be obtained on Au NTs/CFC electrode and only a current of -0.09 A cm-2 mg-1 can be achieved on Au NPs/CFC electrode. All these results reveal that the novel Au NTs/CFC electrode exhibits excellent catalytic performance and superior stability for H2O2 electroreduction in acid medium, benefitting from the unique 3D structure which can ensure high utilization of catalyst.

  4. Contribution of some ozone depleting substances (ODS) and greenhouse gases (GHGs) on total column zone growth at Srinagar (34°N, 74.8°), India

    Indian Academy of Sciences (India)

    P K Jana; D K Saha; D Sarkar

    2013-02-01

    A critical analysis has been made on the contribution of CFC-11, CFC-12, CFC-113, CH2Cl, CH3Br, CCl4, CH3CCl3, HCFCs, halons, WMO (World Meteorological Organization) minor constituents, CH4, N2O and water vapour to the variation of total column ozone (TCO) concentration at the station in Srinagar (34°N, 74.8°E), India from 1992 to 2003. With the implementation of Montreal Protocol, though the concentrations of CFC-11, CFC-113, CH3Cl, CH3Br, CCl4 and CH3CCl3 had decreased, the concentrations of CFC-12, HCFCs, halons, WMO minor constituents, CH4, N2O and water vapour had increased, as a result of which TCO had risen from 1992 to 2003 at the above station. The nature of yearly variations of concentrations of the above ozone depleting substances and greenhouse gases as well as ozone has been presented. Possible explanations for build-up of TCO have also been offered.

  5. Damage of actively cooled plasma facing components of magnetic confinement controlled fusion machines

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France)], E-mail: gaelle.chevet@cea.fr; Schlosser, J. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France); Martin, E.; Herb, V.; Camus, G. [Universite Bordeaux 1, UMR 5801 (CNRS-SAFRAN-CEA-UB1), Laboratoire des Composites Thermostructuraux, F-33600 Pessac (France)

    2009-03-31

    Plasma facing components (PFCs) of magnetic fusion machines have high manufactured residual stresses and have to withstand important stress ranges during operation. These actively cooled PFCs have a carbon fibre composite (CFC) armour and a copper alloy heat sink. Cracks mainly appear in the CFC near the composite/copper interface. In order to analyse damage mechanisms, it is important to well simulate the damage mechanisms both of the CFC and the CFC/Cu interface. This study focuses on the mechanical behaviour of the N11 material for which the scalar ONERA damage model was used. The damage parameters of this model were identified by similarity to a neighbour material, which was extensively analysed, according to the few characterization test results available for the N11. The finite elements calculations predict a high level of damage of the CFC at the interface zone explaining the encountered difficulties in the PFCs fabrication. These results suggest that the damage state of the CFC cells is correlated with a conductivity decrease to explain the temperature increase of the armour surface under fatigue heat load.

  6. Redesigning of a Canard Control Surface of an Advanced Fighter Aircraft: Effect on Buckling and Aerodynamic Behavior

    Directory of Open Access Journals (Sweden)

    Shrivastava Sachin

    2015-01-01

    Full Text Available A redesign of canard control-surface of an advanced all-metallic fighter aircraft was carried out by using carbon fibre composite (CFC for ribs and panels. In this study ply-orientations of CFC structure are optimized using a Genetic-Algorithm (GA with an objective function to have minimum failure index (FI according to Tsai-Wu failure criterion. The redesigned CFC structure was sufficiently strong to withstand aerodynamic loads from stress and deflection points of view. Now, in the present work CFC canard structure has been studied for its buckling strength in comparison to existing metallic design. In this study, the existing metallic design was found to be weak in buckling. Upon a detailed investigation, it was revealed that there are reported failures in the vicinity of zones where initial buckling modes are excited as predicted by the finite element based buckling analysis. In view of buckling failures, the redesigned CFC structure is sufficiently reinforced with stringers at specific locations. After providing reinforcements against buckling, the twist and the camber variations of the airfoil are checked and compared with existing structure data. Finally, the modal analysis has been carried out to compare the variation in excitation frequency due to material change. The CFC structure thus redesigned is safe from buckling and aerodynamic aspects as well.

  7. Structure of Sphingolipids From Sea Cucumber Cucumaria frondosa and Structure-Specific Cytotoxicity Against Human HepG2 Cells.

    Science.gov (United States)

    Jia, Zicai; Song, Yu; Tao, Suyuan; Cong, Peixu; Wang, Xiaoxu; Xue, Changhu; Xu, Jie

    2016-03-01

    To investigate the relationship between structure and activity, three glucocerebroside series (CFC-1, CFC-2 and CFC-3), ceramides (CF-Cer) and long-chain bases (CF-LCB) of sea cucumber Cucumaria frondosa (C. frondosa) were isolated and evaluated in HepG2 cells. The molecular species of CFC-1, CFC-2 and CFC-3 and CF-Cer were identified using reversed-phase liquid chromatography with heated electrospray ionization coupled to high-resolution mass spectrometry (RPLC-HESI-HRMS), and determined on the basis of chemical and spectroscopic evidence: For the three glucocerebroside series, fatty acids (FA) were mainly saturated (18:0 and 22:0), monounsaturated (22:1, 23:1 and 24:1) and 2-hydroxyl FA (2-HFA) (23:1 h and 24:1 h), the structure of long-chain bases (LCB) were dihydroxy (d17:1, d18:1 and d18:2) and trihydroxy (t16:0 and t17:0), and the glycosylation was glucose; For CF-Cer, FA were primarily saturated (17:0) and monounsaturated (16:1 and 19:1), the structure of LCB were dihydroxy (d17:1 and d18:1), and trihydroxy (t16:0). The results of cell experiment indicated that all of three glucocerebroside series, CF-Cer and CF-LCB exhibited an inhibitory effects on cell proliferation. Moreover, CFC-3 was most effective in three glucocerebrosides to HepG-2 cell viability. The inhibition effect of CF-LCB was the strongest, and the inhibition effect of CF-Cer was much stronger than glucocerebrosides. PMID:26861868

  8. Behavioral functioning in cardiofaciocutaneous syndrome: Risk factors and impact on parenting experience.

    Science.gov (United States)

    Pierpont, Elizabeth I; Wolford, Melinda

    2016-08-01

    The present study is an investigation of behavioral functioning in children with cardiofaciocutaneous syndrome (CFC). CFC is a rare single-gene disorder associated with cardiac disease, characteristic skin and facial features, intellectual disability, and neurological complications such as seizures and structural brain anomalies. Emotional and behavioral features of CFC have not been systematically investigated. We aimed to identify key variables that contribute to psychopathology during childhood and adolescence, and to examine the impact of challenging behaviors on the caregiving experience. Parents of 34 children and adolescents with CFC completed standardized broadband measures of child emotional and behavioral functioning, as well as measures of sensory modulation, functional communication, and caregiver stress. Results indicate that children with CFC syndrome are at heightened risk for psychopathology, with attention problems, social difficulties, and unusual behaviors (e.g., obsessive thoughts, strange behaviors, repetitive acts) found to be especially prevalent. Behavioral challenges in children with CFC syndrome were significantly associated with a history of obstetric complications and with problems modulating sensory information. With regard to the impact of child neurocognitive and behavioral issues on the caregiving experience, parent self-reported stress was significantly higher among parents of children who engaged in more problem behaviors, and lower among parents whose children could communicate effectively with others. Results of this study suggest avenues to help families cope with CFC-related stressors and enhance overall functioning. In particular, this study highlights the need for educational and treatment interventions aimed at addressing sensory needs, increasing functional communication, and identifying and managing challenging behaviors. © 2016 Wiley Periodicals, Inc. PMID:27149079

  9. An assessment of alternatives for replacing Freon 113 in bench type electrical circuit board cleaning at Fermi National Accelerator Laboratory

    International Nuclear Information System (INIS)

    Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ''best alternatives'': Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases

  10. A 17-year record of environmental tracers in spring discharge, Shenandoah National Park, Virginia, USA: use of climatic data and environmental conditions to interpret discharge, dissolved solutes, and tracer concentrations

    Science.gov (United States)

    Busenberg, Eurybiades; Plummer, L. Niel

    2014-01-01

    A 17-year record (1995–2012) of a suite of environmental tracer concentrations in discharge from 34 springs located along the crest of the Blue Ridge Mountains in Shenandoah National Park (SNP), Virginia, USA, reveals patterns and trends that can be related to climatic and environmental conditions. These data include a 12-year time series of monthly sampling at five springs, with measurements of temperature, specific conductance, pH, and discharge recorded at 30-min intervals. The monthly measurements include age tracers (CFC-11, CFC-12, CFC-113, CFC-13, SF6, and SF5CF3), dissolved gases (N2, O2, Ar, CO2, and CH4), stable isotopes of water, and major and trace inorganic constituents. The chlorofluorocarbon (CFC) and sulfur hexafluoride (SF6) concentrations (in pptv) in spring discharge closely follow the concurrent monthly measurements of their atmospheric mixing ratios measured at the Air Monitoring Station at Big Meadows, SNP, indicating waters 0–3 years in age. A 2-year (2001–2003) record of unsaturated zone air displayed seasonal deviations from North American Air of ±10 % for CFC-11 and CFC-113, with excess CFC-11 and CFC-113 in peak summer and depletion in peak winter. The pattern in unsaturated zone soil CFCs is a function of gas solubility in soil water and seasonal unsaturated zone temperatures. Using the increase in the SF6 atmospheric mixing ratio, the apparent (piston flow) SF6 age of the water varied seasonally between about 0 (modern) in January and up to 3 years in July–August. The SF6 concentration and concentrations of dissolved solutes (SiO2, Ca2+, Mg2+, Na+, Cl−, and HCO3−) in spring discharge demonstrate a fraction of recent recharge following large precipitation events. The output of solutes in the discharge of springs minus the input from atmospheric deposition per hectare of watershed area (mol ha−1 a−1) were approximately twofold greater in watersheds draining the regolith of Catoctin metabasalts than that of granitic

  11. Chemistry of unsaturated zone gases sampled in open boreholes at the crest of Yucca Mountain, Nevada: Data and basic concepts of chemical and physical processes in the mountain

    Science.gov (United States)

    Thorstenson, Donald C.; Weeks, Edwin P.; Haas, Herbert; Busenberg, Eurybiades; Plummer, L. Niel; Peters, Charles A.

    Boreholes open to the unsaturated zone at the crest of Yucca Mountain, Nevada, were variously sampled for CO2 (including 13C and 14C), CH4, N2, O2, Ar, CFC-11, CFC-12, and CFC-113 from 1986 to 1993. Air enters the mountain in outcrops, principally on the eastern slope, is enriched in CO2 by mixing with soil gas, and is advected to the mountain crest, where it returns to the atmosphere. The CFC data indicate that travel times of the advecting gas in the shallow Tiva Canyon hydrogeologic unit are <=5 years. The 14C activities are postbomb to depths of 100 m, indicating little retardation of 14CO2 in the shallow flow systems. The 14C activities from 168 to 404 m in the Topopah Spring hydrogeologic unit are 85-90 pMC at borehole USW-UZ6. The CFC data show that the drilling of USW-UZ6 in 1984 has altered the natural system by providing a conduit through the Paintbrush Nonwelded unit, allowing flow from Topopah Spring outcrops in Solitario Canyon on the west to USW-UZ6, upward in the borehole through the Paintbrush, to the shallow Tiva Canyon flow systems, and out of the mountain.

  12. Continual low-level MEK inhibition ameliorates cardio-facio-cutaneous phenotypes in zebrafish.

    Science.gov (United States)

    Anastasaki, Corina; Rauen, Katherine A; Patton, E Elizabeth

    2012-07-01

    Cardio-facio-cutaneous (CFC) syndrome is caused by germline mutations in KRAS, BRAF and MEK1/2. The highly selective and potent MEK inhibitors that have been developed as anti-cancer agents hold potential as therapeutics for CFC syndrome. We have previously shown that the effects of CFC mutations on zebrafish gastrulation can be prevented by a 1-hour treatment with MEK inhibitors within a specific developmental time-window. However, MEK activity is essential for normal development and PD0325901 treatment outside this treatment window leads to additional developmental defects in MEK-dependent tissues. We now test ten different doses of PD0325901 at six developmental time points and assess the effects on body axis length, heart development and craniofacial structures in zebrafish embryos. Notably, we find that a continuous low-level dose of PD0325901 that has only minor inhibition of MEK activity can prevent the action of both the common CFC BRAF(Q257R) kinase-active allele and the BRAF(G596V) kinase-impaired mutant allele through the first 5 days of development. These results provide a detailed study of the effects of PD0325901 in development and show that, unlike in cancer, which requires robust inhibition of MAPK signalling, a partial reduction in phospho-ERK1/2 activity is sufficient to moderate the developmental effects of BRAF(CFC) mutations.

  13. Age-distribution estimation for karst groundwater: Issues of parameterization and complexity in inverse modeling by convolution

    Science.gov (United States)

    Long, A.J.; Putnam, L.D.

    2009-01-01

    Convolution modeling is useful for investigating the temporal distribution of groundwater age based on environmental tracers. The framework of a quasi-transient convolution model that is applicable to two-domain flow in karst aquifers is presented. The model was designed to provide an acceptable level of statistical confidence in parameter estimates when only chlorofluorocarbon (CFC) and tritium (3H) data are available. We show how inverse modeling and uncertainty assessment can be used to constrain model parameterization to a level warranted by available data while allowing major aspects of the flow system to be examined. As an example, the model was applied to water from a pumped well open to the Madison aquifer in central USA with input functions of CFC-11, CFC-12, CFC-113, and 3H, and was calibrated to several samples collected during a 16-year period. A bimodal age distribution was modeled to represent quick and slow flow less than 50 years old. The effects of pumping and hydraulic head on the relative volumetric fractions of these domains were found to be influential factors for transient flow. Quick flow and slow flow were estimated to be distributed mainly within the age ranges of 0-2 and 26-41 years, respectively. The fraction of long-term flow (>50 years) was estimated but was not dateable. The different tracers had different degrees of influence on parameter estimation and uncertainty assessments, where 3H was the most critical, and CFC-113 was least influential.

  14. ITER transient consequences for material damage: modelling versus experiments

    International Nuclear Information System (INIS)

    Carbon-fibre composite (CFC) and tungsten macrobrush armours are foreseen as PFC for the ITER divertor. In ITER the main mechanisms of metallic armour damage remain surface melting and melt motion erosion. In the case of CFC armour, due to rather different heat conductivities of CFC fibres a noticeable erosion of the PAN bundles may occur at rather small heat loads. Experiments carried out in the plasma gun facilities QSPA-T for the ITER like edge localized mode (ELM) heat load also demonstrated significant erosion of the frontal and lateral brush edges. Numerical simulations of the CFC and tungsten (W) macrobrush target damage accounting for the heat loads at the face and lateral brush edges were carried out for QSPA-T conditions using the three-dimensional (3D) code PHEMOBRID. The modelling results of CFC damage are in a good qualitative and quantitative agreement with the experiments. Estimation of the droplet splashing caused by the Kelvin-Helmholtz (KH) instability was performed

  15. Beryllium Concentrations at European Workplaces: Comparison of 'Total' and Inhalable Particulate Measurements.

    Science.gov (United States)

    Kock, Heiko; Civic, Terence; Koch, Wolfgang

    2015-07-01

    A field study was carried out in order to derive a factor for the conversion of historic worker exposure data on airborne beryllium (Be) obtained by sampling according to the 37-mm closed faced filter cassette (CFC) 'total' particulate method into exposure concentration values to be expected when sampling using the 'Gesamtstaubprobenahmesystem' (GSP) inhalable sampling convention. Workplaces selected to represent the different copper Be work processing operations that typically occur in Germany and the EU were monitored revealing a broad spectrum of prevailing Be size distributions. In total, 39 personal samples were taken using a 37-mm CFC and a GSP worn side by side for simultaneous collection of the 'total' dust and the inhalable particulates, respectively. In addition, 20 static general area measurements were carried out using GSP, CFC, and Respicon samplers in parallel, the latter one providing information on the extra-thoracic fraction of the workplace aerosol. The study showed that there is a linear relationship between the concentrations measured with the CFC and those measured with the GSP sampler. The geometric mean value of the ratios of time-weighted average concentrations determined from GSP and CFC samples of all personal samples was 2.88. The individual values covered a range between 1 and 17 related to differences in size distributions of the Be-containing particulates. This was supported by the area measurements showing that the conversion factor increases with increasing values of the extra-thoracic fraction covering a range between 0 and 79%. PMID:25808693

  16. Rapid detection of cancer related DNA nanoparticulate biomarkers and nanoparticles in whole blood

    Science.gov (United States)

    Heller, Michael J.; Krishnan, Raj; Sonnenberg, Avery

    2010-08-01

    The ability to rapidly detect cell free circulating (cfc) DNA, cfc-RNA, exosomes and other nanoparticulate disease biomarkers as well as drug delivery nanoparticles directly in blood is a major challenge for nanomedicine. We now show that microarray and new high voltage dielectrophoretic (DEP) devices can be used to rapidly isolate and detect cfc-DNA nanoparticulates and nanoparticles directly from whole blood and other high conductance samples (plasma, serum, urine, etc.). At DEP frequencies of 5kHz-10kHz both fluorescent-stained high molecular weight (hmw) DNA, cfc-DNA and fluorescent nanoparticles separate from the blood and become highly concentrated at specific DEP highfield regions over the microelectrodes, while blood cells move to the DEP low field-regions. The blood cells can then be removed by a simple fluidic wash while the DNA and nanoparticles remain highly concentrated. The hmw-DNA could be detected at a level of <260ng/ml and the nanoparticles at <9.5 x 109 particles/ml, detection levels that are well within the range for viable clinical diagnostics and drug nanoparticle monitoring. Disease specific cfc-DNA materials could also be detected directly in blood from patients with Chronic Lymphocytic Leukemia (CLL) and confirmed by PCR genotyping analysis.

  17. Time orientation and eating behavior: Unhealthy eaters consider immediate consequences, while healthy eaters focus on future health.

    Science.gov (United States)

    Dassen, Fania C M; Houben, Katrijn; Jansen, Anita

    2015-08-01

    Time orientation could play an important role in eating behavior. The current study investigated whether eating behavior is associated with the Consideration of Future Consequences scale (CFC). Specifically, it was examined whether unhealthy eaters consider the future less and are more concerned with immediate gratification. A related measure of time orientation is delay discounting, a process by which a reinforcer becomes less valuable when considered later in time. Recent research argues that the relation between time orientation and health behaviors is measured best at a behavior-specific level. In the current study, we explored the relationships between CFC and discount rate - both general and food-specific - and their influence on healthy eating. Participants with ages 18 to 60 (N = 152; final sample N = 146) filled in an online questionnaire consisting of the CFC, a food-specific version of the CFC (CFC-food), the Monetary Choice Questionnaire (MCQ) and an adapted MCQ version with snack food as a reinforcer. Self-reported healthy eating was positively related to the future subscale (r = .48, p MCQ and MCQ-snack) were not related to healthy eating (all p > .05). In order to predict behavior, measurements of time orientation should thus be tailored to the behavior of interest. Based on current results, shifting one's concern from the immediate consequences of eating to a more future-oriented perspective may present an interesting target for future interventions aimed at promoting healthy eating and reducing overweight. PMID:25814191

  18. Potent attenuation of context fear by extinction training contiguous with acquisition

    Science.gov (United States)

    Bernier, Brian E.; Lacagnina, Anthony F.

    2015-01-01

    Studies on the behavioral mechanisms underlying contextual fear conditioning (CFC) have demonstrated the importance of preshock context exposure in the formation of aversive context memories. However, there has been comparatively little investigation of the effects of context exposure immediately after the shock. Some models predict that nonreinforced context exposure at the end of the acquisition session will strongly influence the strength of conditioning and/or recruit distinct neural mechanisms relative to extinction after acquisition. Here we investigate the effects of manipulating postshock context exposure on CFC in mice. Prolonging the period of context exposure immediately following the shock caused a significant and durable reduction in conditioned fear. This immediate postshock context exposure was more effective at attenuating conditioned fear than was an equivalent amount of context exposure a day or more after acquisition. The results suggest that nonreinforced exposure to the context influences conditioned fear through distinct mechanisms depending on whether it occurs during acquisition or after it. The superiority of immediate postshock context exposure was specific to single-shock CFC; in two-shock CFC, immediate and delayed postshock context exposure had similar effects. Consistent with previous reports, we hypothesize that the effectiveness of extinction is modulated by emotional state, and procedures engendering higher postshock freezing (such as two-shock CFC) are associated with weaker immediate extinction. PMID:25512575

  19. Radiosensitivity increases with differentiation status of murine hemopoietic progenitor cells selected using enriched marrow subpopulations and recombinant growth factors

    International Nuclear Information System (INIS)

    The radiosensitivity of populations of colony-forming cells (CFC) in murine bone marrow was investigated using different recombinant colony-stimulating factors (CSFs; murine IL-3 and granulocyte-macrophage CSF and human granulocyte CSF), or purified murine macrophage CSF. With unfractionated normal bone marrow the CFC increased in radiosensitivity as they progressed through the granulocyte lineage. The D0 values ranged from 129 +/- 12 cGy for CFC stimulated with GM-CSF down to 42 +/- 2 cGy after stimulation with G-CSF. IL-3 stimulated a CFC population which gave the only survival curve with a shoulder (n = 1.9 +/- 0.3). With semipurified populations of primitive or bipotential CFC, D0 values were generally lower with respect to the equivalent values for unpurified bone marrow (range 62 +/- 7 cGy to 135 +/- 7 cGy). Changes in cluster/colony ratio and colony morphology together possibly with products of accessory cells influence the interpretation of the radiosensitivity parameters

  20. Extinction learning, which consists of the inhibition of retrieval, can be learned without retrieval.

    Science.gov (United States)

    de Carvalho Myskiw, Jociane; Furini, Cristiane Regina Guerino; Schmidt, Bianca; Ferreira, Flávia; Izquierdo, Ivan

    2015-01-13

    In the present study we test the hypothesis that extinction is not a consequence of retrieval in unreinforced conditioned stimulus (CS) presentation but the mere perception of the CS in the absence of a conditioned response. Animals with cannulae implanted in the CA1 region of hippocampus were subjected to extinction of contextual fear conditioning. Muscimol infused intra-CA1 before an extinction training session of contextual fear conditioning (CFC) blocks retrieval but not consolidation of extinction measured 24 h later. Additionally, this inhibition of retrieval does not affect early persistence of extinction when tested 7 d later or its spontaneous recovery after 2 wk. Furthermore, both anisomycin, an inhibitor of ribosomal protein synthesis, and rapamycin, an inhibitor of extraribosomal protein synthesis, given into the CA1, impair extinction of CFC regardless of whether its retrieval was blocked by muscimol. Therefore, retrieval performance in the first unreinforced session is not necessary for the installation, maintenance, or spontaneous recovery of extinction of CFC.

  1. Adsorption of dissolved Reactive red dye from aqueous phase onto activated carbon prepared from agricultural waste.

    Science.gov (United States)

    Senthilkumaar, S; Kalaamani, P; Porkodi, K; Varadarajan, P R; Subburaam, C V

    2006-09-01

    The adsorption of Reactive red dye (RR) onto Coconut tree flower carbon (CFC) and Jute fibre carbon (JFC) from aqueous solution was investigated. Adsorption studies were carried out at different initial dye concentrations, initial solution pH and adsorbent doses. The kinetic studies were also conducted; the adsorption of Reactive red onto CFC and JFC followed pseudosecond-order rate equation. The effective diffusion coefficient was evaluated to establish the film diffusion mechanism. Quantitative removal of Reactive red dye was achieved at strongly acidic conditions for both the carbons studied. The adsorption isotherm data were fitted well to Langmuir isotherm and the adsorption capacity were found to be 181.9 and 200 mg/g for CFC and JFC, respectively. The overall rate of dye adsorption appeared to be controlled by chemisorption, in this case in accordance with poor desorption studies.

  2. Failure to Consider Future Consequences Increases the Effects of Alcohol on Aggression

    Science.gov (United States)

    Bushman, Brad J.; Giancola, Peter R.; Parrott, Dominic J.; Roth, Robert M.

    2011-01-01

    The failure to consider the future consequences of one’s behavior is a major risk factor for aggression. Aggressive people tend to act first, and think later. Some people focus on the —here and now rather than on the future, a tendency measured by the Consideration of Future Consequences (CFC) scale (Strathman, Gleicher, Boninger, & Edwards, 1994). Alcohol intoxication is a neuro-biological variable that produces similar effects. Participants in the present experiment completed the CFC scale and then consumed either an alcohol or a placebo beverage. Next, they competed against a same-sex ostensible partner on an interpersonally adversarial competitive task in which the winner could administer electric shocks to the loser (the aggression measure). As expected, aggression was highest in intoxicated persons with low CFC scores. Being unconcerned about the future consequences of one’s actions, in conjunction with acute alcohol intoxication, combine in a pernicious manner to increase aggression. PMID:22639468

  3. An improved DS acoustic-seismic modality fusion algorithm based on a new cascaded fuzzy classifier for ground-moving targets classification in wireless sensor networks

    Science.gov (United States)

    Pan, Qiang; Wei, Jianming; Cao, Hongbing; Li, Na; Liu, Haitao

    2007-04-01

    A new cascaded fuzzy classifier (CFC) is proposed to implement ground-moving targets classification tasks locally at sensor nodes in wireless sensor networks (WSN). The CFC is composed of three and two binary fuzzy classifiers (BFC) respectively in seismic and acoustic signal channel in order to classify person, Light-wheeled (LW) Vehicle, and Heavywheeled (HW) Vehicle in presence of environmental background noise. Base on the CFC, a new basic belief assignment (bba) function is defined for each component BFC to give out a piece of evidence instead of a hard decision label. An evidence generator is used to synthesize available evidences from BFCs into channel evidences and channel evidences are further temporal-fused. Finally, acoustic-seismic modality fusion using Dempster-Shafer method is performed. Our implementation gives significantly better performance than the implementation with majority-voting fusion method through leave-one-out experiments.

  4. CFCs age calculation of shallow groundwater in Guanzhong basin%关中盆地浅层地下水CFC年龄的计算

    Institute of Scientific and Technical Information of China (English)

    李晨; 秦大军

    2009-01-01

    通过在关中盆地典型地貌系统取样,在实验室中应用吹扫捕集气相色谱法对关中盆地浅层地下水样品CFC-11、CFC-12和CFC-113浓度进行测定,以亨利定律为基础建立了计算地下水CFC年龄的活塞模型.利用CFC输入函数对地下水表观年龄进行了计算.研究结果表明,关中盆地浅层地下水的年龄随埋深增加而增大;从两侧山前向渭河,浅层地下水年龄呈增加的趋势;自然状态下,渭河水对地下水的影响仅局限在河道两侧2km范围内.%Through systematically sampling in some typical regions in Guanzong basin, the concentrations of CFC-11, CFC-12 and CFC-113 of shallow groundwater in Guanzhong basin are determined in the laboratory using a purge and trap chromatography procedure and a Piston-Flow-Model is established to calcuate CFCs ages of groundwater based on the Henry Law. Apparent ages of groundwater are calculated by the input function of CFCs. The study result shows that ages of shallow groundwater in Guanzhong basin increase as depth. From mountain sides to the Weihe river, shallow groundwater ages take a rising trend. Under natural conditions, the Weihe river does not affect areas more than 2 kilometers away from the bank.

  5. Outgassing of plasma facing antenna front for lower hybrid wave launcher

    Energy Technology Data Exchange (ETDEWEB)

    Maebara, Sunao E-mail: maebara@felsunl.tokai.jaeri.go.jp; Goniche, Marc; Kazarian, Fabienne; Seki, Masami; Ikeda, Yoshitaka; Imai, Tsuyoshi; Bibet, Philippe; Froissard, Philippe; Rey, Guy

    2000-11-01

    A 3.7 GHz mock-up antenna module using carbon fiber composite (CFC) was fabricated and tested for the development of a heat-resistive front of the lower hybrid current drive (LHCD) antenna. This module has four waveguides and a water cooling channel, the length is 206 mm. The CFC surface was coated with a thin titanium layer and was plated with copper in order to reduce RF losses, to bond rods and septum plates and to assemble them with cooling channel. The RF losses and the outgassing rates of this CFC module at high RF power were measured during long pulses. When the injected power varies between 30 and 100 kW, the RF losses measured by calorimetery, were found to be in the range of 1.0-1.2%. It is found that this experimental value is 2.5-3.0 times higher than the theoretical value of pure copper. Stationary operation of the CFC module with water cooling is performed at the RF power density of 45 MW m{sup -2} during 1000 s. The outgassing rates from the CFC module are in the range of 0.93{approx}1.3x10{sup -6} Pam{sup -3} s{sup -1} m{sup -2} at the module temperature of 120 deg. C, it is low enough for an antenna material. No significant bonding defects occurred during the steady-state operation. It is assessed that a CFC module is an attractive candidate for a heat-resistive front of LHCD antenna.

  6. DEVELOPMENT AND VALIDATION OF TWO FOOD FREQUENCY QUESTIONNAIRES TO ASSESS GLUTEN INTAKE IN CHILDREN UP TO 36 MONTHS OF AGE.

    Science.gov (United States)

    Crespo Escobar, Paula; Calvo Lerma, Joaquim; Hervas Marin, David; Donat Aliaga, Ester; Masip Simó, Etna; Polo Miquel, Begoña; Ribes Koninckx, Carmen

    2015-11-01

    Antecedentes y objetivos: una información precisa sobre el consumo de gluten es muy importante para estudiar el verdadero impacto de la introducción y la ingesta de gluten en el desarrollo de la enfermedad celiaca. El objetivo del estudio fue desarrollar y validar herramientas (cuestionarios de frecuencia de consumo, CFC) para evaluar el consumo de gluten en niños con edades comprendidas entre los 7 y 36 meses. Métodos: se incluyeron un total de 342 niños reclutados en el Hospital Universitario y Politécnico de La Fe, así como en guarderías y escuelas de primaria con problemas menores de salud. Se desarrollaron dos CFC diferentes (uno para niños de 7 a 12 meses y otro para niños de 13 a 36 meses). Para su validación, los resultados obtenidos con los CFC se compararon con un registro alimentario de dos días (2RA) y también con un registro alimentario de soete días (7RA), considerado el “estándar de oro”. La ingesta media de gluten obtenida de la comparación del 2RA vs. CFC y de 7RA vs. CFC fueron comparadas usando el método de Bland Altman plot y también el coeficiente de correlación de concordancia de Lin’s. Resultados: de acuerdo a los resultados de los dos métodos estadísticos usados para la validación, se encontró una buena correlación entre los CFC y los registros alimentarios de dos y siete días, lo que indica que los CFC son fiables para la evaluación de la ingesta de gluten. Conclusiones: estos dos nuevos CFC son los únicos validados y disponibles en España para la evaluación de la ingesta de gluten. Además, son herramientas útiles y fáciles de usar para el cálculo del consumo de gluten en niños de hasta tres años de edad.

  7. GPi Oscillatory Activity Differentiates Tics from the Resting State, Voluntary Movements, and the Unmedicated Parkinsonian State

    Science.gov (United States)

    Jimenez-Shahed, Joohi; Telkes, Ilknur; Viswanathan, Ashwin; Ince, Nuri F.

    2016-01-01

    Background: Deep brain stimulation (DBS) is an emerging treatment strategy for severe, medication-refractory Tourette syndrome (TS). Thalamic (Cm-Pf) and pallidal (including globus pallidus interna, GPi) targets have been the most investigated. While the neurophysiological correlates of Parkinson's disease (PD) in the GPi and subthalamic nucleus (STN) are increasingly recognized, these patterns are not well characterized in other disease states. Recent findings indicate that the cross-frequency coupling (CFC) between beta band and high frequency oscillations (HFOs) within the STN in PD patients is pathologic. Methods: We recorded intraoperative local field potentials (LFPs) from the postero-ventrolateral GPi in three adult patients with TS at rest, during voluntary movements, and during tic activity and compared them to the intraoperative GPi-LFP activity recorded from four unmedicated PD patients at rest. Results: In all PD patients, we noted excessive beta band activity (13–30 Hz) at rest which consistently modulated the amplitude of the co-existent HFOs observed between 200 and 400 Hz, indicating the presence of beta-HFO CFC. In all 3TS patients at rest, we observed theta band activity (4–7 Hz) and HFOs. Two patients had beta band activity, though at lower power than theta oscillations. Tic activity was associated with increased high frequency (200–400 Hz) and gamma band (35–200 Hz) activity. There was no beta-HFO CFC in TS patients at rest. However, CFC between the phase of 5–10 Hz band activity and the amplitude of HFOs was found in two TS patients. During tics, this shifted to CFC between the phase of beta band activity and the amplitude of HFOs in all subjects. Conclusions: To our knowledge this is the first study that shows that beta-HFO CFC exists in the GPi of TS patients during tics and at rest in PD patients, and suggests that this pattern might be specific to pathologic/involuntary movements. Furthermore, our findings suggest that during tics

  8. Impacts of greenhouse gases and aerosol direct and indirect effects on clouds and radiation in atmospheric GCM simulations of the 1930-1989 period

    OpenAIRE

    Quaas, Johannes; Dufresne, Jean-Louis; Boucher, Olivier; Le Treut, Hervé

    2015-01-01

    Among anthropogenic perturbations of the Earth\\'s atmosphere, greenhouse gases and aerosols are considered to have a major impact on the energy budget through their impact on radiative fluxes. We use three ensembles of simulations with the LMDZ general circulation model to investigate the radiative impacts of five species of greenhouse gases (CO2, CH4, N2O, CFC-11 and CFC-12) and sulfate aerosols for the period 1930-1989. Since our focus is on the atmospheric changes in clouds and radiation f...

  9. Proposal for the award of a contract, without competitive tendering, for the supply of carbon fibre-reinforced carbon Collimator Jaws for the LHC

    CERN Document Server

    2005-01-01

    This document concerns the award of a contract, without competitive tendering, for the supply of 103 carbon fibre-reinforced carbon (CFC) jaws for the LHC collimators. The Finance Committee is invited to agree to the negotiation of a contract, without competitive tendering, with TATSUNO (JP) for the supply of 103 CFC collimator jaws for a total amount of 23 087 900 Japanese Yen (267 000 Swiss francs), not subject to revision. The amount in Swiss francs has been calculated using the present rate of exchange.

  10. Pilot retrofit test of refrigerant R-134a for GDSCC

    Science.gov (United States)

    Albus, J.; Brown, B.; Dungao, M.; Spencer, G.

    1994-01-01

    NASA has issued an interim policy requiring all of its Centers to eliminate consumption (purchase) of stratospheric ozone-depleting substances, including chlorofluorocarbons (CFC's), by 1995. Also, plans must be outlined for the eventual phase out of their usage. The greatest source of CFC consumption and usage at the Goldstone Deep Space Communications Complex is refrigerant R-12, which is used in many of the facility's air-conditioning systems. A pilot retrofit test shows that retrofitting R-12 air-conditioning systems with hydrofluorocarbon R-13a would be a workable means to comply with the R-12 portion of NASA's policy. Results indicate acceptable cost levels and nearly equivalent system performance.

  11. Chillers - entering the next century

    Energy Technology Data Exchange (ETDEWEB)

    Ertinger, R.; Brasz, J. [Carrier Corp., Syracuse, NY (United States)

    1999-07-01

    During the last twenty five years there have been major changes in the HVAC equipment offered in the marketplace. One of the product lines with the most significant changes is that of centrifugal chillers. It has been impacted by two strong forces: (1) the need for energy efficiency, and (2) regulations against the use of CFC refrigerants. Chiller manufacturers reacted in impressive fashion, furnishing non-CFC chillers with increased efficiency achieved through a variety of technology improvements. These gains continue, under the influence of ongoing market needs and changes. (orig.)

  12. Ultrasonic test of carbon composite/copper joints in the ITER divertor

    International Nuclear Information System (INIS)

    Highlights: • ENEA developed and tested a specimen for the simulation of defects at the interface between CFC and copper. • The use of an ultrasonic technique properly set permitted to highlight and size with high accuracy the defects. • The technology developed could be employed successfully in the production of these components for high heat flux applications. -- Abstract: The vertical targets of the ITER divertor consist of high flux units (HFU) actively cooled: CuCrZr tubes armoured by tungsten and carbon/carbon fibre composite (CFC). The armour is obtained with holed parallelepiped blocks, called monoblocks, previously prepared and welded onto the tubes by means diffusion bonding. The monoblock preparation consists in the casting of a layer of copper oxygen free (Cu OFHC) inside the monoblock hole. Each HFU is covered with more than 100 monoblocks that have to be joined simultaneously to the tube. Therefore, it is very important to individuate any defects present in the casting of Cu OFHC or at the interface with the CFC before the monoblocks are installed on the units. This paper discusses the application of non-destructive testing by ultrasound (US) method for the control of the joining interfaces between CFC monoblocks and Cu OFHC, before the brazing on the CrCrZr tube. In ENEA laboratory an ultrasonic technique (UT) suitable for the control of these joints with size and geometry according to the ITER specifications has been developed and widely tested. Real defects in this type of joints are, however, still hardly detected by UT. The CFC surface has to be machined to improve the mechanical strength of the joint. This results in a surface not perpendicular to the ultrasonic wave. Moreover, CFC is characterized by high acoustic attenuation of the ultrasonic wave and then it is not easy to get information regarding the Cu/CFC bonding. Nevertheless, the UT sharpness and simplicity pushes to perform some further study. With this purpose, a sample with

  13. 温室气体的“源”与“汇”及其防治对策%The "Source" and "Collection" of Greenhouse Gases and Its Control Measure

    Institute of Scientific and Technical Information of China (English)

    王晓峰

    2012-01-01

    From the theories of "source" and "collection", the paper analyses the "source" and "collection" of four kinds of greenhouse gases: CO2, CH4, N2O and CFC8, and provided some methods to control the greenhouse gas.%从“源”与“汇”理论入手,分析大气中四种主要温室气体CO2、CH4、N2O和CFC8的“源”与“汇”,并提出相应防治对策。

  14. The Production and Release of CFCs from Coal Combustion

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The destruction of the ozone layer in the atmosphere caused by industrially synthesized CFCs has aroused greatest concerns from the international society, but the CFCs formed from burning of coal containing fluorine have not been recognized by the world yet. In the present study, we condensed the gas through cold traps and used the GC-MS to measure the gas composition, and found that the content of CFC-12 in the smog from coal combustion was significantly higher than the background value of the local atmosphere. This proves that CFC-12 is formed in the process of coal combustion. This paper discusses a new source of non-synthesized CFCs.

  15. Transport and mixing in the Tropical Tropopause Layer

    OpenAIRE

    Homan, Carine

    2011-01-01

    The TTL is the transition layer between the tropical troposphere and stratosphere, and is the main region where tropospheric air enters the stratosphere. In this thesis different transport processes are studied by using in situ measurements of tracers. Long-lived tracers were measured with the High Altitude Gas Analyzer (HAGAR) on board the M55 Geophysica aircraft. The instrument was developed by the University of Frankfurt and measures the long-lived tracers CO2, N2O, CFC-12, CFC-11, H-1211,...

  16. Improvement of the SCC resistance of FCC alloys: influence of pre-fatigue on the SCC resistance of the austenitic stainless steel-316L in a MgCl{sub 2} boiling solution at 117 deg C; Recherche d'une amelioration du comportement en CSC d'alliages de structure CFC: influence d'une pre-deformation en fatigue oligocyclique sur le comportement en CSC de l'acier inoxydable austenitique 316L dans une solution bouillante de MgCl{sub 2} a 117 deg C

    Energy Technology Data Exchange (ETDEWEB)

    Curiere, I. de

    2000-12-01

    The aim of this study is to analyse the effect of pre-fatigue of FCC materials on their mechanical and electrochemical response to better understand and delay the SCC damage. The material/environment couple tested is the 316L polycrystalline austenitic stainless steel in boiling MgCl{sub 2} at 30% mass. Samples are pre-strained in low cycle fatigue under plastic strain control, with a p/2 value of 0.4%, for various number of cycles (25%, 75% and at the number of cycles to reach saturation during pre-fatigue). It was found that only pre-fatigue at saturation improves the SCC resistance of the material, both on SSRT and constant load tests. A delayed crack initiation up to 10% of strain. which increases strain to failure by half. mostly accounts for this beneficial effect, during SSRT tests. Furthermore, other pre-straining only resulted in loss of strain to fracture and no delay in crack initiation. We related the crack initiation delay to the surface strain state due to pre-fatigue. It provides fine parallel slip bands. homogeneously located at the surface of the samples. This surface state induces an increasing anodic surface-cathodic surface ratio which lowers the kinetics of localised corrosion. thus that of crack initiation. We also show some experiments implying that pre-fatigue at saturation decreases the SCC crack growth velocity which can be understood through the CEP (Corrosion Enhanced Plasticity) Model. We also show that this beneficial effect is probably available on other fcc material/environment couples, such as OFHC Cu/ 1 M NaNO{sub 2} at pH 9. (author)

  17. Decline of deep and bottom water ventilation and slowing down of anthropogenic carbon storage in the Weddell Sea, 1984-2011

    NARCIS (Netherlands)

    Huhn, Oliver; Rhein, Monika; Hoppema, Mario; van Heuven, Steven

    2013-01-01

    We use a 27 year long time series of repeated transient tracer observations to investigate the evolution of the ventilation time scales and the related content of anthropogenic carbon (C-ant) in deep and bottom water in the Weddell Sea. This time series consists of chlorofluorocarbon (CFC) observati

  18. 5 CFR 950.110 - Prohibited discrimination.

    Science.gov (United States)

    2010-01-01

    ... Section 950.110 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE..., handicap, or political affiliation is prohibited in all aspects of the management and the execution of the... part to participate in the CFC, merely because such organization is organized by, on behalf of, or...

  19. 3F: A Leading Fluorine Chemical Company

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Shanghai 3F New Materials Co., Ltd.(3F, SH: 600636) is a company mainlyengaged in the research, development,production and operation of fluorine-containing materials. It owns a complete fluorine chemical industrial chain.Products include CFCs, CFC substitutes,fluorine-containing polymers and fluo-rine-containing fine chemicals.

  20. Non-destructive methods for the defect detection in the ITER high heat flux components

    Energy Technology Data Exchange (ETDEWEB)

    Roccella, S., E-mail: selanna.roccella@enea.it [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy); Burrasca, G.; Cacciotti, E. [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy); Castillo, A. [Associazione Euratom-ENEA sulla Fusione, C.R.Casaccia, Via Anguillarese 301-00123 S. Maria di Galeria, RM (Italy); Universidad Politecnica de Valencia, Valencia (Spain); Mancini, A.; Pizzuto, A. [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy); Tati, A. [Associazione Euratom-ENEA sulla Fusione, C.R.Casaccia, Via Anguillarese 301-00123 S. Maria di Galeria, RM (Italy); Visca, E. [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy)

    2011-10-15

    This paper discusses the application of non-destructive testing (NDT) by ultrasonic technique for the control of the joining interfaces of the ITER divertor vertical target plasma facing units. The defect detection capability has to be proved for both metal to metal and metal to carbon/carbon fibre composite (CFC) joints because these two types of joints have to be realized for the manufacturing of the high heat flux units. In this paper the UT results coming from the investigation performed during the manufacturing, but also after the thermal fatigue testing (up to 20 MW/m{sup 2}) of six mock-ups manufactured using the Hot Radial Pressure technology (HRP) in ENEA labs are presented and compared with the evidences from the final destructive examination. Regarding the Cu/CFC joint, the effectiveness of the ultrasonic test has been deeply studied due to the high acoustic attenuation of CFC to ultrasonic waves. To investigate the possibility to use the ultrasonic technique for this type of joint, an 'ad hoc' flat Cu/CFC joint sample, that reproduces the actual annular joint interfaces, was manufactured. This flat sample has the advantage of being easily tested by probes with different geometry and frequency. UT results are compared with X-ray and eddy current testing of the same sample.

  1. Continual low-level MEK inhibition ameliorates cardio-facio-cutaneous phenotypes in zebrafish

    Directory of Open Access Journals (Sweden)

    Corina Anastasaki

    2012-07-01

    Cardio-facio-cutaneous (CFC syndrome is caused by germline mutations in KRAS, BRAF and MEK1/2. The highly selective and potent MEK inhibitors that have been developed as anti-cancer agents hold potential as therapeutics for CFC syndrome. We have previously shown that the effects of CFC mutations on zebrafish gastrulation can be prevented by a 1-hour treatment with MEK inhibitors within a specific developmental time-window. However, MEK activity is essential for normal development and PD0325901 treatment outside this treatment window leads to additional developmental defects in MEK-dependent tissues. We now test ten different doses of PD0325901 at six developmental time points and assess the effects on body axis length, heart development and craniofacial structures in zebrafish embryos. Notably, we find that a continuous low-level dose of PD0325901 that has only minor inhibition of MEK activity can prevent the action of both the common CFC BRAFQ257R kinase-active allele and the BRAFG596V kinase-impaired mutant allele through the first 5 days of development. These results provide a detailed study of the effects of PD0325901 in development and show that, unlike in cancer, which requires robust inhibition of MAPK signalling, a partial reduction in phospho-ERK1/2 activity is sufficient to moderate the developmental effects of BRAFCFC mutations.

  2. 78 FR 20820 - Solicitation of Federal Civilian and Uniformed Service Personnel for Contributions to Private...

    Science.gov (United States)

    2013-04-08

    ... collection of gifts-in-kind, such as food, clothing and toys, or to the solicitation of Federal employees... Order 12353 (March 23, 1982), 47 FR 12785 (Mar. 25, 1982), as amended by Executive Order 12404 (February 10, 1983), 48 FR 6685 (Feb. 15, 1983). In 2011, the CFC celebrated its 50th anniversary....

  3. Situation and perspectives in refrigerating and air-conditioning. The point of view of Elf Atochem; Situation et perspectives en refrigeration et air conditionne. Point de vue d`Elf Atochem

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This paper is a series of transparencies which explains the engagements of Elf Atochem company in the replacement of chlorofluorocarbons (CFCs): development of HFCs, production of FORANE, safety and environmental criteria, main refrigerants and their application in new installations, perspectives in reconversion, replacement of R-22, CFC-12 and R-502 fluids with respect to their applications. (J.S.)

  4. Power handling of the JET ITER-like wall

    NARCIS (Netherlands)

    Arnoux, G.; Balboa, I.; Clever, M.; Devaux, S.; P. de Vries,; Eich, T.; M Firdaouss,; Jachmich, S.; Lehnen, M.; Lomas, P. J.; Matthews, G. F.; Mertens, P.; Nunes, I.; Riccardo, V.; Ruset, C.; Sieglin, B.; D F Valcárcel,; J Wilson,; Zastrow, K. D.; JET-EFDA Contributors,

    2014-01-01

    The ITER-like wall (ILW) at JET provides a unique opportunity to study the combination of material (beryllium and tungsten) that will be used for the plasma facing components (PFCs) in ITER. Both the limiters (Be) and divertor (CFC W coated and bulk W) have been designed to maximize their power hand

  5. Application of environmental tracers to mixing, evolution, and nitrate contamination of ground water in Jeju Island, Korea

    Science.gov (United States)

    Koh, Dong-Chan; Niel Plummer, L.; Kip Solomon, D.; Busenberg, Eurybiades; Kim, Yong-Je; Chang, Ho-Wan

    2006-07-01

    SummaryTritium/helium-3 ( 3H/ 3He) and chlorofluorocarbons (CFCs) were investigated as environmental tracers in ground water from Jeju Island (Republic of Korea), a basaltic volcanic island. Ground-water mixing was evaluated by comparing 3H and CFC-12 concentrations with lumped-parameter dispersion models, which distinguished old water recharged before the 1950s with negligible 3H and CFC-12 from younger water. Low 3H levels in a considerable number of samples cannot be explained by the mixing models, and were interpreted as binary mixing of old and younger water; a process also identified in alkalinity and pH of ground water. The ground-water CFC-12 age is much older in water from wells completed in confined zones of the hydro-volcanic Seogwipo Formation in coastal areas than in water from the basaltic aquifer. Major cation concentrations are much higher in young water with high nitrate than those in uncontaminated old water. Chemical evolution of ground water resulting from silicate weathering in basaltic rocks reaches the zeolite-smectite phase boundary. The calcite saturation state of ground water increases with the CFC-12 apparent (piston flow) age. In agricultural areas, the temporal trend of nitrate concentration in ground water is consistent with the known history of chemical fertilizer use on the island, but increase of nitrate concentration in ground water is more abrupt after the late 1970s compared with the exponential growth of nitrogen inputs.

  6. Focal point: Refrigeration engineering. All components are available for the substitution of R 12; IKK '92, 13. international trade fair for refrigeration - air conditioning engineering, Nuernberg, October 8-10, 1992. Brennpunkt Kaeltetechnik. Alle Komponenten fuer den R 12-Ersatz verfuegbar; IKK '92, 13. Internationale Fachmesse Kaelte-Klima-Technik Nuernberg, 8. -10. 1992

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1992-12-01

    The most important topic of the IKK conference is still the imminent ban on CFC (chloroflurocarbons). It appears that in the meantime a technically advanced solution for the substitution of R12 is available. This report gives an overview of the most important news in this field. (BWI)

  7. Data of evolutionary structure change: 1CFCA-2CTNA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CFCA-2CTNA 1CFC 2CTN A A -------ADQLTEEQIAEFKEAFSLFDK-DGDGTITTKE...A SLFDK-DGDGT ure>GGG - EEure> THR CA 546 2CTN A 2CTNA DIFVLGAEDGS ure>HHHH ...>1CFCA GQNPT-EAELQ ure> -HHHHHure>

  8. 5 CFR 950.104 - Local Federal Coordinating Committee responsibilities.

    Science.gov (United States)

    2010-01-01

    ... activities including: Public notice in newspapers, postings on Web sites, advertising in trade journals... not use the services of consulting firms, advertising firms or similar business organizations to perform the policy-making or decisionmaking functions in the CFC. A PCFO may, however, contract...

  9. InterProScan Result: CK523618 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK523618 CK523618_6_ORF1 9340A0F489CFC86C PANTHER PTHR18866 CARBOXYLASE:PYRUVATE/AC...ETYL-COA/PROPIONYL-COA CARBOXYLASE 2.1e-14 T IPR005482 unintegrated Molecular Function: ligase activity (GO:0016874) ...

  10. Thermal simulation and analysis of flat surface flip-chip high power light-emitting diodes

    International Nuclear Information System (INIS)

    Conventional GaN-based flip-chip light-emitting diodes (CFC-LEDs) use Au bumps to contact the LED chip and Si submount, however the contact area is constrained by the number of Au bumps, limiting the heat dissipation performance. This paper presents a flat surface high power GaN-based flip-chip light emitting diode (SFC-LED), which can greatly improve the heat dissipation performance of the device. In order to understand the thermal performance of the SFC-LED thoroughly, a 3-D finite element model (FEM) is developed, and ANSYS is used to simulate the thermal performance. The temperature distributions of the SFC-LED and the CFC-LED are shown in this article, and the junction temperature simulation values of the SFC-LED and the CFC-LED are 112.80 °C and 122.97 °C, respectively. Simulation results prove that the junction temperature of the new structure is 10.17 °C lower than that of the conventional structure. Even if the CFC-LED has 24 Au bumps, the thermal resistance of the new structure is still far less than that of the conventional structure. The SFC-LED has a better thermal property. (semiconductor devices)

  11. Effects of drugs inhibiting prostaglandin or leukotriene biosynthesis on postirradiation haematopoiesis in mouse

    Energy Technology Data Exchange (ETDEWEB)

    Kozubik, A.; Hofmanova, J.; Pospisil, M.; Netikova, J.; Hola, J.; Lojek, A. (Ceskoslovenska Akademie Ved, Brno (Czech Republic). Biofysikalni Ustav)

    1994-03-01

    Two non-steroidal anti-inflammatory drugs, i.e. indomethacin (INDO), an inhibitor of prostaglandin production, and esculetin (ESCUL), an inhibitor of leukotriene production, were tested for their ability to modify haematopoiesis in three experimental systems: (a) in vitro clonal proliferation of marrow GM-CFC from the irradiated mouse was found to be augmented by addition of INDO at a low concentration, and inhibited by ESCUL in a dose-dependent manner; (b) in the lethally irradiated and bone marrow-transplanted mice treated with the drugs in the postirradiation period, stimulatory effects of INDO on CFU-S and GM-CFC populations and an inhibitory effect of ESCUL on GM-CFC were observed; and (c) when the drugs were administered i.p. to mice 1 h before 5-Gy irradiation, INDO enhanced the postirradiation recovery of haematopoietic indices such the numbers of CFU-S, GM-CFC, peripheral blood granuloctyes, and nucleated bone marrow cells, while ESCUL had no effect or even inhibited the recovery of these indices. (author).

  12. COP improvement of refrigerator/freezers, air-conditioners, and heat pumps using nonazeotropic refrigerant mixtures

    Science.gov (United States)

    Westra, Douglas G.

    1993-01-01

    With the February, 1992 announcement by President Bush to move the deadline for outlawing CFC (chloro-fluoro-carbon) refrigerants from the year 2000 to the year 1996, the refrigeration and air-conditioning industries have been accelerating their efforts to find alternative refrigerants. Many of the alternative refrigerants being evaluated require synthetic lubricants, are less efficient, and have toxicity problems. One option to developing new, alternative refrigerants is to combine existing non-CFC refrigerants to form a nonazeotropic mixture, with the concentration optimized for the given application so that system COP (Coefficient Of Performance) may be maintained or even improved. This paper will discuss the dilemma that industry is facing regarding CFC phase-out and the problems associated with CFC alternatives presently under development. A definition of nonazeotropic mixtures will be provided, and the characteristics and COP benefits of nonazeotropic refrigerant mixtures will be explained using thermodynamic principles. Limitations and disadvantages of nonazeotropic mixtures will be discussed, and example systems using such mixtures will be reviewed.

  13. HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...

  14. Milieurapportage 1993. II. Integratierapport, 'Aantasting ozonlaag en blootstelling UV'

    NARCIS (Netherlands)

    Aben JMM; Aldenkamp FJ; Bordewijk JA; Eggink GJ; Garssen J; Heij GJ; van Liere L; van Loveren H; Matthijsen AJCM; Olivier JGJ; Pruppers MJM; Reinen H; Slaper H; Thomas R; Veen A; Verweij W; van der Woerd H; LLO; LSO; PAT; LWD; LAE

    1994-01-01

    The report deals with compounds which are known or supposed to deplete the stratospheric ozone layer (such as CFC's). The entire chain is discussed, starting with production and emission of these compounds. Emissions are followed by dispersion in the atmosphere which results in depletion of t

  15. Ozone depletion and skin cancer incidence: an integrated modelling approach

    NARCIS (Netherlands)

    Slaper H; den Elzen MGJ; de Woerd HJ; de Greef J

    1992-01-01

    A decrease in stratospheric ozone, probably caused by chlorofluorocarbon (CFC) emissions, has been observed over large parts of the globe. The incidence of skin cancer is expected to increase due to ozone depletion. An integrated source-risk model is developed and applied to evaluate the increased

  16. 75 FR 6338 - Protection of Stratospheric Ozone: New Substitute in the Motor Vehicle Air Conditioning Sector...

    Science.gov (United States)

    2010-02-09

    ... to use conditions as a substitute for CFC-12 in motor vehicle air conditioning. The proposed... AGENCY 40 CFR Part 82 Protection of Stratospheric Ozone: New Substitute in the Motor Vehicle Air Conditioning Sector Under the Significant New Alternatives Policy (SNAP) Program AGENCY:...

  17. Non-destructive methods for the defect detection in the ITER high heat flux components

    International Nuclear Information System (INIS)

    This paper discusses the application of non-destructive testing (NDT) by ultrasonic technique for the control of the joining interfaces of the ITER divertor vertical target plasma facing units. The defect detection capability has to be proved for both metal to metal and metal to carbon/carbon fibre composite (CFC) joints because these two types of joints have to be realized for the manufacturing of the high heat flux units. In this paper the UT results coming from the investigation performed during the manufacturing, but also after the thermal fatigue testing (up to 20 MW/m2) of six mock-ups manufactured using the Hot Radial Pressure technology (HRP) in ENEA labs are presented and compared with the evidences from the final destructive examination. Regarding the Cu/CFC joint, the effectiveness of the ultrasonic test has been deeply studied due to the high acoustic attenuation of CFC to ultrasonic waves. To investigate the possibility to use the ultrasonic technique for this type of joint, an 'ad hoc' flat Cu/CFC joint sample, that reproduces the actual annular joint interfaces, was manufactured. This flat sample has the advantage of being easily tested by probes with different geometry and frequency. UT results are compared with X-ray and eddy current testing of the same sample.

  18. Impact of nitrogen seeding on carbon erosion in the JET divertor

    NARCIS (Netherlands)

    Brezinsek, S.; Jachmich, S.; Rapp, J.; Meigs, A. G.; Nicholas, C.; O' Mullane, M.; Pospieszczyk, A.; van Rooij, G. J.

    2011-01-01

    Nitrogen has been introduced in H-mode plasmas in JET in order to study its radiation cooling capability and impact on the erosion of divertor plasma-facing components made of carbon-fiber composites (CFC). Experiments in the ionizing plasma regime with low nitrogen injection show a reduction of the

  19. TRENDS 1991: A compendium of data on global change

    Energy Technology Data Exchange (ETDEWEB)

    Boden, T.A.; Sepanski, R.J.; Stoss, F.W. (eds.)

    1991-12-01

    This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO{sub 2}) and methane (CH{sub 4}), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N{sub 2}) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N{sub 2}O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO{sub 2} emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO{sub 2} emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center.

  20. Are New Technologies Safe?

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen

    2004-01-01

    The question is raised to what extend new technologies should - before released on the market - be subjected to a principle of precaution, including the relevance of the product. The issue is illustrated by examples from the past like asbestos and CFC gasses, as well as new cases like mobile phones...

  1. Extreme 13C depletion of CCl2F2 in firn air samples from NEEM, Greenland

    NARCIS (Netherlands)

    Zuiderweg, A.T.; Holzinger, R.; Röckmann, T.

    2012-01-01

    A series of 12 high volume air samples collected from the S2 firn core during the North Greenland Eemian Ice Drilling (NEEM) 2009 campaign have been measured for mixing ratio and stable carbon isotope composition of the chlorofluorocarbon CFC- 12 (CCl2F2). While the mixing ratio measurements compare

  2. Groundwater age, mixing and flow rates in the vicinity of large open pit mines, Pilbara region, northwestern Australia

    Science.gov (United States)

    Cook, Peter; Dogramaci, Shawan; McCallum, James; Hedley, Joanne

    2016-09-01

    Determining groundwater ages from environmental tracer concentrations measured on samples obtained from open bores or long-screened intervals is fraught with difficulty because the sampled water represents a variety of ages. A multi-tracer technique (Cl, 14C, 3H, CFC-11, CFC-12, CFC-113 and SF6) was used to decipher the groundwater ages sampled from long-screened production bores in a regional aquifer around an open pit mine in the Pilbara region of northwest Australia. The changes in tracer concentrations due to continuous dewatering over 7 years (2008-2014) were examined, and the tracer methods were compared. Tracer concentrations suggest that groundwater samples are a mixture of young and old water; the former is inferred to represent localised recharge from an adjacent creek, and the latter to be diffuse recharge. An increase in 14C activity with time in wells closest to the creek suggests that dewatering of the open pit to achieve dry mining conditions has resulted in change in flow direction, so that localised recharge from the creek now forms a larger proportion of the pumped groundwater. The recharge rate prior to development, calculated from a steady-state Cl mass balance, is 6 mm/y, and is consistent with calculations based on the 14C activity. Changes in CFC-12 concentrations with time may be related to the change in water-table position relative to the depth of the well screen.

  3. Methods development for measuring and classifying flammability/combustibility of refrigerants. Interim report, task 2 - test plan

    Energy Technology Data Exchange (ETDEWEB)

    Heinonen, E.W.; Tapscott, R.E. [Univ. of New Mexico, Albuquerque, NM (United States)

    1994-07-01

    Regulations on alternative refrigerants and concerns for the environment are forcing the refrigeration industry to consider the use of potentially flammable fluids to replace CFC fluids currently in use. The objectives of this program are to establish the conditions under which refrigerants and refrigerant blends exhibit flammability and to develop appropriate methods to measure flammability.

  4. TRENDS 1991: A compendium of data on global change

    International Nuclear Information System (INIS)

    This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO2) and methane (CH4), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N2) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N2O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO2 emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO2 emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center

  5. Question No. 5: What Role Can Satellites Take, as a Complement to Ground Based Measurement Systems, to Provide Sustained Observations to Monitor GHG Emissions?

    Science.gov (United States)

    Chahine, Moustafa; Olsen, Edward

    2011-01-01

    What role can satellites take, as a complement to ground based measurement systems, to provide sustained observations to monitor GHG emissions (e.g., CO2, CH4, O3, N2O, CFC s, NH3, and NF3) that contribute to global warming?

  6. Validation of sub-grid-scale mixing schemes using CFCs in a global ocean model

    Science.gov (United States)

    Robitaille, Daniel Y.; Weaver, Andrew J.

    Three sub-grid-scale mixing parameterizations (lateral/vertical; isopycnal; Gent and McWilliams, 1990) are used in a global ocean model in an attempt to determine which yields the best ocean climate. Observed CFC-11 distributions, in both the North and South Atlantic, are used in evaluating the model results. While the isopycnal mixing scheme does improve the deep ocean potential temperature and salinity distributions, when compared to results from the traditional lateral/vertical mixing scheme, the CFC-11 distribution is worse in the upper ocean due to too much mixing. The Gent and McWilliams (1990) parameterization significantly improves the CFC-11 distributions when compared to both of the other schemes. The main improvement comes from a reduction of CFC uptake in the southern ocean where the ‘bolus’ transport cancels the mean advection of tracers and hence causes the Deacon Cell to disappear. These results suggest that the asymmetric response found in CO2-increase experiments, whereby the climate over the southern ocean does not warm as much as in the northern hemisphere, may be due to the particular mixing schemes used.

  7. The technical viability of alternative blowing agents in polyisocyanurate roof insulation: A cooperative industry/government project

    Energy Technology Data Exchange (ETDEWEB)

    Christian, J.E.; Courville, G.E.; Desjarlais, A.O.; Graves, R.S.; Linkous, R.L.; McElroy, D.L.; Weaver, F.J.; Wendt, R.L.; Yarbrough, D.W.

    1993-06-01

    This report is a summary of the cooperative industry/government program to establish the viability of alternative blowing agents to chlorofluorocarbons (CFCs). The project was initiated in 1989 following two workshops that focused on needed research on thermal insulation blown with substitutes for CFC-11 and CFC-12. The project is directed by a steering committee of representatives of the sponsors and of Oak Ridge National Laboratory (ORNL). The purpose of the project is to determine if the performance of polyisocyanurate (PIR) roof insulation foam boards blown with alternate agents differs from the performance of boards blown with CFC-1. This report describes apparent thermal conductivity (k) results obtained from field and laboratory tests from 1989 to 1992 on a set of experimental PIR laminate boardstock produced to evaluate the viability of alternative hydrochlorofluorocarbons (HCFCs) as blowing agents. All boardstock was manufactured from similar formulations that were not optimized for thermal performance. Commercial broadstock made in the future may differ in performance from this set. The PIR boards were prepared with CFC-11, HCFC-123, HCFC-141b, and 50/50 and 65/35 blends of HCFC-123/HCFC-141b.

  8. Treatment of low level radioactive liquid wastes using composite ion-exchange resins based on polyurethane foam

    International Nuclear Information System (INIS)

    Composite ion-exchange resins were prepared by coating copper-ferrocyanide (CFC) and hydrous manganese oxide (HMO) powders on polyurethane (PU) foam. Polyvinyl acetate/Acetone was used as a binder. The foam was loaded with about five times its weight with CFC and HMO powders. The distribution coefficients of CFC-PU foam and HMO-PU foam for cesium and strontium respectively were estimated. Under similar conditions the HMO-PU foam showed higher capacity as well as better kinetics for removal of strontium than CFC-PU foam for Cs. The pilot plant scale studies were conducted using a mixed composite ion-exchange resin bed. About 1000 bed volumes could be passed before attaining a DF of 10 from an initial value of 60-80. The spent resin was digested in alkaline KMnO4 and the digested liquid was fixed in cement matrix. The matrices were characterized with respect to compressive strength and leach resistance. (author)

  9. PERFORMANCE OF HYDROCARBONS IN A HOUSEHOLD REFRIGERATOR/FREEZER

    Science.gov (United States)

    The paper discusses the performance of hydrocarbons in a household refrigerator/freezer (R/F). t focuses on the utilization of specific hydrocarbons (propane and isobutane) as drop-in replacements for CFC-12 in household R/Fs. esults, from this experimental work can be extrapolat...

  10. An evaluation on the environmental consequences of residual CFCs from obsolete household refrigerators in China

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) contained in household refrigerators consist mainly of CFC-11 and CFC-12, which will be eventually released into the environment. Consequentially, environmental releases of these refrigerants will lead to ozone depletion and contribute significantly to the greenhouse effect, if waste refrigerators are not disposed of properly. In the present paper, the potential release of residual CFCs and their substitutes from obsolete household refrigerators in China is examined, and their contributions to ozone depletion and greenhouse effect are compared with those of other recognized ozone-depleting substances (ODS) and greenhouse gases (GHGs). The results imply that annual potential amounts of released residual CFC-11 and CFC-12 will reach their maximums at 4600 and 2300 tons, respectively in 2011, and then decrease gradually to zero until 2020. Meanwhile, the amounts of their most widely used substitutes HCFC-141b and HFC-134a will keep increasing. Subsequently, the contribution ratio of these CFCs and their substitutes to ozone depletion will remain at 25% through 2011, and reach its peak value of 34% by 2018. The contribution to greenhouse effect will reach its peak value of 0.57% by 2010. Moreover, the contribution ratio of these CFCs to the total global release of CFCs will steadily increase, reaching its peak of 15% by 2018. Thus, this period from 2010 to 2018 is a crucial time during which residual CFCs and their substitutes from obsolete household refrigerators in China will contribute significantly to ozone depletion.

  11. 40 CFR Appendix B to Subpart G of... - Substitutes Subject to Use Restrictions and Unacceptable Substitutes

    Science.gov (United States)

    2010-07-01

    .... Additional Comments 1—Must conform with OSHA 29 CFR 1910 Subpart L Section 1910.160 of the U.S. Code. You..., 5. Additional comments: 1—Must conform with relevant OSHA requirements, including 29 CFR 1910... safely in this end-use. CFC-12 Household Refrigerators (Retrofit and New Equipment/NIKs)...

  12. Coping focus counselling in mental health nursing.

    Science.gov (United States)

    Shanley, Eamon; Jubb-Shanley, Maureen

    2012-12-01

    The aim of this paper was to describe a newly-developed system of mental health nurse counselling (coping focus counselling (CFC)) for people with serious and complex mental health needs. The system is based on the recovery alliance theory (RAT) of mental health nursing. The paper identifies shortcomings in current practices in psychotherapy and counselling in the exclusive use of techniques from a single approach, for example, cognitive behaviour therapy, client-centred therapy, attachment theory, or Gestalt theory. It also discusses the opposite dangers of the use of many techniques from different approaches, without a clear rationale for their selection. CFC was developed to avoid these practices. It accommodates the selective use of techniques from different approaches. Techniques selected are viewed as deriving their meanings from the theoretical framework into which they are assimilated, namely RAT, and no longer take the same meaning from the theory from which they originated. Central to this integrative process is the use of the concept of coping. Other distinguishing features of CFC are the use of everyday language in using the system and the reaffirmation of the nurse-client relationship within a working alliance as the basis in which the CFC operates. PMID:22640173

  13. Reduction of chlorofluorocarbon emissions from refrigeration systems

    International Nuclear Information System (INIS)

    Recently enacted State and Federal legislation, (The Clean Air Act and Colorado Senate Bill 77), and the implementation of regulations for each, forbid the intentional release of ozone depleting chlorofluorocarbons(CFCs) from refrigeration and air conditioning systems to the atmosphere. In addition, an international agreement (The Montreal Protocol), calls for CFC manufacturing reductions, which began in 1991, and eventual discontinuation. The declining supply and resultant escalating costs of CFCs are additional driving forces toward conservation and reuse of present refrigerant resources. Rocky Flats Plant (RFP) currently has an estimated 42,000 pounds of CFCs in refrigeration and air conditioning systems. The purpose of this paper is to discuss steps being taken at RFP toward the abatement of CFC releases. The main thrust of our efforts is the use of a refrigerant management system, used to recover and recycle our current CFC stock. Additional methods of further reducing CFC emissions will also be discussed. These include the installation of state-of-the-art oil filtration systems on major chiller units, installation of spring-loaded pressure relief valves and the retrofitting of major chiller units to accept less harmful, alternative refrigerants

  14. 40 CFR Appendix I to Subpart A of... - Global Warming Potentials (Mass Basis), Referenced to the Absolute GWP for the Adopted Carbon...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Global Warming Potentials (Mass Basis..., App. I Appendix I to Subpart A of Part 82—Global Warming Potentials (Mass Basis), Referenced to the... formula Global warming potential (time horizon) 20 years 100 years 500 years CFC-11 CFCl3 5000 4000...

  15. 5 CFR 950.401 - Campaign and publicity information.

    Science.gov (United States)

    2010-01-01

    ... permit the distribution by organizations of promotional information to Federal personnel in public areas... contributors. All CFC Charity Lists must inform employees of their right to make a choice to contribute or not... List: (1) OPM will include in the annual distribution of the National/International and...

  16. Lightning protection design and testing of an all composite wet wing for the Egrett

    Science.gov (United States)

    Burrows, B. J. C.; Haigh, S. J.; Chessum, C.; Dunkley, V. P.

    1991-01-01

    The Egrett aircraft has an all composite wing comprising CFC(carbon fiber composite)/Nomex sandwich skins, full length CFC main spar caps, and GFRP (glass fiber reinforced plastics) main and auxiliary spar webs. It also has short inboard CFC auxiliary spar caps. It has fine aluminum wires woven into the surface for protection. It has an integral fuel tank using the CFC/Nomex skins as the upper and lower tank walls, and lies between the forward auxiliary spar and the forward of the two main spar webs. The fuel tank is not bagged, i.e., it is in effect a wet wing tank. It has conventional capacitive type fuel gauging. The aircraft was cleared to IFR standards and so required full lightning protection and demonstration that it would survive the lightning environment. The lightning protection was designed for the wing (and also for the remainder of the aircraft). An inner wing test samples (which included a part of the fuel tank) were tested as part of the proving program. The protection design and the testing process are described. The intrinsic structural features are indicated that improve lightning protection design and which therefore minimize the weight and cost of any added lightning protection components.

  17. 26 CFR 4.954-2 - Foreign personal holding company income; taxable years beginning after December 31, 1986.

    Science.gov (United States)

    2010-04-01

    .... On day 10, under its method of accounting, CFC accrues the value of $100 in country X currency, but... is determined to be in use must be consistent with the determination of depreciation under sections... office machines which it sells or leases to others and services. Under paragraph (c)(1)(i) of...

  18. 铆钉联接

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    A new approach to hybrid front-end systems;A versatile riveting system for metal/CFC structures;Achieving low-porosity laser welds in aerospace aluminium alloy;Affordable reconfigurable tooling;;Design and evaluation of novel composite aircraft repairs;Enhancement of fatigue life of self-piercing riveted joints by coining……

  19. Seasonal variability in the Deep Western Boundary Current around the Eastern tip of Brazil

    Science.gov (United States)

    Rhein, Monika; Stramma, Lothar

    2005-08-01

    The spreading of recently ventilated North Atlantic Deep Water (NADW) from the formation region to the equatorial Atlantic occurs mainly in the Deep Western Boundary Current (DWBC). When crossing the equator between 44°W and 35°W, the DWBC is split in two velocity cores through a chain of seamounts around the Atoll das Rocas at 3.5°S. Further eastward the DWBC contributes to the zonally oriented equatorial current system. The circulation of the NADW in the crucial region around the eastern tip of Brazil is examined using 8 CTD and Chlorofluorocarbon (CFC) sections along 35°W and along 5°S, respectively, taken mainly in spring and fall in the years 1990-2002. As expected from the short direct flow path between the two sections, the CFC concentrations in the upper NADW (1400-2200 m) were similar at 35°W and 5°S during boreal autumn. In spring, however, a significant downstream CFC decrease was observed. If one attributes the decrease solely to the older age of water further downstream, the CFC concentration age difference between 35°W and 5°S in May 2002 would be 3-5 years. We interpret the aging to be caused by an eastward detour of the flow with the deep equatorial circulation before reaching 5°S in spring. Another conspicuous anomaly was found in the middle NADW (2200-3400 m) with downstream decreasing salinities in boreal spring, but not in autumn. This variability might also be caused by differences in the deep equatorial circulation, but in contrast to the uNADW, one cannot exclude enhanced mixing with water of South Atlantic origin in spring to be the cause of that variability. No seasonal difference was observed in the hydrography or the CFC concentrations for the lower NADW. The weaker CFC decrease along the equator compared with that in the DWBC downstream of 35°W, and the topographic features along the downstream path, point to a predominantly eastward flow of the deep lNADW core. The lNADW CFC core is no longer observed at 11°S. Repeated

  20. Neuronal oscillations with non-sinusoidal morphology produce spurious phase-to-amplitude coupling and directionality.

    Directory of Open Access Journals (Sweden)

    Diego Lozano-Soldevilla

    2016-08-01

    Full Text Available Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (> 40 Hz occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC. However, the CFC patterns be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 mg or 1.5 mg of lorazepam (LZP; GABAergic enhancer in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM, we were able to demonstrate that posterior alpha (8 – 12 Hz phase was coupled to beta-low gamma band (20 – 45 Hz amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD. Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs

  1. Neuronal Oscillations with Non-sinusoidal Morphology Produce Spurious Phase-to-Amplitude Coupling and Directionality

    Science.gov (United States)

    Lozano-Soldevilla, Diego; ter Huurne, Niels; Oostenveld, Robert

    2016-01-01

    Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (>40 Hz) occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC). However, the CFC patterns might be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 or 1.5 mg of lorazepam (LZP; GABAergic enhancer) in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM), we were able to demonstrate that posterior alpha (8–12 Hz) phase was coupled to beta-low gamma band (20–45 Hz) amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh) values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD). Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs. Furthermore, we

  2. Neuronal Oscillations with Non-sinusoidal Morphology Produce Spurious Phase-to-Amplitude Coupling and Directionality.

    Science.gov (United States)

    Lozano-Soldevilla, Diego; Ter Huurne, Niels; Oostenveld, Robert

    2016-01-01

    Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (>40 Hz) occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC). However, the CFC patterns might be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 or 1.5 mg of lorazepam (LZP; GABAergic enhancer) in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM), we were able to demonstrate that posterior alpha (8-12 Hz) phase was coupled to beta-low gamma band (20-45 Hz) amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh) values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD). Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs. Furthermore, we showed

  3. Age-Related Changes in Population of Stromal Precursor Cells in Hematopoietic and Lymphoid Organs.

    Science.gov (United States)

    Gorskaya, Yulia F.; Latzinik, Natalia V.; Shuklina, Ekaterina U.; Nesterenko, Vladimir G.

    2000-07-01

    It is shown that the content of precursor cells of stromal tissue (CFC-F) in the hemopoietic and lymphoid organs of SAMP (rapidly-ageing mice) and SAMR mice (mice with a normal ageing rate) decreases as the animals grow older. However the decrease in the content of CFC-F in SAMP mice begins substantially earlier - in the age group of 9-11 months, while in the SAMR mice - only in the age group of 16-19 months. It was found that the age reduction of the number to an equal degree relates to the whole population of CFC-F, in particular both the fraction of weakly-linked CFC-F, which is isolated by means of mechanical disaggregation of the tissue, and the fraction which may only be isolated using trypsin. It is shown that the concentration of inducible osteogenic precursor cells (IOPC) in the spleen of guinea pigs does not change with age, but their content in that organ in old animals (2-3 years old) drops by two times. It was found that in elderly animals the mass of the ectopic osseous tissue, formed by the implantation of an osteoinductor (autologous epithelium of the urinary bladder) in a system open for entrance of cells, decreases by two times. After curettage of the medullary cavity of guinea pig tibia (i.e. under conditions of an increased demand for osteogenic cells) the mass of induced ectopic osseous tissue decreases by 4 times, which indicates to the possible functional relationship between the pool of determined and inducible osteogenic precursor cells. On the whole, the obtained data show that during ageing there is a reduction in the number of stromal precursor cells (CFC-F and IOPC), which form a specific microenvironment for hemopoietic and lymphoid organs, which is important to understand the role of these cells in the development of age pathologies, in particular senile osteoporosis. PMID:12687170

  4. 神经振荡交叉节律耦合的生理学意义及在神经工程基础研究中的应用%Cross-Frequency Coupling of Neural Oscillations in Potential Physiological Significance and Its Applications in Neural Engineering

    Institute of Scientific and Technical Information of China (English)

    程宁; 徐霞霞; 李群; 张涛

    2015-01-01

    Cross-frequency coupling ( CFC) of neural oscillations could support integration and exchange information across different temporal and spatial scales, playing an important role in facilitating neural communication and promoting neural plasticity.Particularly, phase-amplitude coupling ( PAC), one of the CFC patterns, relates to multi-item working memory maintenance and long-term memory retrieval. This review presents a comprehensive introduction of CFC phenomenon in neural oscillation systems, and expounds the correspondent physiological significance.In order to quantitatively measure the CFC, three commonly used algorithms are introduced and their applications in neurobiological studies are presented accordingly.Finally, a brief description of the CFC potential applications in the fundamental research of neural engineering is provided.%交叉节律耦合( cross-frequency coupling,CFC)反映了不同时空尺度上信息的整合与交流,在神经信息通讯和促进突触可塑性等方面有重要作用。其中,相位-幅值耦合( phase-amplitude coupling,PAC)与工作记忆中多重对象的维持以及长时程记忆的回忆过程相关。此综述较全面地介绍了神经振荡CFC现象,阐述了其对应的生理学意义,给出了量化分析CFC的3种常用算法及其应用,并简单描述了CFC在神经工程研究中的潜在应用。

  5. Validation of a semi-quantitative food frequency questionnaire to assess food groups and nutrient intake.

    Science.gov (United States)

    Macedo-Ojeda, Gabriela; Vizmanos-Lamotte, Barbara; Márquez-Sandoval, Yolanda Fabiola; Rodríguez-Rocha, Norma Patricia; López-Uriarte, Patricia Josefina; Fernández-Ballart, Joan D

    2013-11-01

    Introducción. Los cuestionarios semicuantitativos de frecuencia de consumo (CFC) analizan ingestión promedio de alimentos y nutrimentos en períodos extensos para asociar consumo habitual con problemas de salud, como enfermedades crónicas. En México, no existe una herramienta similar, aplicable en mujeres y hombres. Objetivo. Validar un CFC en mujeres y hombres adultos. Métodos. El estudio incluyó 97 participantes (61% mujeres). Dos CFC fueron aplicados (un año entre ambos) para medir reproducibilidad. Para validez, se comparó el segundo CFC con registros dietéticos de nueve días. Los análisis incluyeron correlaciones de Pearson y coeficientes de correlación intraclase (CCI). Se controló desatenuación de CCI provocada por la variabilidad intraindividual. El análisis de validez se complementó con la comparación de la capacidad de clasificación entre CFC y registros dietéticos, mediante concordancia de categorías de consumo y gráficos de Bland y Altman. Resultados. Reproducibilidad: los CCI para grupos de alimentos oscilaron entre 0.42-0.87 y para nutrimentos entre 0.34-0.82. Validez: los CCI para grupos de alimentos variaron entre 0.35-0.84 y para nutrimentos entre 0.36-0.77. La mayoría de sujetos (56.7-76.3%) clasificaron en el mismo quintil o adyacente por ambos métodos (media 66.1%), para nutrimentos. La mala clasificación extrema para todos los ítems fue.

  6. Use of chloroflurocarbons as internal standards for the measurement of atmospheric non-methane volatile organic compounds sampled onto solid adsorbent cartridges.

    Science.gov (United States)

    Karbiwnyk, Christine M; Mills, Craig S; Helmig, Detlev; Birks, John W

    2003-03-01

    Solid adsorbents have proven useful for determining the vertical profiles of volatile organic compounds (VOCs) using sampling platforms such as balloons, kites, and light aircraft, and those profiles provide valuable information about the sources, sinks, transformations, and transport of atmospheric VOCs. One of the largest contributions to error in VOC concentrations is the estimation of the volume of air sampled on the adsorbent cartridge. These errors arise from different sources, such as variations in pumping flow rates from changes in ambient temperature and pressure with altitude, and decrease in the sampling pump battery power. Another significant source for sampling rate variations are differences in the flow resistance of individual sampling cartridges. To improve the accuracy and precision of VOC measurements, the use of ambient chlorofluorocarbons (CFCs) as internal standards was investigated. A multibed solid adsorbent, AirToxic (Supelco), was chosen for its wide sampling range (C3-C12). Analysis was accomplished by thermal desorption and dual detection GC/FID/ECD, resulting in sensitive and selective detection of both VOCs and CFCs in the same sample. Long-lived chlorinated compounds (CFC-11, CFC-12, CFC-113, CCl4 and CH3CCl3) banned by the Montreal Protocol and subsequent amendments were studied for their ability to predict sample volumes using both ground-based and vertical profiling platforms through the boundary layer and free troposphere. Of these compounds, CFC-113 and CCl4 were found to yield the greatest accuracy and precision for sampling volume determination. Use of ambient CFC-113 and CCl4 as internal standards resulted in accuracy and precision of generally better than 10% for the prediction of sample volumes in ground-, balloon-, and aircraft-based measurements. Consequently, use of CFCs as reference compounds can yield a significant improvement of accuracy and precision for ambient VOC measurements in situations where accurate flow

  7. Combination of low O(2) concentration and mesenchymal stromal cells during culture of cord blood CD34(+) cells improves the maintenance and proliferative capacity of hematopoietic stem cells.

    Science.gov (United States)

    Hammoud, Mohammad; Vlaski, Marija; Duchez, Pascale; Chevaleyre, Jean; Lafarge, Xavier; Boiron, Jean-Michel; Praloran, Vincent; Brunet De La Grange, Philippe; Ivanovic, Zoran

    2012-06-01

    The physiological approach suggests that an environment associating the mesenchymal stromal cells (MSC) and low O(2) concentration would be most favorable for the maintenance of hematopoietic stem cells (HSCs) in course of ex vivo expansion of hematopoietic grafts. To test this hypothesis, we performed a co-culture of cord blood CD34(+) cells with or without MSC in presence of cytokines for 10 days at 20%, 5%, and 1.5% O(2) and assessed the impact on total cells, CD34(+) cells, committed progenitors (colony-forming cells-CFC) and stem cells activity (pre-CFC and Scid repopulating cells-SRC). Not surprisingly, the expansion of total cells, CD34(+) cells, and CFC was higher in co-culture and at 20% O(2) compared to simple culture and low O(2) concentrations, respectively. However, co-culture at low O(2) concentrations provided CD34(+) cell and CFC amplification similar to classical culture at 20% O(2) . Interestingly, low O(2) concentrations ensured a better pre-CFC and SRC preservation/expansion in co-culture. Indeed, SRC activity in co-culture at 1.5% O(2) was higher than in freshly isolated CD34(+) cells. Interleukin-6 production by MSC at physiologically low O(2) concentrations might be one of the factors mediating this effect. Our data demonstrate that association of co-culture and low O(2) concentration not only induces sufficient expansion of committed progenitors (with respect to the classical culture), but also ensures a better maintenance/expansion of hematopoietic stem cells (HSCs), pointing to the oxygenation as a physiological regulatory factor but also as a cell engineering tool.

  8. Climate control of decadal-scale increases in apparent ages of eogenetic karst spring water

    Science.gov (United States)

    Martin, Jonathan B.; Kurz, Marie J.; Khadka, Mitra B.

    2016-09-01

    Water quantity and quality in karst aquifers may depend on decadal-scale variations in recharge or withdrawal, which we hypothesize could be assessed through time-series measurements of apparent ages of spring water. We tested this hypothesis with analyses of various age tracers (3H/3He, SF6, CFC-11, CFC-12, CFC-113) and selected solute concentrations [dissolved oxygen (DO), NO3, Mg, and SO4] from 6 springs in a single spring complex (Ichetucknee springs) in northern Florida over a 16-yr period. These springs fall into two groups that reflect shallow short (Group 1) and deep long (Group 2) flow paths. Some tracer concentrations are altered, with CFC-12 and CFC-113 concentrations yielding the most robust apparent ages. These tracers show a 10-20-yr monotonic increase in apparent age from 1997 to 2013, including the flood recession that followed Tropical Storm Debby in mid-2012. This increase in age indicates most water discharged during the study period recharged the aquifer within a few years of 1973 for Group 2 springs and 1980 for Group 1 springs. Inverse correlations between apparent age and DO and NO3 concentrations reflect reduced redox state in older water. Positive correlations between apparent age and Mg and SO4 concentrations reflect increased water-rock reactions. Concentrated recharge in the decade around 1975 resulted from nearly 2 m of rain in excess of the monthly average that fell between 1960 and 2014, followed by a nearly 4 m deficit to 2014. This excess rain coincided with two major El Niño events during the maximum cool phase in the Atlantic Multidecadal Oscillation. Although regional water withdrawal increased nearly 5-fold between 1980 and 2005, withdrawals represent only 2-5% of Ichetucknee River flow and are less important than decadal-long variations in precipitation. These results suggest that groundwater management should consider climate cycles as predictive tools for future water resources.

  9. Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA) data processing and atmospheric temperature and trace gas retrieval

    Science.gov (United States)

    Riese, M.; Spang, R.; Preusse, P.; Ern, M.; Jarisch, M.; Offermann, D.; Grossmann, K. U.

    1999-07-01

    The Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA) experiment aboard the Shuttle Pallet Satellite (SPAS) was successfully flown in early November 1994 (STS 66) and in August 1997 (STS 85). This paper focuses on the first flight of the instrument, which was part of the Atmospheric Laboratory for Application and Science 3 (ATLAS 3) mission of NASA. During a free flying period of 7 days, limb scan measurements of atmospheric infrared emissions were performed in the 4 to 71 μm wavelength region. For improved horizontal resolution, three telescopes (viewing directions) were used that sensed the atmosphere simultaneously. Atmospheric pressures, temperatures, and volume mixing ratios of various trace gases were retrieved from the radiance data by using a fast onion-peeling retrieval technique. This paper gives an overview of the data system including the raw data processing and the temperature and trace gas profile retrieval. Examples of version 1 limb radiance data (level 1 product) and version 1 mixing ratios (level 2 product) of ozone, ClONO2, and CFC-11 are given. A number of important atmospheric transport processes can already be identified in the level 1 limb radiance data. Radiance data of the lower stratosphere (18 km) indicate strong upwelling in some equatorial regions, centered around the Amazon, Congo, and Indonesia. Respective data at the date line are consistent with convection patterns associated with El Niño. Very low CFC-11 mixing ratios occur inside the South Polar vortex and cause low radiance values in a spectral region sensitive to CFC-11 emissions. These low values are a result of considerable downward transport of CFC-11 poor air that occurred during the winter months. Limb radiance profiles and retrieved mixing ratio profiles of CFC-11 indicate downward transport over ˜5 km. The accuracy of the retrieved version 1 mixing ratios is rather different for the various trace gases. In the middle atmosphere the estimated

  10. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Tétard

    2008-02-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and CFC-12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10%, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences probably remain

  11. Spurious cross-frequency amplitude-amplitude coupling in nonstationary, nonlinear signals

    Science.gov (United States)

    Yeh, Chien-Hung; Lo, Men-Tzung; Hu, Kun

    2016-07-01

    Recent studies of brain activities show that cross-frequency coupling (CFC) plays an important role in memory and learning. Many measures have been proposed to investigate the CFC phenomenon, including the correlation between the amplitude envelopes of two brain waves at different frequencies - cross-frequency amplitude-amplitude coupling (AAC). In this short communication, we describe how nonstationary, nonlinear oscillatory signals may produce spurious cross-frequency AAC. Utilizing the empirical mode decomposition, we also propose a new method for assessment of AAC that can potentially reduce the effects of nonlinearity and nonstationarity and, thus, help to avoid the detection of artificial AACs. We compare the performances of this new method and the traditional Fourier-based AAC method. We also discuss the strategies to identify potential spurious AACs.

  12. NSE与视频脑电图在儿童热性惊厥的相关研究%THE CORRELATION BETWEEN SERUM NEURON SPECIFIC ENOLASE AND VIDEO EEG IN FEBRILE CONVULSION OF CHILDREN

    Institute of Scientific and Technical Information of China (English)

    刘秀琴; 于树红; 孙若鹏

    2002-01-01

    Objective:To evaluate the diagnostic value of serum neuron specific enolase and Video EEG in Febrile Convulsion of childen. Method:Serum NSE was detected by RIA on the first day and the seventh day after seizure in 40 children with simple febrile convulsion and 18 with complex febrile convulsion. Video EEG was performed at 1st, 7th and 30th day in all the patients. Results: There were significant differences between NSE levels at 24th hour and on 7th day after convulsion (P<0.01). NSE concentrations in patients with SFC and CFC were also different (P < 0.01). The more slowly NSE restored, the higher the abnormal ratio of EGG was . Conclusion: NSE increased in patients within 24hours after seizure, especially in CFC patients. The abnormal ratio of VideoEEG was related to the change of NSE concentration.

  13. Supermarket refrigerators with natural refrigerants; Supermarktkaelteanlagen mit natuerlichen Kaeltemitteln. Erfahrungsbericht

    Energy Technology Data Exchange (ETDEWEB)

    Haaf, S.; Heinbokel, B. [Linde AG, Koeln (Germany). Gechaeftsbereich Linde Kaeltetechnik

    2002-09-01

    In view of the high contribution to global warming of H-CFC refrigerants, substitution has been a key concern for several years now. Leakage protection measures were enhanced, and Linde also installed many supermarket refrigerators with natural refrigerants, i.e. ammonia, propene and carbon dioxide. The environmental and economic aspects are assessed on the basis of the experience gained, and the systems are compared with H-CFC refrigeration systems. [German] Wegen des betraechtlichen Treibhauspotentials von HFKW-Kaeltemitteln werden seit Jahren Anstrengungen unternommen, um den von diesen Stoffen ausgehenden Treibhauseffekt zu reduzieren. Neben Massnahmen zur Verminderung von Leckagen sowie zur Verringerung von Kaeltemittel-Fuellmengen wurden im Laufe der letzten 10 Jahre von Linde auch zahlreiche Kaelteanlagen mit den natuerlichen Kaeltemitteln Ammoniak, Propen und Kohlendioxid in Supermaerkten installiert. Auf Basis der gesammelten Erfahrungen wird eine Einschaetzung der umweltspezifischen und wirtschaftlichen Aspekte im Vergleich zu Anlagen mit HFKW-Kaeltemitteln vorgenommen. (orig.)

  14. Experimental performance of ozone-safe alternative refrigerants: Experimental performance comparisons of R32, R125, R143a, R218, R134a, R152a, R124, R142b, RC318 and R143 in a refrigeration circuit

    Science.gov (United States)

    Sand, James R.; Vineyard, Edward A.; Nowak, Richard J.

    1990-02-01

    Several compounds proposed as near term or longer range substitutes for the regulated chlorofluorocarbon (CFC) refrigerants were tested in a breadboard vapor-compression circuit, and their performance was evaluated relative to more commonly used refrigerants. The limited physical property information available in the literature for these alternative compounds was used to fit an equation of state so coefficients of performance (COPs) and capacities calculated from refrigerant property subroutines could be compared to those obtained experimentally. Comparisons of measured and modeled performance are given for 11 alternatives and for R22, R12, and R114. Estimates of compressor efficiency with each refrigerant are provided. Several of the alternatives exhibited better performance than the more widely used refrigerants at some or all of the conditions tested. Ozone-safe, alternative refrigerants that performed better than CFC counterparts at selected conditions are R152a, R143a, R134a, R134, and R142b.

  15. Halon-1301, a new Groundwater Age Tracer

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2015-04-01

    Groundwater dating is an important tool to assess groundwater resources in regards to direction and time scale of groundwater flow and recharge and to assess contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However ambiguous age interpretations are often faced, due to a limited set of available tracers and limitations of each tracer method when applied alone. There is a need for additional, complementary groundwater age tracers. We recently discovered that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate [Beyer et al, 2014]. Halon-1301 can be determined along with SF6, SF5CF3 and CFC-12 in groundwater using a gas chromatography setup with attached electron capture detector developed by Busenberg and Plummer [2008]. Halon-1301 has not been assessed in groundwater. This study assesses the behaviour of Halon-1301 in water and its suitability as a groundwater age tracer. We determined Halon-1301 in 17 groundwater and various modern (river) waters sites located in 3 different groundwater systems in the Wellington Region, New Zealand. These waters have been previously dated with tritium, CFC-12, CFC-11 and SF6 with mean residence times ranging from 0.5 to over 100 years. The waters range from oxic to anoxic and some show evidence of CFC contamination or degradation. This allows us to assess the different properties affecting the suitability of Halon-1301 as groundwater age tracer, such as its conservativeness in water and local contamination potential. The samples are analysed for Halon-1301 and SF6simultaneously, which allows identification of issues commonly faced when using gaseous tracers such as contamination with modern air during sampling. Overall we found in the assessed groundwater samples Halon-1301 is a feasible new groundwater tracer. No sample indicated significantly elevated

  16. How long R 22? - The future of R 22 systems. Lecture seminar in the North German Technical Highschool for Refrigeration Engineering at Springe; Wie lange noch R 22? - Zukunft von R 22 Altanlagen. Vortrags-Seminar in der Norddeutschen Kaelte-Fachschule in Springe

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2000-12-01

    On the day before the new EC-CFC/H-CFC Ordinance No. 2037/00 was to replace the former No. 3093/94, refrigeration experts came together at Springe to discuss the future of the existing R 22 plants. Is there a sufficient supply of R 22 through 2010, and what is to come after that data?. [German] 1 Tag vor Veroeffentlichung einer Neufassung der EU-FCKW/H-FCKW-Verbotsverordnung (EG) Nr. 2037/00 in Abloesung von (EG) Nr. 3093/94 im Amtsblatt der Europaeischen Union in Bruessel trafen sich Vertreter der Branche am 28. September in Springe, um im Tagungsraum 'Kelvin' (nomen est omen) der NKF den Fortbestand von R 22 in Altanlagen fruehzeitig zu beraten. Gibt es bis 2010 genuegend Mengen R 22, oder wenn nicht, was dann? (orig.)

  17. Investigations into the damage for various types of unprotected carbon fibre composites with a variety of lightning arc attachments

    Science.gov (United States)

    Reid, G. W.

    1991-01-01

    Very little quantitative information exists on the extent and nature of damage caused to unprotected carbon fiber composites (CFC's) due to lightning arc attachment. An initial investigation into the arc damage to three different types and various thickness of CFC's from A and C component type lightning discharges is described. The difference in damage which the two types of waveform produced and the way the area of damage varies with different levels of action integral and charge transfer is compared. In some cases, the temperature rise at the rear of the panels was recorded for various levels of action integral and charge transfer. A comparison was made of the area of damage from visual inspection and soft x ray photography, using a suitable penetrant in the damage area. It is concluded there is a need for a more detailed analysis of the damage.

  18. Experimental study of PFCs erosion under ITER-like transient loads at plasma gun facility QSPA

    International Nuclear Information System (INIS)

    This paper is concerned with investigation of an erosion of the ITER-like divertor castellated targets of pure tungsten, lanthanum tungsten and CFC under plasma heat loads expected during the Type I ELMs and disruptions in ITER. These experiments were carried out on a plasma gun QSPA-T at the SRC RF TRINITI under EU/RF collaboration. The targets were exposed by series repeated plasma pulses with heat loads in the range of 0.2-2.5 MJ/m2 and a pulse duration of 0.5 ms. The erosion value as a function of pulse number and energy density were obtained. The erosion of lanthanum tungsten started at the lower energy density as compared with pure tungsten and was mainly due to a melt layer movement and a droplets ejection. Characteristics of ejected droplets were measured. The erosion of CFC macrobrushes under ELM and disruption heat loads was determined mainly by damage of PAN-fibers.

  19. Evolution of genitalia: theories, evidence, and new directions.

    Science.gov (United States)

    Eberhard, William G

    2010-01-01

    Many hypotheses have been proposed to explain why male intromittent genitalia consistently tend to diverge more rapidly than other body traits of the same individuals in a wide range of animal taxa. Currently the two most popular involve sexual selection: sexually antagonistic coevolution (SAC) and cryptic female choice (CFC). A review of the most extensive attempts to discriminate between these two hypotheses indicates that SAC is not likely to have played a major role in explaining this pattern of genital evolution. Promising lines for future, more direct tests of CFC include experimental modification of male genital form and female sensory abilities, analysis of possible male-female dialogues during copulation, and direct observations of genital behavior.

  20. Relationship between the merit factor of thermoelectric materials and the air conditioning unit of urban electric cars

    International Nuclear Information System (INIS)

    The main benefit of electric cars is to reduce air pollution in cities that is thus desirable to equip them with non polluting air conditioning units and this rules out frigorific compressors operating with CFC. The planned replacement of CFC by HFC is at best an interim solution. The best solution is certainly to use thermoelectric air conditioning units, which are inherently pollution-free. However, these have a fairly low COPF when compared to traditional compressor units. We study the relationship between the cooling of the interior of urban electric cars and the merit factor of the thermoelectric material in their Peltier unit. This should help provide concrete target properties of future T E materials. copyright 1995 American Institute of Physics

  1. Nobel Prize in Chemistry 1995 "for their work in atmospheric chemistry, particularly concerning the formation and decomposition of ozone" : Paul J Crutzen, Mario J Molina and F Sherwood Rowland

    CERN Multimedia

    1997-01-01

    Prof. Paul J Crutzen presents "The stratospheric ozone hole : a man-caused chemical instability".The discovery of the spring time stratospheric ozone hole by scientists of the British Antarctic Survey, led by Joe Farman, was one of the greatest surprises in the history of the atmospheric sciences and global change studies. After intensive research efforts by many international scientific teams it has clearly been demonstrated that the observed rapid ozone depletions are due to catalytic reactions involving CIO radicals, more than 80571130f which are produced by the photochemical breakdown of the industrial chlorofluorocarbon (CFC) gases. In this lecture I will present the course of events leading to the rapid ozone depletions. International agreements have been reached to forbid the production of the CFC gases. However, despite these measures, it will take almost 50 years before the ozone hole will have disappeared. I will also show that mankind has indeed been very lucky and that things could have been far w...

  2. Water filtration of the forearm in short- and long-term diabetes mellitus

    DEFF Research Database (Denmark)

    Poulsen, H L; Nielsen, S L

    1976-01-01

    ). There was no difference in blood flow in the four groups, but CFC was significantly increased in long-term diabetes (duration above 20 years) when measured at the distal part of the forearm near the wrist. Calculations showed that this was probably due to the relatively high contribution of connective tissue in this part......Blood flow and capillary filtration coefficient (CFC) were measured by strain-gauge plethysmography on the upper and lower third of the forearm in 9 normal subjects and 29 well regulated patients with diabetes mellitus of varying duration (less than 10 years, 10 to 20 years, and more than 20 years...... of the forearm. Increased water filtration in connective tissue in long-term diabetics is in accordance with earlier findings of a lowered subcutaneous interstitial fluid albumin concentration in long-term diabetics, this being explained by an increase in net water outflux from the microcirculation....

  3. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  4. Chlorofluorocarbons and ~3H/~3He in groundwater——Applications in tracing and dating young groundwater

    Institute of Scientific and Technical Information of China (English)

    秦大军; 王浩

    2001-01-01

    Based on the CFC concentration, the fraction of young groundwater in a mixture with old groundwater can be defined if the age of the young component is known. The authors argued that the ratio of [3HeJ/[3Ht] in a young water is independent of its mixing with old waters. Hence, the 3H-3He can be used to determine age of the young groundwater, though mixing with old ground-water may occur. CFC concentrations are susceptible to change by mixing of young and old water. The combination of CFCs and tritium/helium can provide confidential apparent age of the young groundwater and fraction of the young water in the mixture with old groundwater.

  5. The stratospheric ozone hole a man-caused chemical instability

    CERN Document Server

    Crutzen, P J

    1997-01-01

    The discovery of the spring time stratospheric ozone hole by scientists of the British Antarctic Survey, led by Joe Farman, was one of the greatest surprises in the history of the atmospheric sciences and global change studies. After intensive research efforts by many international scientific teams it has clearly been demonstrated that the observed rapid ozone depletions are due to catalytic reactions involving CIO radicals, more than 80571130f which are produced by the photochemical breakdown of the industrial chlorofluorocarbon (CFC) gases. In this lecture I will present the course of events leading to the rapid ozone depletions. International agreements have been reached to forbid the production of the CFC gases. However, despite these measures, it will take almost 50 years before the ozone hole will have disappeared. I will also show that mankind has indeed been very lucky and that things could have been far worse.

  6. Speaker identification based on complete feature corpus and evaluation of mutual information

    Institute of Scientific and Technical Information of China (English)

    YU Yibiao; WANG Shuozhong

    2005-01-01

    A speaker model called complete feature corpus (CFC) and an evaluation algorithm of mutual information (MIE) are proposed for text-independent speaker identification. The CFC model represents the speech and pronunciation characteristics of speaker by a feature vector corpus which was trained from some typical speech samples. It hires multi-step mini-max search matching scheme for MIE algorithm to evaluate the similarity of speech features between input speech and the models in distance and information space. Maximum mutual information (MMI)decision criterion is used to decide the identity of speaker. Experiments on performance analysis with comparison to GMM method show that proposed model and evaluation algorithm are quite effective and presented a higher performance than ordinary GMM method.

  7. Analysis of new species retrieved from MIPAS

    Directory of Open Access Journals (Sweden)

    Shaomin Cai

    2014-02-01

    Full Text Available The Michelson Interferometer for Passive Atmospheric Sounding (MIPAS instrument which operated on the Envisat satellite from 2002-2012 is a Fourier transform spectrometer for the measurement of high-resolution gaseous emission spectra at the Earth's limb. It operates in the near- to mid-infrared, where many of the main atmospheric trace gases have important emission features. The initial operational products were profiles of Temperature, H2O, O3, CH4, N2O, HNO3, and NO2, and this list was recently extended to include N2O5, ClONO2, CFC-11 and CFC-12. Here we present preliminary results of retrievals of the third set of species under consideration for inclusion in the operational processor: HCN, CF4, HCFC-22, COF2 and CCl4.

  8. HFC-134A and HCFC-22 supermarket refrigeration demonstration and laboratory testing. Phase I. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Aspen Systems and a team of nineteen agencies and industry participants conducted a series of tests to determine the performance of HFC-134a, HCFC-22, and CFC-502 for supermarket application. This effort constitutes the first phase of a larger project aimed at carrying out both laboratory and demonstration tests of the most viable HFC refrigerants and the refrigerants they replace. The results of the Phase I effort are presented in the present report. The second phase of the project has also been completed. It centered on testing all viable HFC replacement refrigerants for CFC-502. These were HFC-507, HFC-404A, and HFC-407A. The latter results are published in the Phase II report for this project. As part of Phase I, a refrigeration rack utilizing a horizontal open drive screw compressor was constructed in our laboratory. This refrigeration rack is a duplicate of one we have installed in a supermarket in Clifton Park, NY.

  9. Between prohibition and proof of need

    International Nuclear Information System (INIS)

    This article discusses the consequences of new Swiss legislation on the use of chloro-fluoro-carbons (CFC) in refrigeration and air-conditioning units. In particular, the initial replacement of refrigerants that deplete the ozone layer with CFC products is discussed and the climate warming issues associated with global warming potential of these CFCs are examined. The measures set out in the new materials decree that bans substances with a long-term stability in certain appliances and that demands the adherence to the newest technical standards for operation and maintenance are described. The options of refraining from using cooling apparatus at all or the use of other possible solutions for meeting cooling needs using natural working fluids are discussed and the associated problems are discussed. The article is completed with a table giving figures on ecological impact of various substances and a summary of current regulations

  10. Upgrading of refrigeration units in nuclear power plant: An optimized approach to do justice to governmental restrictions

    International Nuclear Information System (INIS)

    Stringent regulations to reduce the use of chlorofluorocarbons (CFC) and halogenated chlorofluorocarbons (HCFC) have been set into force by many European countries. A ban for new plants containing HCFCs in 2005 and a total ban of HCFCs in 2020 are discussed within the European Community. Siemens-KWU and Sulzer Escher Wyss have developed a well-proofed procedure to solve the CFC problem for existing refrigeration systems in nuclear power plants. The new refrigerants are fluorinated hydrocarbons and for the centrifugal water chiller R134a is best suited. Prior to the market introduction toxicity, short and long term health effects, inflammability and stability of R134a have been investigated. The mechanical examination included wear, corrosion, lubrication and resistance to decomposition. A well-proven procedure was established which ensures the owner of the plant and the supplier best results

  11. ECR ion and plasma source having new magnetic field for diverse applications

    International Nuclear Information System (INIS)

    The ECR ion and plasma source (ECRIPS) does not need any filament or electrode for plasma discharge rendering the least requirement of maintenance and uninterrupted operation for long time. The traditional ECRIPS use magnetic min-B field for plasma containment and energizing electrons based on the principle of the ECR process. Some new cusp field configurations (CFC) have been simulated to generate large volume uniform plasma of high density making it very appropriate for producing wide beam for low as well as high charged ion beam. The new cusp field, which is magneto-hydrodynamic (MHD) stable produce modified min-B or 0-B field. It can be designed corresponding to any RF frequency. Confinement feature of the field is assessed by electron simulation and found to contain the particles for longer time in comparison to the traditional similar field configuration (TFC). The CFC can be used to construct a new genre of ECRIPS for various applications. (author)

  12. Investigation of flushing and clean-out methods for refrigeration equipment to ensure system compatibility

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, J.J.; Shows, M.; Abel, M.W. [Integral Sciences Inc., Columbus, OH (United States)

    1996-04-24

    SECTION 608 of the Clean Air Act Amendments has altered much of the refrigeration service contracting industry. MCLR Project Number 660-52502 was established to examine two areas where the Amendments are influencing contractors to determine if more cost-effective service procedures might be developed. One area where existing service procedures are being revisited involves the removal of contaminants from a refrigeration system after a motor burnout. At one time, a Class 1 substance such as CFC-11 or CFC-113 was used as a flushing agent for cleaning a system after a burnout. On large systems, the compressor was disassembled, and the parts were cleaned using 1,1,1-trichloroethane (TCA) or a TCA-containing mixture. Such alternatives are seldom possible today, as the manufacture of Class 1 substances was banned on January 1, 1996. This report describes processes for mineral oil removal, process alternatives for servicing burnouts, solvents, and laboratory retrofit tests.

  13. A new environment-friendly refrigerant

    Institute of Scientific and Technical Information of China (English)

    赵晓宇; 史琳; 朱明善; 韩礼钟

    1999-01-01

    CFCs and HCFCs, widely used in refrigeration and air-conditioning equipment, have been or will be phased out according to the revisions of the Montreal Protocol because they deplete the ozone layer. Many substitutes have been proposed, but no one has perfectly replaced the CFC end HCFC refrigerants. New generation alternatives are being investigated worldwide. According to the industrial and environmental requirements, many factors should be considered in the screening and evaluation of refrigerant alternatives. A new method is proposed using the soft algebra method——fuzzy multiple evaluation. The weights for different factors are determined mathematically and criteria values for all the objects are made dimensionless to quantitatively compare the different alternatives. A new long-term drop-in mixture alternative THR02 is developed and evaluated in a series of theoretical and experimental evaluations.THR02 is proved to be an environment-friendly, nontoxic, inflammable, drop-in alternative to CFC-12 a

  14. 氟利昂替代后吸入气雾剂(MDIs)的研究要求和进展Ⅱ抛射剂替代的MDIs的技术挑战和工业化生产%Transition of Propellants in Metered Dose Inhalers (MDIs) Ⅱ.Technical Challenge and Industrial Manufacture of Alternative Propellant MDIs

    Institute of Scientific and Technical Information of China (English)

    侯曙光; 魏农农; 金方

    2009-01-01

    吸入气雾剂(MDIs)中抛射剂氟利昂(CFC)的替代并非制剂中简单的辅料替换.综述了氢氟烷烃(HFA)替代CFC过程中所涉及的处方组成改变、工艺参数优化、给药装置的选择、制药设备的更新以及产业化过程中的特殊要求.%The propellant transition in metered dose inhalers (MDIs) is not a simple replacement of CFC by HFA in the formulations. This paper reviews the technical challenges for the development of alternative propellant MDIsincluding changes of formulation composition, optimization of product process, selection of container closure system,improvement of manufacture equipment, and requirements for industrial manufacture.

  15. Ag-nanoparticle-decorated porous ZnO-nanosheets grafted on a carbon fiber cloth as effective SERS substrates

    Science.gov (United States)

    Wang, Zhiwei; Meng, Guowen; Huang, Zhulin; Li, Zhongbo; Zhou, Qitao

    2014-11-01

    We report on the large-scale synthesis of Ag-nanoparticle (Ag-NP) decorated ZnO-mesoporous-nanosheets (NSs) grafted on a flexible carbon fiber cloth (CFC), as sensitive and reproducible surface enhanced Raman scattering (SERS) substrates with excellent flexibility. The composite SERS-substrates are achieved by a combination of atomic layer deposition of ZnO-seeds on each fiber of the CFC (denoted as ZnO-seeds@CFC), chemical bath deposition and subsequent pyrolysis for the creation of ZnO-mesoporous-NSs grafted on ZnO-seeds@CFC, and ion-sputtering of Ag-NPs on the ZnO-mesoporous-NSs. As abundant SERS ``hot spots'' are generated from the electromagnetic coupling of the densely distributed Ag-NPs, and the semiconducting ZnO-mesoporous-NSs also have chemical supporting enhancement and distinct molecule adsorbing abilities, the composite SERS-substrates demonstrate high SERS-sensitivity with good signal reproducibility. As a trial for potential applications, the composite SERS-substrates were used to identify pesticides and highly toxic polychlorinated biphenyls (PCBs), and low concentrations down to 10-7 M for methyl parathion and 5 × 10-6 M for PCB-77 were reached, respectively, showing promising potential for the SERS-based rapid detection of toxic organic pollutants in the environment.We report on the large-scale synthesis of Ag-nanoparticle (Ag-NP) decorated ZnO-mesoporous-nanosheets (NSs) grafted on a flexible carbon fiber cloth (CFC), as sensitive and reproducible surface enhanced Raman scattering (SERS) substrates with excellent flexibility. The composite SERS-substrates are achieved by a combination of atomic layer deposition of ZnO-seeds on each fiber of the CFC (denoted as ZnO-seeds@CFC), chemical bath deposition and subsequent pyrolysis for the creation of ZnO-mesoporous-NSs grafted on ZnO-seeds@CFC, and ion-sputtering of Ag-NPs on the ZnO-mesoporous-NSs. As abundant SERS ``hot spots'' are generated from the electromagnetic coupling of the densely

  16. Chapter 2. Chlorofluorocarbons in the atmosphere

    International Nuclear Information System (INIS)

    CFCs were predominantly consumed and released by industrialized nations between the latitudes of 30 deg. N and 70 deg. N (Hartley et al., 1996); therefore, the troposphere mixing ratios in the northern hemisphere historically have been higher than those of the southern hemisphere. However, with the phasing out of CFC production by the developed countries (Montreal Protocol on Substances that Deplete the Ozone Layer), the interhemispheric differences in the mixing ratios have appreciably decreased. Near urban areas, some CFC mixing ratios are often raised relative to background air composition. If these differences are neglected, then the calculated age of the water from these urban or densely populated sites will appear contaminated or younger than the actual recharge age of the groundwater

  17. Autism traits in the RASopathies

    OpenAIRE

    Adviento, B; Corbin, IL; Widjaja, F; Desachy, G; Enrique, N.; Rosser, T.; Risi, S; Marco, EJ; Hendren, RL; Bearden, CE; Rauen, KA; Weiss, LA

    2013-01-01

    Background Mutations in Ras/mitogen-activated protein kinase (Ras/MAPK) pathway genes lead to a class of disorders known as RASopathies, including neurofibromatosis type 1 (NF1), Noonan syndrome (NS), Costello syndrome (CS), and cardio-facio-cutaneous syndrome (CFC). Previous work has suggested potential genetic and phenotypic overlap between dysregulation of Ras/MAPK signalling and autism spectrum disorders (ASD). Although the literature offers conflicting evidence for association of NF1 and...

  18. The effect of metabolic regulation on microvascular permeability to small and large molecules in short-term juvenile diabetics

    DEFF Research Database (Denmark)

    Parving, H H; Noer, Ivan; Deckert, Toke;

    1976-01-01

    of albumin (TER), glomerular filtration rate (GFR), capillary filtration coefficient (CFC), and capillary diffusion capacity (CDC). The urinary albumin and beta2-microglobulin concentration were measured by sensitive radioimmunoassays; TER was detemined from the initial disappearance of intravenously......The microvascular permeability to small and large molecules was studied during good and poor metabolic regulation in ten short duration juvenile diabetics. The following variables were measured; daily urinary albumin and beta2-microglobulin-excretion rates, whole body transcapillary escape rate...

  19. A novel biomarker of amnestic MCI based on dynamic cross-frequency coupling patterns during cognitive brain responses.

    Science.gov (United States)

    Dimitriadis, Stavros I; Laskaris, Nikolaos A; Bitzidou, Malamati P; Tarnanas, Ioannis; Tsolaki, Magda N

    2015-01-01

    The detection of mild cognitive impairment (MCI), the transitional stage between normal cognitive changes of aging and the cognitive decline caused by AD, is of paramount clinical importance, since MCI patients are at increased risk of progressing into AD. Electroencephalographic (EEG) alterations in the spectral content of brainwaves and connectivity at resting state have been associated with early-stage AD. Recently, cognitive event-related potentials (ERPs) have entered into the picture as an easy to perform screening test. Motivated by the recent findings about the role of cross-frequency coupling (CFC) in cognition, we introduce a relevant methodological approach for detecting MCI based on cognitive responses from a standard auditory oddball paradigm. By using the single trial signals recorded at Pz sensor and comparing the responses to target and non-target stimuli, we first demonstrate that increased CFC is associated with the cognitive task. Then, considering the dynamic character of CFC, we identify instances during which the coupling between particular pairs of brainwave frequencies carries sufficient information for discriminating between normal subjects and patients with MCI. In this way, we form a multiparametric signature of impaired cognition. The new composite biomarker was tested using data from a cohort that consists of 25 amnestic MCI patients and 15 age-matched controls. Standard machine-learning algorithms were employed so as to implement the binary classification task. Based on leave-one-out cross-validation, the measured classification rate was found reaching very high levels (95%). Our approach compares favorably with the traditional alternative of using the morphology of averaged ERP response to make the diagnosis and the usage of features from spectro-temporal analysis of single-trial responses. This further indicates that task-related CFC measurements can provide invaluable analytics in AD diagnosis and prognosis. PMID:26539070

  20. Experimental Investigation and Mathematical Modeling of Commercially Available R744 Compressors

    OpenAIRE

    Kurtulus, Orkan; Olgun, Burak; Oguz, Emre

    2012-01-01

    The vapor compression cycle using refrigerant CFC (chlorofluorocarbon) and HCFC (hydrochlorofluorocarbon) is widely used in refrigeration, air-conditioning and water heating industries. Utilization of these gases are prohibited by the Montreal Protocol. The critical temperature of carbon dioxide (CO2) is much lower than that of the other refrigerants, namely 31.06°C. The gas cooling process occurs at a constant pressure but at variable temperatures takes the place of the condensation process ...

  1. INVESTIGATIONS ON THE PERFORMANCE OF VAPOUR COMPRESSION SYSTEM RETROFITTED WITH ZEOTROPIC REFRIGERANT R404A

    OpenAIRE

    A. Lovelin Jerald; D. SenthilKumaran

    2014-01-01

    The environmental impacts like global warming and ozone depletion has become a challenge to the refrigeration and air conditioning industry. Chloro Fluoro Carbons (CFCs) and Hydro Flouro Carbons (HCFCs) are referred to as an Ozone Depleting Substances (ODS) because once these gases are released into the environment and reach the stratosphere, depletes the ozone layer. This research paper aims to study the performance characteristics of an R12 (CFC) vapour compression refrigeration system retr...

  2. The Design and Performance Analysis of Refrigeration System Using R12 & R134a Refrigerants

    OpenAIRE

    K. Nagalakshmi; G. Marurhiprasad Yadav

    2014-01-01

    The design and performance analysis of refrigeration system using R12 & R134a refrigerants are presented in this report. The design calculations of the suitable and necessary refrigerator equipment and their results are also reported here. CFC-12 is the most widely used refrigerant. It serves both in residential and commercial applications, from small window units to large water chillers, and everything in between. Its particular combination of efficiency, capacity and pressur...

  3. The CoCoNuT code: from neutron star oscillations to supernova explosions

    Science.gov (United States)

    Cerdá-Durán, P.; Gabler, M.; Müller, E.; Font, J. A.; Stergioulas, N.; Obergaulinger, M.; Aloy, M. A.; DeBrye, N.; Cordero-Carrión, I.; Ibáñez, J. M.

    2013-05-01

    CoCoNuT is a numerical code, that evolves the General relativistic magneto-hydrodynamics equations coupled to the Einstein equations in the CFC approximation. Its main purpose is to simulate astrophysical scenarios in which strong gravity is important such as the collapse of massive stars and the evolution of neutron stars. I review recent results of the numerical code regarding neutron star oscillations and core collapse supernova and its observational consequences.

  4. Dynamical spacetimes and gravitational radiation in a Fully Constrained Formulation

    CERN Document Server

    Cordero-Carrión, Isabel; Ibáñez, José María

    2010-01-01

    This contribution summarizes the recent work carried out to analyze the behavior of the hyperbolic sector of the Fully Constrained Formulation (FCF) derived in Bonazzola et al. 2004. The numerical experiments presented here allows one to be confident in the performances of the upgraded version of CoCoNuT's code by replacing the Conformally Flat Condition (CFC) approximation of the Einstein equations by the FCF.

  5. Human response to global change

    International Nuclear Information System (INIS)

    Alertness of the global climate and environment change triggered by the effects of the economy of waste of industrial modern society has been raised to governments and populations. World-wide agreements and protocols have been established; they will be improved for action in two major issues: limitation (elimination of CFC's use, reductions of CO2 emissions, increasing energy efficiency, etc.) and adaptation (socio economic impacts, human behaviour, enhancement of predictive models, etc.)

  6. Latest development trends: R 134a, R 123, R 152a, mixtures and oils. Seminar of the Research Centre for Refrigeration Engineering and Heat Pumps GmbH (FKW). Neueste Entwicklungstendenzen: R 134a, R 123, R 152a, Gemische und Oele. Seminar des Forschungszentrums fuer Kaeltetechnik und Waermepumpen GmbH FKW

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1991-01-01

    Already for the second time in this year it was the task of the FKW seminar to give experts from the user and operator side latest information from research and development of refrigerating machinery and substitutes. In April it was information about promising alternative technologies what hold the attention of the seminar participants, and this time it was to hear if and in which way CFC substitutes can be used in different compressor systems. (orig.).

  7. Greenhouse effect of chlorofluorocarbons and other trace gases

    OpenAIRE

    Hansen, James; Lacis, Andrew; Prather, Michael

    1989-01-01

    We compare the radiative (greenhouse) forcing of the climate system due to changes of atmospheric chlorofluorocarbons and other trace gases. We find that CFCs, defined to include chlorofluorocarbons, chlorocarbons, and fluorocarbons, now provide about one-quarter of current annual increases in anthropogenic greenhouse climate forcing. If the growth rates of CFC production in the early 1970s had continued to the present, current annual growth of climate forcing due to CFCs would exceed that du...

  8. Ex vivo expansions and transplantations of mouse bone marrow-derived hematopoietic stem/progenitor cells

    Institute of Scientific and Technical Information of China (English)

    王金福; 吴亦凡; HARRINTONGJenny; McNIECEIanK.

    2004-01-01

    To examine the effects of co-culture with bone marrow mesenchymal stem cells on expansion of hematopoietic tem/progenitor cells and the capacities of rapid neutrophil engraftment and hematopoietic reconstitution of the expanded ells, we expanded mononuclear cells (MNCs) and CD34+/c-kit+ cells from mouse bone marrow and transplanted the expanded cells into the irradiated mice. MNCs were isolated from mouse bone marrow and CD34+/c-kit+ cells were selected from MNCs by using MoFlo Cell Sorter. MNCs and CD34+/c-kit+ cells were co-cultured with mouse bone marrow-derived mesenchymal stem cells (MSCs) under a two-step expansion. The expanded cells were then transplanted into sublethally irradiated BDF 1 mice. Results showed that the co-culture with MSCs resulted in expansions of median total nucleated cells, CD34+ cells, GM-CFC and HPP-CFC respectively by 10.8-, 4.8-, 65.9- and 38.8-fold for the mononuclear cell culture, and respectively by 76.1-, 2.9-, 71.7- and 51.8-fold for the CD34+/c-kit+ cell culture. The expanded cells could rapidly engraft in the sublethally irradiated mice and reconstitute their hematopoiesis. Co-cultures with MSCs in conjunction with two-step expansion increased expansions of total nucleated cells, GM-CFC and HPP-CFC, which led us to conclude MSCs may create favorable environment for expansions of hematopoietic stem/progenitor cells. The availability of increased numbers of expanded ceils by the co-culture with MSCs may result in more rapid engraftment ofneutrophils following infusion to transplant recipients.

  9. Ex vivo expansions and transplantations of mouse bone marrow-derived hematopoietic stem/progenitor cells

    Institute of Scientific and Technical Information of China (English)

    WANG Jin-fu(王金福); WU Yi-fan(吴亦凡); HARRINTONG Jenny; McNIECE Ian K.

    2004-01-01

    To examine the effects of co-culture with bone marrow mesenchymal stem cells on expansion of hematopoietic stem/progenitor cells and the capacities of rapid neutrophil engraftment and hematopoietic reconstitution of the expanded cells, we expanded mononuclear cells (MNCs) and CD34+/c-kit+ cells from mouse bone marrow and transplanted the expanded cells into the irradiated mice. MNCs were isolated from mouse bone marrow and CD34+/c-kit+ cells were selected from MNCs by using MoFlo Cell Sorter. MNCs and CD34+/c-kit+ cells were co-cultured with mouse bone marrow-derived mesenchymal stem cells (MSCs) under a two-step expansion. The expanded cells were then transplanted into sublethally irradiated BDF1 mice. Results showed that the co-culture with MSCs resulted in expansions of median total nucleated cells,CD34+ cells, GM-CFC and HPP-CFC respectively by 10.8-, 4.8-, 65.9- and 38.8-fold for the mononuclear cell culture, and respectively by 76.1-, 2.9-, 71.7- and 51.8-fold for the CD34+/c-kit+ cell culture. The expanded cells could rapidly engraft in the sublethally irradiated mice and reconstitute their hematopoiesis. Co-cultures with MSCs in conjunction with two-step expansion increased expansions of total nucleated cells, GM-CFC and HPP-CFC, which led us to conclude MSCs may create favorable environment for expansions of hematopoietic stem/progenitor cells. The availability of increased numbers of expanded cells by the co-culture with MSCs may result in more rapid engraftment ofneutrophils following infusion to transplant recipients.

  10. Model calculations of the relative effects of CFCs and their replacements on stratospheric ozone

    Science.gov (United States)

    Fisher, Donald A.; Hales, Charles H.; Filkin, David L.; Ko, Malcolm K. W.; Sze, N. Dak

    1990-01-01

    Because chlorine has been linked to the destruction of stratospheric ozone, the use of many fully halogenated compounds, such as the chlorofluorocarbons CFC-11 and -12, is restricted by international agreement. Hydrohalocarbons are under intensive development as replacements for CFCs. Because they contain hydrogen, these gases are susceptible to tropospheric destruction which significantly shortens their atmospheric lifetimes,. Model calculations show that chlorine-containing hydrohalocarbons have less effect on ozone, by an order of magnitude, than their regulated counterparts.

  11. TABES 93 - Annual Technical and Business Exhibition and Symposium, 9th, Huntsville, AL, May 11, 12, 1993, Submitted Papers

    Science.gov (United States)

    The present symposium on space science and engineering discusses commercial space opportunities, materials processing in space, and the impact of TQM concepts on inspection of aerospace systems. Attention is given to the defense budget environment, tactical missiles and the changing world, and government/contractor development teams. Topics addressed include technology demonstration and evaluation activities in the Department of the Army, total environmental quality management in corporate America, and environmental lessons to be learned from the upcoming CFC phase-out.

  12. Isolation and characterization of antimicrobial proteins produced by a potential probiotic strain of human Lactobacillus rhamnosus 231 and its effect on selected human pathogens and food spoilage organisms

    OpenAIRE

    Ambalam, P. S.; Prajapati, J. B.; Dave, J. M.; Nair, Baboo M.; Ljungh, Åsa; Vyas, B. R. M.

    2011-01-01

    Objective: To study in vitro properties of potential probiotics and the antimicrobial activity of Lactobacillus rhamnosus 231 isolated from human faeces. Methods and Results: Lact. rhamnosus 231 isolated from human faeces tolerated bile salt (4%), phenol (0.5%), and NaCl (4%) and retained viability at low pH (2.5). The cell-free culture (CFC) fi ltrate and extracellular protein concentrate (EPC) of Lact. rhamnosus 231 contained antimicrobial substances active against Pseudomonas aeruginosa, E...

  13. HCC-240fa氟化合成HFC-245fa技术进展%Progress on Synthesizing HFC -245fa by Fluorinating HCC -240fa

    Institute of Scientific and Technical Information of China (English)

    张国利; 杨会娥; 张文庆; 赵新堂

    2009-01-01

    HFC-245fa作为ODS发泡剂HCHC-141b和CFC-11的良好替代品,具有很好工业前景.全面综述了以HCC-240fa为原料合成HFC-245fa的各种工艺,并对HFC-245fa粗品的提纯进行详细的讨论.

  14. Risk communication: Anthropogenically induced climatic changes

    International Nuclear Information System (INIS)

    In order to reduce the risk of the greenhouse effect, conventional thermal power plants should be substituted by maximum energy conservation, use of renewable energies, and low-risk, high-tech nuclear power plants. Motor traffic exhausts could be eliminated by alternative fuels, and trace gas reducers, such as tropical rain forests, preserved by financial adjustments. CFC's are to be reduced in any case in order to lower the ozone risk. (DG)

  15. Hats off to CERN's Master of Apprenticeships ! Roland Gay of the HR Department (at right) recently received a special diploma from the Geneva Industrial Union (UIG).

    CERN Multimedia

    2004-01-01

    Presented by Carlo Lamprecht, Head of the Department of Economy, Employment and External Affairs of the State of Geneva, the diploma was awarded in recognition of the 199 CERN apprentices Roland has guided through the Certificat Fédéral de Capacité (CFC), an end-of-apprenticeship certificate awarded by the Cantonal authorities. Roland will be retiring in December 2004 after 37 years of service, 32 of which he spent in the role of apprenticeship supervisor.

  16. PEMANASAN GLOBAL

    Directory of Open Access Journals (Sweden)

    Vivi Triana

    2008-03-01

    Full Text Available Pemanasan global (global warming pada dasarnya merupakan fenomena peningkatan temperature global dari tahun ke tahun karena terjadinya efek rumah kaca (greenhouse effect yang disebabkan oleh meningkatnya emisi gas-gas seperti karbondioksida (CO2, metana (CH4, dinitrooksida (N2O dan CFC sehingga energy matahari terperangkap dalam atmosfer bumi. Berbagai literatur menunjukkan kenaikan temperatur global termasuk Indonesia yang terjadi pada kisaran 1,5 – 40 °C pada akhir abad 21.

  17. PEMANASAN GLOBAL

    OpenAIRE

    Vivi Triana

    2008-01-01

    Pemanasan global (global warming) pada dasarnya merupakan fenomena peningkatan temperature global dari tahun ke tahun karena terjadinya efek rumah kaca (greenhouse effect) yang disebabkan oleh meningkatnya emisi gas-gas seperti karbondioksida (CO2), metana (CH4), dinitrooksida (N2O) dan CFC sehingga energy matahari terperangkap dalam atmosfer bumi. Berbagai literatur menunjukkan kenaikan temperatur global termasuk Indonesia yang terjadi pada kisaran 1,5 – 40 °C pada akhir abad 21.

  18. Greenhouse effect of chlorofluorocarbons and other trace gases

    Science.gov (United States)

    Hansen, James; Lacis, Andrew; Prather, Michael

    1989-01-01

    A comparison is made of the radiative (greenhouse) forcing of the climate system due to changes of atmospheric chlorofluorocarbons and other trace gases. It is found that CFCs, defined to include chlorofluorocarbons, chlorocarbons, and fluorocarbons, now provide about one-quater of current annual increases in anthropogenic greenhouse climate forcing. If the growth rates of CFC production in the early 1970s had continued to the present, current annual growth of climate forcing due to CFCs would exceed that due to CO2.

  19. Modelling of electromagnetic material properties at microwave frequencies

    OpenAIRE

    Alsadi, Majid Hamid Nassar

    2012-01-01

    In recent years, electromagnetic interference (EMI) has raised serious issues in terms of the unintentional radiation that disrupts the near proximity equipment from working properly. One solution to reduce the effects of EMI is the use of electromagnetic shielding. Carbon fibre composite (CFC) material is a promising customised product that has entered numerous industrial areas due to its attractive properties like high strength, low weight, and the resistance to chemical substances and corr...

  20. CRIPTO1 expression in EGFR-mutant NSCLC elicits intrinsic EGFR-inhibitor resistance

    OpenAIRE

    Park, Kang-Seo; Raffeld, Mark; Moon, Yong Wha; Xi, Liqiang; Bianco, Caterina; Van Pham, Trung; Lee, Liam C.; Mitsudomi, Tetsuya; Yatabe, Yasushi; Okamoto, Isamu; Subramaniam, Deepa; Mok, Tony; Rosell, Rafael; Luo, Ji; Salomon, David S.

    2014-01-01

    The majority of non–small cell lung cancer (NSCLC) patients harbor EGFR-activating mutations that can be therapeutically targeted by EGFR tyrosine kinase inhibitors (EGFR-TKI), such as erlotinib and gefitinib. Unfortunately, a subset of patients with EGFR mutations are refractory to EGFR-TKIs. Resistance to EGFR inhibitors reportedly involves SRC activation and induction of epithelial-to-mesenchymal transition (EMT). Here, we have demonstrated that overexpression of CRIPTO1, an EGF-CFC protei...

  1. New Delivery Systems and Propellants

    Directory of Open Access Journals (Sweden)

    Myrna Dolovich

    1999-01-01

    Full Text Available The removal of chlorofluorocarbon (CFC propellants from industrial and household products has been agreed to by over 165 countires of which more than 135 are developing countries. The timetable for this process is outlined in the Montreal Protocol on Substances that Deplete the Ozone Layer document and in several subsequent amendments. Pressured metered dose inhalers (pMDIs for medical use have been granted temporary exemptions until replacement formulations, providing the same medication via the same route, and with the same efficacy and safety profiles, are approved for human use. Hydrofluoroalkanes (HFAs are the alternative propellants for CFCs-12 and -114. Their potential for damage to the ozone layer is nonexistent, and while they are greenhouse gases, their global warming potential is a fraction (one-tenth of that of CFCs. Replacement formulations for almost all inhalant respiratory medications have been or are being produced and tested; in Canada, it is anticipated that the transition to these HFA or CFC-free pMDIs will be complete by the year 2005. Initially, an HFA pMDI was to be equivalent to the CFC pMDI being replaced, in terms of aerosol properties and effective clinical dose. However, this will not necessarily be the situation, particularly for some corticosteroid products. Currently, only one CFC-free formulation is available in Canada – Airomir, a HFA salbutamol pMDI. This paper discusses the in vitro aerosol characteristics, in vivo deposition and clinical data for several HFA pMDIs for which there are data available in the literature. Alternative delivery systems to the pMDI, namely, dry powder inhalers and nebulizers, are briefly reviewed.

  2. Beryllium Concentrations at European Workplaces: Comparison of ‘Total’ and Inhalable Particulate Measurements

    OpenAIRE

    Kock, Heiko; Civic, Terence; Koch, Wolfgang

    2015-01-01

    A field study was carried out in order to derive a factor for the conversion of historic worker exposure data on airborne beryllium (Be) obtained by sampling according to the 37-mm closed faced filter cassette (CFC) ‘total’ particulate method into exposure concentration values to be expected when sampling using the ‘Gesamtstaubprobenahmesystem’ (GSP) inhalable sampling convention. Workplaces selected to represent the different copper Be work processing operations that typically occur in Germa...

  3. CMSAF products Cloud Fraction Coverage and Cloud Type used for solar global irradiance estimation

    Science.gov (United States)

    Badescu, Viorel; Dumitrescu, Alexandru

    2016-08-01

    Two products provided by the climate monitoring satellite application facility (CMSAF) are the instantaneous Cloud Fractional Coverage (iCFC) and the instantaneous Cloud Type (iCTY) products. Previous studies based on the iCFC product show that the simple solar radiation models belonging to the cloudiness index class n CFC = 0.1-1.0 have rRMSE values ranging between 68 and 71 %. The products iCFC and iCTY are used here to develop simple models providing hourly estimates for solar global irradiance. Measurements performed at five weather stations of Romania (South-Eastern Europe) are used. Two three-class characterizations of the state-of-the-sky, based on the iCTY product, are defined. In case of the first new sky state classification, which is roughly related with cloud altitude, the solar radiation models proposed here perform worst for the iCTY class 4-15, with rRMSE values ranging between 46 and 57 %. The spreading error of the simple models is lower than that of the MAGIC model for the iCTY classes 1-4 and 15-19, but larger for iCTY classes 4-15. In case of the second new sky state classification, which takes into account in a weighted manner the chance for the sun to be covered by different types of clouds, the solar radiation models proposed here perform worst for the cloudiness index class n CTY = 0.7-0.1, with rRMSE values ranging between 51 and 66 %. Therefore, the two new sky state classifications based on the iCTY product are useful in increasing the accuracy of solar radiation models.

  4. Effect of feeding whole compared with cell-free colostrum on calf immune status: Vaccination response.

    Science.gov (United States)

    Langel, S N; Wark, W A; Garst, S N; James, R E; McGilliard, M L; Petersson-Wolfe, C S; Kanevsky-Mullarky, I

    2016-05-01

    Vaccination contributes to improved herd health and production. Boosting immune development at a young age may have long-term effects by enhancing vaccine immune response and efficacy. In the bovine, colostrum is the sole source of maternal immunity, having a substantial effect on health status in the neonate. To date, colostral antibody concentration is used to evaluate colostrum quality. However, colostrum also contains proteins and cells, which may affect immune development and future responses to vaccines. To determine the effect of maternal colostral cells on immune development, 37 female Holstein and Jersey dairy calves were bottle-fed 4 quarts total of whole colostrum (WC) or cell-free colostrum (CFC) at birth. Calves were vaccinated with 2 series of multivalent vaccines. Series A consisted of vaccines given between 1 and 4mo of life. Series B consisted of vaccines given between 5 and 10mo of life. Calf peripheral blood samples were obtained before each vaccination series and monthly for 3mo after each vaccination series. Cellular blood parameters were determined by flow cytometry. Quantitative real-time PCR was used to determine cytokine gene expression in peripheral blood mononuclear cells before vaccination series B and once a month for 2mo after vaccination series B. Calves fed CFC had fewer numbers of B cells in mo 2 after vaccination series A when compared with WC-fed calves. Calves fed CFC had decreased gene expression levels of IL-2 in mo 1 and numbers of CD4(+)CD62L(+)CD45RO(-) and CD4(+)CD62L(+)CD45RO(+) T cells in mo 0 and 1 after vaccination series B as compared with WC-fed calves. Our findings indicate a greater response to vaccines up to 6 to 10mo post-WC feeding when compared with CFC. These data suggest that adoptive transfer of maternal colostral cells at birth has a long-term effect on development of the neonatal immune system. PMID:26923041

  5. Effect of feeding whole compared with cell-free colostrum on calf immune status: The neonatal period.

    Science.gov (United States)

    Langel, S N; Wark, W A; Garst, S N; James, R E; McGilliard, M L; Petersson-Wolfe, C S; Kanevsky-Mullarky, I

    2015-06-01

    Mortality and decreased weight gain resulting from infection and disease in dairy calves are problems within the dairy industry. The bovine neonate relies solely on colostrum to acquire antibodies through passive transfer. To date, colostrum quality is determined by the concentration of antibodies. However, proteins and cells in the colostrum might also enhance immune development in the neonate. To determine the effect of maternal colostral immune cells on calf health and immune status, maternal colostrum was fed either fresh or after lysis of cells by flash-freezing in liquid nitrogen. Thirty-seven female Holstein and Jersey dairy calves were fed 4 quarts total of whole colostrum (WC) or cell-free colostrum (CFC) at birth. Respiratory and fecal scores were measured from birth to d 45 of life. Calf peripheral blood samples were obtained before and after feeding colostrum as well as on d 1, 3, 7, 14, 21, and 28 of life. Peripheral blood mononuclear cells were collected and analyzed for cellular parameters by flow cytometry. Total respiratory scores were greater in CFC-fed calves compared with WC-fed calves on d 38 of life. There were fewer CD4+ T cells and CD4+CD62L+CD45RO- T cells on d 1 and fewer CD4+CD62L+CD45RO+ T cells on d 1 and 3 in CFC-fed calves compared with WC-fed calves. Compared with WC-fed calves, CFC-fed calves had a greater percentage of CD4+CD62L-CD45RO+ T cells on d 0.25, 1, 3, and 7, and a greater percentage of monocytes on d 7. Our data suggest that colostral cells adoptively transfer and enhance neonatal immunity during the first month of life. PMID:25795487

  6. Mechanisms and Kinetics of Reactions of the O (1D,3p) + CF3Cl System

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ In the stratosphere, CF3Cl (CFC 13) can either photodecompose or react directly with atomic oxygen to generate ozone-depleting agents such as Cl and ClO in the gas phase[1-3]. Since the 1970s, attention has been focused on the effects of these compounds on the destruction of ozone in the stratosphere and on global warming[4,5].

  7. Greenhouse effect: an issue for the refrigeration and air conditioning sector; Effet de serre: quelle problematique pour le froid et le conditionnement de l`air?

    Energy Technology Data Exchange (ETDEWEB)

    Billiard, F. [Institut International du Froid, 75 - Paris (France)

    1997-12-31

    The principles of greenhouse effect and the greenhouse gas main direct and indirect emission sources due to refrigeration and air conditioning systems are first reviewed. Evolution scenarios from 1992 to 2020 and 2100 for the emissions of CFC, HCFC and HFC are presented and related to the Kyoto protocol project limitations; technical improvements in refrigerating and air conditioning systems (lower refrigerant utilization, fluid confinement, alternative technologies, natural refrigerant utilization, etc.) could lead to substantial diminutions of these greenhouse gases

  8. Factors Associated with Parental Perception of Child Vulnerability 12 months After Abnormal Newborn Screening Results

    OpenAIRE

    Tluczek, Audrey; McKechnie, Anne Chevalier; Brown, Roger L

    2011-01-01

    We identified factors associated with elevated parental perceptions of child vulnerability (PPCV) 12 months after newborn screening (NBS) of 136 children: healthy, normal results (H, n=37), cystic fibrosis carriers (CF-C, n=40), congenital hypothyroidism (CH, n=36), and cystic fibrosis (CF, n=23). Controlling for infant and parent characteristics, mixed logit structural equation modeling showed direct paths to PPCV included parent female sex, CF diagnosis, and high documented illness frequenc...

  9. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    OpenAIRE

    J. W. Elkins; Krummel, P.B.; Mondeel, D. J.; D. Nance; G. S. Dutton; Hall, B D; P. G. Simmonds; Young, D.; Weiss, R. F.; P. K. Salameh; Mühle, J.; C. M. Harth; McCulloch, A; Montzka, S. A.; S. O'Doherty

    2012-01-01

    Since the Montreal Protocol on substances that deplete the ozone layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements beg...

  10. Past changes in the vertical distribution of ozone - Part 1: Measurement techniques, uncertainties and availability

    OpenAIRE

    Hassler, B.; Petropavlovskikh, I; J. Staehelin; August, T.; Bhartia, P. K.; Clerbaux, Cathy; Degenstein, D.; De Mazière, M.; DINELLI, B. M.; Dudhia, A.; Dufour, G.; Frith, S. M.; Froidevaux, L.; Godin-Beekmann, Sophie; Granville, J.

    2014-01-01

    Peak stratospheric chlorofluorocarbon (CFC) and other ozone depleting substance (ODS) concentrations were reached in the mid to late 1990s. Detection and attribution of the expected recovery of the stratospheric ozone layer in an atmosphere with reduced ODSs as well as efforts to understand the evolution of stratospheric ozone in the presence of increasing greenhouse gases are key current research topics. These require a critical examination of the ozone changes with an accurate knowledge of ...

  11. Past changes in the vertical distribution of ozone - Part 1: Measurement techniques, uncertainties and availability

    OpenAIRE

    Hassler, B.; Petropavlovskikh, I; J. Staehelin; August, T.; Bhartia, P. K.; Clerbaux, C.; Degenstein, D.; De Mazière, M.; DINELLI, B. M.; Dudhia, A.; Dufour, G.; Frith, S. M.; Froidevaux, L.; S. Godin-Beekmann; Granville, J.

    2014-01-01

    Peak stratospheric chlorofluorocarbon (CFC) and other ozone depleting substance (ODS) concentrations were reached in the mid- to late 1990s. Detection and attribution of the expected recovery of the stratospheric ozone layer in an atmosphere with reduced ODSs as well as efforts to understand the evolution of stratospheric ozone in the presence of increasing greenhouse gases are key current research topics. These require a critical examination of the ozone ch...

  12. Re-evaluation of the lifetimes of the major CFCs and CH[subscript 3]CCl[subscript 3] using atmospheric trends

    OpenAIRE

    Rigby, M.; R. G. Prinn; S. O'Doherty; Montzka, S. A.; McCulloch, A; C. M. Harth; Mühle, J.; P. K. Salameh; Weiss, R. F.; Young, D.; P. G. Simmonds; Hall, B D; G. S. Dutton; D. Nance; Mondeel, D. J.

    2013-01-01

    Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began ...

  13. A STUDY OF THE REQUIRED PUBLIC ACCOUNTING PROGRAM IN PUBLIC COMPETITIVE EXAMINATIONS HELD BY CESPE

    OpenAIRE

    Fátima de Souza Freire; Thaise Corcino da Nóbrega; Matheus de Mendonça Marques; Ednei Morais Pereira

    2012-01-01

    With a view to standardizing the contents offered to future Accounting professionals, the Federal Accounting Council (CFC) elaborated the National Proposal for Undergraduate Accountancy Program Contents. Thus, the curriculum that Higher Education Institutions (HEI) adopt serves as an ally for students’ professional conquests. Stability and favorable job conditions attract many people to the dispute for a public function, with a growing Braz ilian public competitive examination market. Accordi...

  14. A novel biomarker of amnestic MCI based on dynamic Cross-Frequency Coupling patterns during cognitive brain responses

    Directory of Open Access Journals (Sweden)

    Stavros I Dimitriadis

    2015-10-01

    Full Text Available The detection of mild cognitive impairment (MCI, the transitional stage between normal cognitive changes of aging and the cognitive decline caused by AD, is of paramount clinical importance, since MCI patients are at increased risk of progressing into AD. Electroencephalographic (EEG alterations in the spectral content of brainwaves and connectivity at resting state have been associated with early-stage AD. Recently, cognitive event-related potentials (ERPs have entered into the picture as an easy to perform screening test. Motivated by the recent findings about the role of cross-frequency coupling (CFC in cognition, we introduce a relevant methodological approach for detecting MCI based on cognitive responses from a standard auditory oddball paradigm. By using the single trial signals recorded at Pz sensor and comparing the responses to target and non-target stimuli, we first demonstrate that increased CFC is associated with the cognitive task. Then, considering the dynamic character of CFC, we identify instances during which the coupling between particular pairs of brainwave frequencies carries sufficient information for discriminating between normal subjects and patients with MCI. In this way, we form a multiparametric signature of impaired cognition. The new composite biomarker was tested using data from a cohort that consists of 25 amnestic MCI patients and 15 age-matched controls. Standard machine-learning algorithms were employed so as to implement the binary classification task. Based on leave-one-out cross-validation, the measured classification rate was found reaching very high levels (95%. Our approach compares favorably with the traditional alternative of using the morphology of averaged ERP response to make the diagnosis and the usage of features from spectro-temporal analysis of single-trial response. This further indicates that task-related CFC measurements can provide invaluable analytics in AD diagnosis and prognosis.

  15. Boilers, evaporators, and condensers

    International Nuclear Information System (INIS)

    This book reports on the boilers, evaporators and condensers that are used in power plants including nuclear power plants. Topics included are forced convection for single-phase side heat exchangers, heat exchanger fouling, industrial heat exchanger design, fossil-fuel-fired boilers, once through boilers, thermodynamic designs of fossil fuel-first boilers, evaporators and condensers in refrigeration and air conditioning systems (with respect to reducing CFC's) and nuclear steam generators

  16. Ozone friendly HFC134a/HC mixture compatible with mineral oil in refrigeration system improves energy efficiency of a walk in cooler

    International Nuclear Information System (INIS)

    In the event of chloro fluorocarbon (CFC) phase out, identifying a long term alternative to meet all our requirements in respect of system performance and service is an important area for research in the refrigeration and air conditioning (RAC) sector. Even though HFC134a and the HC blend (containing 55.2% HC600a and 44.8% HC290) have been reported to be substitutes for CFC12, they have their own drawbacks in energy efficiency, flammability and serviceability aspects of the system. HFC134a is not miscible with mineral oil, and hence, polyol ester oil is recommended, which is highly hygroscopic in nature. This hygroscopicity demands stringent service practices, which otherwise results in moisture entry into the system. On the other hand, the HC blend has flammability issues, and hence, the charge quantity in systems is limited by safety standards. This work focuses on experimentally studying the performance of an ozone friendly refrigerant mixture (containing HFC134a/HC600a/HC290) in a walk in cooler, operating with an open type compressor with mineral oil as lubricant. To have a realistic comparison of the new mixture performance, tests were conducted with the conventional refrigerant (CFC12) for the system behaviour, such as no load pull down time, motor power, energy consumption, ON and OFF cycle time, temperature distribution along the coil and COP. The performance of the system with the new mixture was studied and compared. The oil miscibility of the new mixture with mineral oil was also studied and found to be good. It is observed that the mixture has better performance, resulting in 28.6% less energy consumption than CFC12. The enhancement in COP was 6-10%

  17. Operation plans for reducing greenhouse effect gas emissions

    International Nuclear Information System (INIS)

    The European Fluorocarbon Technical Committee (EFCTC) is presenting an operation project for air conditioning, refrigerating, foam, etc. industries that use fluorocarbons (CFC, HCFC, HFC), in order to market safe and high performance products, through various means: cooperation between industries and government for reducing greenhouse gas emissions (such as concerning leakage rate in refrigeration or gas inter-dependency effects), energy conservation measures, thermal insulation measures in building, and technological cooperation with developing countries

  18. The Design and Performance Analysis of Refrigeration System Using R12 & R134a Refrigerants

    Directory of Open Access Journals (Sweden)

    K. Nagalakshmi

    2014-02-01

    Full Text Available The design and performance analysis of refrigeration system using R12 & R134a refrigerants are presented in this report. The design calculations of the suitable and necessary refrigerator equipment and their results are also reported here. CFC-12 is the most widely used refrigerant. It serves both in residential and commercial applications, from small window units to large water chillers, and everything in between. Its particular combination of efficiency, capacity and pressure has made it a popular choice for equipment designers. Nevertheless, it does have some ODP, so international law set forth in the Montreal Protocol has put CFC-12 on a phase out schedule.HFC-134a has been established as a drop-in alternative for CFC-12 in the industry due to their zero Ozone Depletion Potential (ODP and similarities in thermodynamic properties and performance. However, when a system is charged with a HFC-134a compressor oil has to be changed.Not enough research has been done to cover all aspects of alternative refrigerants applications in the systems. This project intended to explore behavior of this alternative refrigerants compare to CFC-12 and challenges the industry is facing in design, operation services and maintenance of these equipments.The purpose of this project is to investigate behavior of R134a refrigerant. This includes performance and efficiency variations when it replaces R12 in an existing system as well as changes involved in maintaining the system charged with R134a. This project is intended to address challenges faced in the real world and some practical issues. Theoretical and experimental approaches used as a methodology in this work.

  19. Development of a youth elixir; La mise en oeuvre d`un elixir de jouvence

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This short paper presents a new refrigerant developed by Quiri Refrigeration company in collaboration with Electricite de France (EdF), which can replace the no-longer produced R-12 CFC. This substitute, called `youth elixir` is a mixture of HCFCs and has similar physical characteristics, is compatible with the R-12 and can be used in a similar pressure range. Its use requires to modify the existing installation but with a reasonable cost. (J.S.)

  20. Effect of feeding whole compared with cell-free colostrum on calf immune status: Vaccination response.

    Science.gov (United States)

    Langel, S N; Wark, W A; Garst, S N; James, R E; McGilliard, M L; Petersson-Wolfe, C S; Kanevsky-Mullarky, I

    2016-05-01

    Vaccination contributes to improved herd health and production. Boosting immune development at a young age may have long-term effects by enhancing vaccine immune response and efficacy. In the bovine, colostrum is the sole source of maternal immunity, having a substantial effect on health status in the neonate. To date, colostral antibody concentration is used to evaluate colostrum quality. However, colostrum also contains proteins and cells, which may affect immune development and future responses to vaccines. To determine the effect of maternal colostral cells on immune development, 37 female Holstein and Jersey dairy calves were bottle-fed 4 quarts total of whole colostrum (WC) or cell-free colostrum (CFC) at birth. Calves were vaccinated with 2 series of multivalent vaccines. Series A consisted of vaccines given between 1 and 4mo of life. Series B consisted of vaccines given between 5 and 10mo of life. Calf peripheral blood samples were obtained before each vaccination series and monthly for 3mo after each vaccination series. Cellular blood parameters were determined by flow cytometry. Quantitative real-time PCR was used to determine cytokine gene expression in peripheral blood mononuclear cells before vaccination series B and once a month for 2mo after vaccination series B. Calves fed CFC had fewer numbers of B cells in mo 2 after vaccination series A when compared with WC-fed calves. Calves fed CFC had decreased gene expression levels of IL-2 in mo 1 and numbers of CD4(+)CD62L(+)CD45RO(-) and CD4(+)CD62L(+)CD45RO(+) T cells in mo 0 and 1 after vaccination series B as compared with WC-fed calves. Our findings indicate a greater response to vaccines up to 6 to 10mo post-WC feeding when compared with CFC. These data suggest that adoptive transfer of maternal colostral cells at birth has a long-term effect on development of the neonatal immune system.

  1. Comparison of halocarbon measurements in an atmospheric dry whole air sample

    Directory of Open Access Journals (Sweden)

    George C. Rhoderick

    2015-11-01

    Full Text Available Abstract The growing awareness of climate change/global warming, and continuing concerns regarding stratospheric ozone depletion, will require continued measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track atmospheric mole fractions and assess the impact of policy on emission rates, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. Precise measurements of these species aid in determining small changes in their atmospheric abundance. A common source of standards/scales and/or well-documented agreement of different scales used to calibrate the measurement instrumentation are key to understanding many sets of data reported by researchers. This report describes the results of a comparison study among National Metrology Institutes and atmospheric research laboratories for the chlorofluorocarbons (CFCs dichlorodifluoromethane (CFC-12, trichlorofluoromethane (CFC-11, and 1,1,2-trichlorotrifluoroethane (CFC-113; the hydrochlorofluorocarbons (HCFCs chlorodifluoromethane (HCFC-22 and 1-chloro-1,1-difluoroethane (HCFC-142b; and the hydrofluorocarbon (HFC 1,1,1,2-tetrafluoroethane (HFC-134a, all in a dried whole air sample. The objective of this study is to compare calibration standards/scales and the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. The results of this study show agreement among four independent calibration scales to better than 2.5% in almost all cases, with many of the reported agreements being better than 1.0%.

  2. [Frequency of eating away-from-home and quality of dietary carbohydrate and fat intake in the SUN Project].

    Science.gov (United States)

    Villacis, Cecilia; Zazpe, Itziar; Santiago, Susana; De la Fuente-Arrillaga, Carmen; Bes-Rastrollo, Maira; Martínez-González, Miguel Angel

    2014-10-03

    Objetivo: Investigar la asociación entre la frecuencia de comidas fuera de casa (CFC) con a) la calidad de hidratos de carbono y b) la calidad de grasas. Materiales y métodos: Se evaluaron 19.371 participantes de la cohorte SUN que completaron un cuestionario basal de frecuencia de consumo de alimentos previamente validado. Se utilizaron los índices de calidad de hidratos de carbono (ICHC) en una escala de 4 a 20 y de grasas (ICG) en una escala de 0,62 a 5,92. En ambos casos, a mayor puntuación mayor calidad. Se utilizó la regresión lineal múltiple para determinar la asociación entre la frecuencia de CFC (4 categorías) y la puntuación de ambos índices, y la regresión logística para medir la asociación entre la frecuencia de CFC y un bajo ICHC o ICG (

  3. Ozone loss derived from balloon-borne tracer measurements and the SLIMCAT CTM

    Directory of Open Access Journals (Sweden)

    A. D. Robinson

    2004-11-01

    Full Text Available Balloon-borne measurements of CFC-11 (on flights of the DIRAC in situ gas chromatograph and the DESCARTES grab sampler, ClO and O3 were made during the 1999/2000 winter as part of the SOLVE-THESEO 2000 campaign. Here we present the CFC-11 data from nine flights and compare them first with data from other instruments which flew during the campaign and then with the vertical distributions calculated by the SLIMCAT 3-D CTM. We calculate ozone loss inside the Arctic vortex between late January and early March using the relation between CFC-11 and O3 measured on the flights, the peak ozone loss (1200 ppbv occurs in the 440–470 K region in early March in reasonable agreement with other published empirical estimates. There is also a good agreement between ozone losses derived from three independent balloon tracer data sets used here. The magnitude and vertical distribution of the loss derived from the measurements is in good agreement with the loss calculated from SLIMCAT over Kiruna for the same days.

  4. Modulation of gene expression in contextual fear conditioning in the rat.

    Directory of Open Access Journals (Sweden)

    Giuseppe Federighi

    Full Text Available In contextual fear conditioning (CFC a single training leads to long-term memory of context-aversive electrical foot-shocks association. Mid-temporal regions of the brain of trained and naive rats were obtained 2 days after conditioning and screened by two-directional suppression subtractive hybridization. A pool of differentially expressed genes was identified and some of them were randomly selected and confirmed with qRT-PCR assay. These transcripts showed high homology for rat gene sequences coding for proteins involved in different cellular processes. The expression of the selected transcripts was also tested in rats which had freely explored the experimental apparatus (exploration and in rats to which the same number of aversive shocks had been administered in the same apparatus, but temporally compressed so as to make the association between painful stimuli and the apparatus difficult (shock-only. Some genes resulted differentially expressed only in the rats subjected to CFC, others only in exploration or shock-only rats, whereas the gene coding for translocase of outer mitochondrial membrane 20 protein and nardilysin were differentially expressed in both CFC and exploration rats. For example, the expression of stathmin 1 whose transcripts resulted up regulated was also tested to evaluate the transduction and protein localization after conditioning.

  5. Accelerated line-by-line calculations for the radiative transfer of trace gases related to climate studies

    International Nuclear Information System (INIS)

    In the present study we are studying the effects of including carbon dioxide, ozone, methane, and the halocarbons in addition to water vapor in the radiating atmosphere. The study has focused on two principal issues: the effect on the spectral fluxes and cooling rates of carbon dioxide, ozone and the halocarbons at 1990 concentration levels and the change in fluxes and cooling rates as a consequence of the anticipated ten year change in the profiles of these species. For the latter study the water vapor profiles have been taken as invariant in time. The radiative line-by-line calculations using LBLRTM (Line-By-Line Radiative Transfer Model) have been performed for tropical (TRP), mid-latitude winter (MLW) and mid-latitude summer (MLS) model atmospheres. The halocarbons considered in the present study are CCl4, CFC-11, CFC-12 and CFC-22. In addition to considering the radiative effects of carbon dioxide at 355 ppM, the assumed current level, we have also obtained results for doubled carbon dioxide at 710 ppM. An important focus of the current research effort is the effect of the ozone depletion profile on atmospheric radiative effects

  6. Learned fear, emotional reactivity and fear of heights: a factor analytic map from a large F(2) intercross of Roman rat strains.

    Science.gov (United States)

    Aguilar, Raúl; Gil, Luis; Flint, Jonathan; Gray, Jeffrey A; Dawson, Gerard R; Driscoll, Peter; Giménez-Llort, Lydia; Escorihuela, Rosa M; Fernández-Teruel, Alberto; Tobeña, Adolf

    2002-01-01

    Anxiety-related behaviours were evaluated across various tests in a 800 F(2)-intercross of the Roman high- and low-avoidance inbred rats. These tests either evoke unlearned (open field [OF]; plus-maze [PM]; hole-board [HB]; spontaneous activity [A]; and acoustic startle reflex [ASR]) or learned (classical fear conditioning [CFC]; and shuttlebox avoidance conditioning [SAC]), anxious/fearful responses. Using factor analysis (oblique rotation), we obtained a six-fold solution with 14 variables derived from all tests. These six factors represented SAC, CFC, PM anxiety, PM and OF activity, ASR anxiety, plus a mixed whole of anxious and activity variables (from OF and A), respectively. In searching for a smaller number of meaningful factors, we applied a three-factor solution that coherently corresponded with differentiated facets of fearfulness, rather than with the tests. Results showed that (1) measures of SAC and CFC strongly loaded onto Factor 1, labelled as "Learned Fear"; (2) a blend of almost all variables loaded onto Factor 2, called "Emotional Reactivity"; and (3) open arm behaviour in the PM loaded onto Factor 3, called "Fear of Heights." After discussing limitations of this apparently consistent behavioural map of anxiety, we advance some connections between those factors with quantitative trait loci candidates (genetic markers) as detected in the same sample.

  7. Rhythmic Working Memory Activation in the Human Hippocampus

    Directory of Open Access Journals (Sweden)

    Marcin Leszczyński

    2015-11-01

    Full Text Available Working memory (WM maintenance is assumed to rely on a single sustained process throughout the entire maintenance period. This assumption, although fundamental, has never been tested. We used intracranial electroencephalography (EEG recordings from the human hippocampus in two independent experiments to investigate the neural dynamics underlying WM maintenance. We observed periodic fluctuations between two different oscillatory regimes: Periods of “memory activation” were reflected by load-dependent alpha power reductions and lower levels of cross-frequency coupling (CFC. They occurred interleaved with periods characterized by load-independent high levels of alpha power and CFC. During memory activation periods, a relevant CFC parameter (load-dependent changes of the peak modulated frequency correlated with individual WM capacity. Fluctuations between these two periods predicted successful performance and were locked to the phase of endogenous delta oscillations. These results show that hippocampal maintenance is a dynamic rather than constant process and depends critically on a hierarchy of oscillations.

  8. 混合制冷剂冰箱对比试验研究%EXPERIMENTAL STUDY ON DOMESTIC REFRIGERATORS WITH THE MIXTURE REFRIGERANT

    Institute of Scientific and Technical Information of China (English)

    何茂刚; 李铁辰; 刘志刚

    2004-01-01

    本文对二元混合工质HFC152a/HCFC22、HFC152a/HFC125在冰箱上应用的制冷循环性能进行了详细的理论计算和分析,并且对这两种混合工质灌注式替代CFC12、在最佳配比和充灌量下的冰箱主要制冷性能进行了对比试验研究.试验结果表明:在合适的配比和充灌量下混合工质冰箱制冷性能指标满足国家标准要求,HFC152a/HFC125在最佳充灌量为97 g时,试验冰箱耗电量为1.156 kW·h/24h,比CFC12节能10%,比HFC152a/HCFC22节能0.81%.因此,HFC152a/HFC125比HFC152a/HCFC22更适合于灌注式替代CFC12.

  9. Release and fate of fluorocarbons in a shredder residue landfill cell: 1. Laboratory experiments.

    Science.gov (United States)

    Scheutz, Charlotte; Fredenslund, Anders M; Nedenskov, Jonas; Kjeldsen, Peter

    2010-11-01

    The shredder residues from automobiles, home appliances and other metal-containing products are often disposed in landfills, as recycling technologies for these materials are not common in many countries. Shredder waste contains rigid and soft foams from cushions and insulation panels blown with fluorocarbons. The objective of this study was to use laboratory experiments to estimate fluorocarbon release and attenuation processes in a monofill shredder residue (SR) landfill cell. Waste from the open SR landfill cell at the AV Miljø landfill in Denmark was sampled at three locations. The waste contained 1-3% metal and a relatively low fraction of rigid polyurethane (PUR) foam particles. The PUR waste contained less blowing agent (CFC-11) than predicted from a release model. However, CFC-11 was steadily released in an aerobic bench scale experiment. Anaerobic waste incubation bench tests showed that SRSR produced significant methane (CH(4)), but at rates that were in the low end of the range observed for municipal solid waste. Aerobic and anaerobic batch experiments showed that processes in SRSR potentially can attenuate the fluorocarbons released from the SRSR itself: CFC-11 is degraded under anaerobic conditions with the formation of degradation products, which are being degraded under CH(4) oxidation conditions prevailing in the upper layers of the SR. PMID:20435458

  10. Evidence for terrigenic SF6 in groundwater from basaltic aquifers, Jeju Island, Korea: Implications for groundwater dating

    Science.gov (United States)

    Koh, D.-C.; Plummer, L.N.; Busenberg, E.; Kim, Y.

    2007-01-01

    Measurements of the concentrations of dichlorodifluoromethane (CFC-12), tritium (3H), and sulfur hexafluoride (SF6) in groundwater from basaltic aquifers in Jeju Island, Korea, demonstrate a terrigenic source of SF6. Using a lumped-parameter dispersion model, groundwater was identified as young water (SF6 relative to CFC-12 and 3H concentrations for more than half of the samples. The non-atmospheric excess SF6 may have originated from terrigenic sources in relict volcanic fluids, which could have acquired SF6 from granites and basement rocks of the island during volcanic activity. Local excess anthropogenic sources of SF6 are unlikely. The SF6 age is biased young relative to the CFC-12 age, typically up to 20 years and as high as 30 years. This age bias is more pronounced in samples of groundwater older than 15 years. The presence of terrigenic SF6 can affect the entire dating range for groundwater in mixtures that contain a fraction of old water. ?? 2007 Elsevier B.V. All rights reserved.

  11. Substitutes for potent green house gases. HFCs, PFCs and SF{sub 6}. Status report

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, P.H. [Dansk Teknologisk Institut (Denmark)

    1997-12-31

    CFCs (halogenated chlorofluorocarbons), HCFCs (hydrochlorofluorocarbons), HFCs (hydrofluorocarbons), PFCs (fluorocarbons) and SF{sub 6} (sulphur hexafluoride) are all artificial substances which were not to be found in nature until recently. In 1995 the Danish consumption of HFC substances was approximately 740 tonnes, where the corresponding amount of SF{sub 6} was about 17 tonnes. If the entire amount of these substances was released to to the atmosphere, the resulting impact would correspond to an increased emission of greenhouse gases, corresponding to approximately 1.5 million tonnes of CO{sub 2}. HFC substances would account for 73%, SF{sub 6} with 25% and PFC for 1%. This corresponds to approximately 2.6% of the Danish CO{sub 2} emission (nearly 60 million tonnes per year). This corresponds to about half of the aimed 6% reduction of CO{sub 2} emission attained by introduction of mandatory green taxes on CO{sub 2}. According to experience from the CFC programme it is possible to recover some CFC and send it to controlled destruction. From 1993 to 1996 the refrigeration industry, for instance, has returned a total amount of 163 tonnes of CFC refrigerant through the KMO organization (Koelebranchens Miljoe Ordning). Most of this has been destroyed and a small amount has been purified and recycled afterwards. Similarly, it is likely to believe that some HFC refrigerant will be returned through the KMO organization. (au) 11 refs., also published in Danish

  12. Impact of cryopreservation on tetramer, cytokine flow cytometry, and ELISPOT

    Directory of Open Access Journals (Sweden)

    Morse Michael A

    2005-07-01

    Full Text Available Abstract Background Cryopreservation of PBMC and/or overnight shipping of samples are required for many clinical trials, despite their potentially adverse effects upon immune monitoring assays such as MHC-peptide tetramer staining, cytokine flow cytometry (CFC, and ELISPOT. In this study, we compared the performance of these assays on leukapheresed PBMC shipped overnight in medium versus cryopreserved PBMC from matched donors. Results Using CMV pp65 peptide pool stimulation or pp65 HLA-A2 tetramer staining, there was significant correlation between shipped and cryopreserved samples for each assay (p ≤ 0.001. The differences in response magnitude between cryopreserved and shipped PBMC specimens were not significant for most antigens and assays. There was significant correlation between CFC and ELISPOT assay using pp65 peptide pool stimulation, in both shipped and cryopreserved samples (p ≤ 0.001. Strong correlation was observed between CFC (using HLA-A2-restricted pp65 peptide stimulation and tetramer staining (p Conclusion We conclude that all three assays show concordant results on shipped versus cryopreserved specimens, when using a peptide-based readout. The assays are also concordant with each other in pair wise comparisons using equivalent antigen systems.

  13. Adherence to prophylaxis and bleeding outcome in haemophilia: a multicentre study.

    Science.gov (United States)

    Schrijvers, LieSbeth H; Beijlevelt-van der Zande, Marlene; Peters, Marjolein; Lock, Janske; Cnossen, Marjon H; Schuurmans, Marieke J; Fischer, Kathelijn

    2016-08-01

    Prevention of bleeding and joint damage in severe haemophilia is dependent on adherence to prophylactic replacement therapy. The aim of this study was to assess adherence to prophylaxis, including associations with age, bleeding and clotting factor consumption (CFC). In three Dutch haemophilia centres, semi-structured interviews about adherence to prophylaxis in the previous 2 weeks were conducted with patients or parents of a child with haemophilia. Patients were classified, according to pre-specified definitions, as adherent, sub-optimally adherent or non-adherent based on missing, timing, and dose of infusions. Association of annual bleeding rates, mean CFC, person performing the infusion (parents verus patients) with adherence categories were analysed. Overall, 241 patients with haemophilia using prophylaxis were studied. Parents were more adherent (66%; n = 48/73) than patients (43%; n = 72/168). Sub-optimal adherence occurred in 29% of parents and 37% of patients and was characterized by changes in timing of infusion (mostly from morning to evening), while missing parents and 20% of patients. Reduced adherence was associated with lower CFC, but not with joint bleeding. In conclusion, non-adherence in haemophilia was relatively rare, yet 1/3 of patients struggled to administer prophylaxis at the appropriate time of day. PMID:27098446

  14. Functional Class in Children with Idiopathic Dilated Cardiomyopathy. A pilot Study

    Science.gov (United States)

    Tavares, Aline Cristina; Bocchi, Edimar Alcides; Guimarães, Guilherme Veiga

    2016-01-01

    Background Idiopathic dilated cardiomyopathy (IDCM), most common cardiac cause of pediatric deaths, mortality descriptor: a low left ventricular ejection fraction (LVEF) and low functional capacity (FC). FC is never self reported by children. Objective The aims of this study were (i) To evaluate whether functional classifications according to the children, parents and medical staff were associated. (iv) To evaluate whether there was correlation between VO2 max and Weber's classification. Method Prepubertal children with IDCM and HF (by previous IDCM and preserved LVEF) were selected, evaluated and compared. All children were assessed by testing, CPET and functional class classification. Results Chi-square test showed association between a CFm and CFp (1, n = 31) = 20.6; p = 0.002. There was no significant association between CFp and CFc (1, n = 31) = 6.7; p = 0.4. CFm and CFc were not associated as well (1, n = 31) = 1.7; p = 0.8. Weber's classification was associated to CFm (1, n = 19) = 11.8; p = 0.003, to CFp (1, n = 19) = 20.4; p = 0.0001and CFc (1, n = 19) = 6.4; p = 0.04). Conclusion Drawing were helpful for children's self NYHA classification, which were associated to Weber's stratification. PMID:27168472

  15. Oscillatory dynamics track motor performance improvement in human cortex.

    Directory of Open Access Journals (Sweden)

    Stefan Dürschmid

    Full Text Available Improving performance in motor skill acquisition is proposed to be supported by tuning of neural networks. To address this issue we investigated changes of phase-amplitude cross-frequency coupling (paCFC in neuronal networks during motor performance improvement. We recorded intracranially from subdural electrodes (electrocorticogram; ECoG from 6 patients who learned 3 distinct motor tasks requiring coordination of finger movements with an external cue (serial response task, auditory motor coordination task, go/no-go. Performance improved in all subjects and all tasks during the first block and plateaued in subsequent blocks. Performance improvement was paralled by increasing neural changes in the trial-to-trial paCFC between theta ([Formula: see text]; 4-8 Hz phase and high gamma (HG; 80-180 Hz amplitude. Electrodes showing this covariation pattern (Pearson's r ranging up to .45 were located contralateral to the limb performing the task and were observed predominantly in motor brain regions. We observed stable paCFC when task performance asymptoted. Our results indicate that motor performance improvement is accompanied by adjustments in the dynamics and topology of neuronal network interactions in the [Formula: see text] and HG range. The location of the involved electrodes suggests that oscillatory dynamics in motor cortices support performance improvement with practice.

  16. Oscillatory dynamics track motor performance improvement in human cortex.

    Science.gov (United States)

    Dürschmid, Stefan; Quandt, Fanny; Krämer, Ulrike M; Hinrichs, Hermann; Heinze, Hans-Jochen; Schulz, Reinhard; Pannek, Heinz; Chang, Edward F; Knight, Robert T

    2014-01-01

    Improving performance in motor skill acquisition is proposed to be supported by tuning of neural networks. To address this issue we investigated changes of phase-amplitude cross-frequency coupling (paCFC) in neuronal networks during motor performance improvement. We recorded intracranially from subdural electrodes (electrocorticogram; ECoG) from 6 patients who learned 3 distinct motor tasks requiring coordination of finger movements with an external cue (serial response task, auditory motor coordination task, go/no-go). Performance improved in all subjects and all tasks during the first block and plateaued in subsequent blocks. Performance improvement was paralled by increasing neural changes in the trial-to-trial paCFC between theta ([Formula: see text]; 4-8 Hz) phase and high gamma (HG; 80-180 Hz) amplitude. Electrodes showing this covariation pattern (Pearson's r ranging up to .45) were located contralateral to the limb performing the task and were observed predominantly in motor brain regions. We observed stable paCFC when task performance asymptoted. Our results indicate that motor performance improvement is accompanied by adjustments in the dynamics and topology of neuronal network interactions in the [Formula: see text] and HG range. The location of the involved electrodes suggests that oscillatory dynamics in motor cortices support performance improvement with practice. PMID:24586885

  17. Experimental verification of FOREV-2D simulations for the plasma shield

    International Nuclear Information System (INIS)

    Analysis of experiments in the MK-200UG facility dedicated to verify the FOREV-2D simulations of ITER core contamination with carbon vaporized during ELMs has been performed. In these experiments the carbon fibre composite (CFC) of NB31 grade have been treated with plasma heat fluxes relevant for ITER ELMs. The analysis revealed that thin layer of few hundred microns on CFC surface is damaged and its thermoconductivity effectively reduced approximately three times, but the CFC bulk has the reference thermoconductivity. Good agreement between the measured and the calculated profiles for carbon plasma electron density at various hydrogen plasma heat loads as well as the agreement between the measured and the simulated dependences of the absorbed energy density on the applied heat load provide reliable validation of the carbon plasma shields simulated with the FOREV-2D code. High carbon plasma shield densities of 1023-1024 m-3 predicted in the simulations for ELM-produced shields has been proved in these MK-200UG experiments.

  18. Recurrent fuzzy neural network by using feedback error learning approaches for LFC in interconnected power system

    International Nuclear Information System (INIS)

    In this study, a new adaptive controller based on modified feedback error learning (FEL) approaches is proposed for load frequency control (LFC) problem. The FEL strategy consists of intelligent and conventional controllers in feedforward and feedback paths, respectively. In this strategy, a conventional feedback controller (CFC), i.e. proportional, integral and derivative (PID) controller, is essential to guarantee global asymptotic stability of the overall system; and an intelligent feedforward controller (INFC) is adopted to learn the inverse of the controlled system. Therefore, when the INFC learns the inverse of controlled system, the tracking of reference signal is done properly. Generally, the CFC is designed at nominal operating conditions of the system and, therefore, fails to provide the best control performance as well as global stability over a wide range of changes in the operating conditions of the system. So, in this study a supervised controller (SC), a lookup table based controller, is addressed for tuning of the CFC. During abrupt changes of the power system parameters, the SC adjusts the PID parameters according to these operating conditions. Moreover, for improving the performance of overall system, a recurrent fuzzy neural network (RFNN) is adopted in INFC instead of the conventional neural network, which was used in past studies. The proposed FEL controller has been compared with the conventional feedback error learning controller (CFEL) and the PID controller through some performance indices

  19. Estimated historic emissions of fluorocarbons from the European Union

    Science.gov (United States)

    McCulloch, A.; Midgley, P. M.

    Emissions of chlorofluorocarbons (CFCs), hydrochlorofluorocarbons (HCFCs) and one hydrofluorocarbon (HFC-134a) from Europe have been estimated for the years 1986-1996 with a precision in most cases better than ±20%. During that period, sales of CFCs have reduced to virtually zero but they are still being emitted from the "bank" in use in equipment. These emissions are calculated to have fallen dramatically; however the largest releases are still of CFC-11, at 44,000 tonnes in 1996. Significant contributions to the total emission of ozone depleting substances from the European Union during 1996 were also made by HCFC-22 (35,000 tonnes) and CFC-12 (9000 tonnes); releases of other CFCs and HCFCs into the atmosphere from the EU are markedly less. On the other hand, emissions of HFC-134a (which is not an ozone depleting substance) would appear to be growing rapidly and could have reached 12,000 tonnes yr -1 in 1996. HFC-134a is a replacement for CFC-12, releases of which are calculated to have declined much more than the growth in HFC-134a. This leads to the conclusion that substitution of one by the other has been much less than 100% and is actually smaller than had been projected by market research in the early 1990s.

  20. [Cystic Fibrosis Cloud database: An information system for storage and management of clinical and microbiological data of cystic fibrosis patients].

    Science.gov (United States)

    Prieto, Claudia I; Palau, María J; Martina, Pablo; Achiary, Carlos; Achiary, Andrés; Bettiol, Marisa; Montanaro, Patricia; Cazzola, María L; Leguizamón, Mariana; Massillo, Cintia; Figoli, Cecilia; Valeiras, Brenda; Perez, Silvia; Rentería, Fernando; Diez, Graciela; Yantorno, Osvaldo M; Bosch, Alejandra

    2016-01-01

    The epidemiological and clinical management of cystic fibrosis (CF) patients suffering from acute pulmonary exacerbations or chronic lung infections demands continuous updating of medical and microbiological processes associated with the constant evolution of pathogens during host colonization. In order to monitor the dynamics of these processes, it is essential to have expert systems capable of storing and subsequently extracting the information generated from different studies of the patients and microorganisms isolated from them. In this work we have designed and developed an on-line database based on an information system that allows to store, manage and visualize data from clinical studies and microbiological analysis of bacteria obtained from the respiratory tract of patients suffering from cystic fibrosis. The information system, named Cystic Fibrosis Cloud database is available on the http://servoy.infocomsa.com/cfc_database site and is composed of a main database and a web-based interface, which uses Servoy's product architecture based on Java technology. Although the CFC database system can be implemented as a local program for private use in CF centers, it can also be used, updated and shared by different users who can access the stored information in a systematic, practical and safe manner. The implementation of the CFC database could have a significant impact on the monitoring of respiratory infections, the prevention of exacerbations, the detection of emerging organisms, and the adequacy of control strategies for lung infections in CF patients.

  1. Recurrent fuzzy neural network by using feedback error learning approaches for LFC in interconnected power system

    Energy Technology Data Exchange (ETDEWEB)

    Sabahi, Kamel; Teshnehlab, Mohammad; Shoorhedeli, Mahdi Aliyari [Department of Electrical Engineering, K.N. Toosi University of Technology, Intelligent System Lab, Tehran (Iran)

    2009-04-15

    In this study, a new adaptive controller based on modified feedback error learning (FEL) approaches is proposed for load frequency control (LFC) problem. The FEL strategy consists of intelligent and conventional controllers in feedforward and feedback paths, respectively. In this strategy, a conventional feedback controller (CFC), i.e. proportional, integral and derivative (PID) controller, is essential to guarantee global asymptotic stability of the overall system; and an intelligent feedforward controller (INFC) is adopted to learn the inverse of the controlled system. Therefore, when the INFC learns the inverse of controlled system, the tracking of reference signal is done properly. Generally, the CFC is designed at nominal operating conditions of the system and, therefore, fails to provide the best control performance as well as global stability over a wide range of changes in the operating conditions of the system. So, in this study a supervised controller (SC), a lookup table based controller, is addressed for tuning of the CFC. During abrupt changes of the power system parameters, the SC adjusts the PID parameters according to these operating conditions. Moreover, for improving the performance of overall system, a recurrent fuzzy neural network (RFNN) is adopted in INFC instead of the conventional neural network, which was used in past studies. The proposed FEL controller has been compared with the conventional feedback error learning controller (CFEL) and the PID controller through some performance indices. (author)

  2. Clinical-scale cultures of cord blood CD34(+) cells to amplify committed progenitors and maintain stem cell activity.

    Science.gov (United States)

    Ivanovic, Zoran; Duchez, Pascale; Chevaleyre, Jean; Vlaski, Marija; Lafarge, Xavier; Dazey, Bernard; Robert-Richard, Elodie; Mazurier, Frédéric; Boiron, Jean-Michel

    2011-01-01

    We developed a clinical-scale cord blood (CB) cell ex vivo procedure to enable an extensive expansion of committed progenitors--colony-forming cells (CFCs) without impairing very primitive hematopoietic stem cells (HSCs). CD34(++) cells, selected from previously cryopreserved and thawed CB units, were cultured in two steps (diluted 1:4 after 6 days) in the presence of stem cell factor (SCF), fms-related tyrosine kinase 3 ligand (Flt-3L), megakaryocyte growth and development factor (MGDF) (100 ng/ml each), granulocyte-colony stimulating factor (G-CSF) (10 ng/ml) in HP01 serum-free medium. HSC activity was evaluated in a serial transplantation assay, by detection of human cells (CD45, CD33, CD19 and CFC of human origin) in bone marrow (BM) of primary and secondary recipient NOD/SCID mice 6-8 weeks after transplantation. A wide amplification of total cells (∼350-fold), CD34(+) cells (∼100-fold), and CFC (∼130-fold) without impairing the HSC activity was obtained. The activity of a particular HSC subpopulation (SRC(CFC)) was even enhanced.Thus, an extensive ex vivo expansion of CFCs is feasible without impairing the activity of HSCs. This result was enabled by associating antioxidant power of medium with an appropriate cytokine cocktail (i.e., mimicking physiologic effects of a weak oxygenation in hematopoietic environment).

  3. Hierarchical Ni0.54Co0.46O2 nanowire and nanosheet arrays grown on carbon fiber cloth for high-performance supercapacitors

    Science.gov (United States)

    Jiang, Yuanzhi; Zhang, Lijuan; Zhang, Hang; Zhang, Cui; Liu, Shuangxi

    2016-10-01

    Hierarchical Ni0.54Co0.46O2 architectures composed by nanowires or nanosheets were successfully grown on bio-mass carbon fiber cloth (CFC) by hydrothermal method. The morphology of Ni0.54Co0.46O2 can be effectively controlled by using different precipitators. The structural effects of the two kinds of morphologies were researched. the results suggest that the Ni0.54Co0.46O2 nanosheet arrays grown on CFC (NCO-NSs/CFC) shows a higher Faradaic areal capacity of 438 μAh cm-2 (238.1 mAh g-1) at a current density of 1 mA cm-2 and still about 90.3% initial capacity retention even at the high current density of 50 mA cm-2. Moreover, an all-solid-state flexible symmetric supercapacitor device has been successfully assembled. The optimized device delivers superior electrochemical performance with an outstanding energy density of 92.4 Wh kg-1 at a power density of 207.2 W kg-1. Such hierarchical nanostructure composed by well-aligned uniform Ni0.54Co0.46O2 nanosheet arrays grown on bio-mass carbon fiber cloth might hold great promise as battery-type electrode material for high-performance supercapacitor.

  4. Precision Cleaning Verification of Nonvolatile Residues by Using Water, Ultrasonics, and Turbidity Analyses

    Science.gov (United States)

    Skinner, S. Ballou

    1991-01-01

    Chlorofluorocarbons (CFC's) in the atmosphere are believed to present a major environmental problem because they are able to interact with and deplete the ozone layer. NASA has been mandated to replace chlorinated solvents in precision cleaning, cleanliness verification, and degreasing of aerospace fluid systems hardware and ground support equipment. KSC has a CFC phase-out plan which provides for the elimination of over 90 percent of the CFC and halon use by 1995. The Materials Science Laboratory and KSC is evaluating four analytical methods for the determination of nonvolatile residues removal by water: (1) infrared analyses using an attenuated total reflectance; (2) surface tension analyses, (3) total organic content analyses, and (4) turbidity analyses. This research project examined the ultrasonic-turbidity responses for 22 hydrocarbons in an effect to determine: (1) if ultrasonics in heated water (70 C) will clean hydrocarbons (oils, greases, gels, and fluids) from aerospace hardware; (2) if the cleaning process by ultrasonics will simultaneously emulsify the removed hydrocarbons in the water; and (3) if a turbidimeter can be used successfully as an analytical instrument for quantifying the removal of hydrocarbons. Sixteen of the 22 hydrocarbons tested showed that ultrasonics would remove it at least 90 percent of the contaminated hydrocarbon from the hardware in 10 minutes or less giving a good ultrasonic-turbidity response. Six hydrocarbons had a lower percentage removal, a slower removal rate, and a marginal ultrasonic-turbidity response.

  5. Mothers’ Participation and Compliance toward the Improvement of the Infants’ Nutritional in Community Feeding Center Lagarutu Palu

    Directory of Open Access Journals (Sweden)

    Nurdin Rahman

    2016-06-01

    Full Text Available Nutrition is one of the indicators in building the qualified human resources. Nationally, the prevalence of malnutrition is 19,6%. This shows that the problem of malnutrition in Indonesia is still a public health problem. In Palu Province, malnutrition is also a health problem that continues to be handled. Community Feeding Center is a program of the government in tackling the cases of malnutrition through the supplementary feeding and education in the mothers. This study was aimed to determine the relationship between the mothers’ participation and compliance in giving supplementary feeding with improved nutritional status of infants in CFC Lagarutu. The type of this research is in the form of analytic survey with cross sectional approach with 31 samples taken by purposive sampling technique. The data were analyzed using Chi-square test with α 5%. The research was conducted in April-June 2015. The results show that no relationship between the participation (p=0,001 and the improvement of the infants’ nutritional status, where the more active of the mothers in the CFC program, the more improvement of the infants’ nutritional status. There is a relationship between the compliance and the improved nutritional status (p=0,000, where the more obedient of the mothers in giving supplementary feeding, the more improvement of the infants’ nutritional status. It is recommended to the mothers to always be active in the CFC program and dutifully provide supplementary food to their children in order to improve the nutritional status of infants.

  6. On the age of stratospheric air and ozone depletion potentials in polar regions

    Science.gov (United States)

    Pollock, W. H.; Heidt, L. E.; Lueb, R. A.; Vedder, J. F.; Mills, M. J.; Solomon, S.

    1992-01-01

    Observations of the nearly inert, man-made chlorofluorocarbon CFC-115 obtained during January 1989 are used to infer the age of air in the lower stratosphere. These observations together with estimated release rates suggest an average age of high-latitude air at pressure altitudes near 17-21 km of about 3 to 5 yr. This information is used together with direct measurements of HCFC-22, HCFC-142b, CH3Br, H-1301, H-1211, and H-2402 to examine the fractional dissociation of these species within the Arctic polar lower stratosphere compared to that of CFC-11 and hence to estimate their local ozone depletion potentials in this region. It is shown that these HCFCs are much less efficiently dissociated within the stratosphere than CFC-11, lowering their ozone depletion potentials to only about 30-40 percent of their chlorine loading potentials. In contrast, the observations of CH3Br and the Halons considered confirm that they are rapidly dissociated within the stratosphere, with important implications for their ozone depletion potentials.

  7. Splenic T helper cell type 1 cytokine profile and extramedullary haematopoiesis in severe combined immunodeficient (scid) mice with inflammatory bowel disease (IBD)

    DEFF Research Database (Denmark)

    Bregenholt, S; Claesson, Mogens Helweg

    1998-01-01

    in splenic G/M-CFC compared with control mice. No significant difference in the number of G/M-CFC per total spleen was found between non-transplanted and disease scid mice, although both groups of mice showed a nearly two-fold increase compared with control mice. G/M-CFC were never found in the thymus, liver......Scid mice develop a severe, chronic, and lethal IBD 3-6 months after engraftment of gut wall from immunocompetent congenic donors, induced by donor-derived CD4+ T cells migrating from the graft. We have investigated intracellular T-helper type 1 (Th1) cytokines in the spleens of gut wall-transplanted...... scid mice with IBD. Increased fractions of interferon-gamma (IFN-gamma), tumour necrosis factor-alpha (TNF-alpha) and IL-2-positive CD4+ T cells were found in the spleens of diseased mice compared with control mice. Moreover, a small but significant population of CD4+ T cells which stained positive...

  8. A manual for a Laboratory Information Management System (LIMS) for light stable isotopes

    Science.gov (United States)

    Coplen, Tyler B.

    1998-01-01

    The reliability and accuracy of isotopic data can be improved by utilizing database software to (i) store information about samples, (ii) store the results of mass spectrometric isotope-ratio analyses of samples, (iii) calculate analytical results using standardized algorithms stored in a database, (iv) normalize stable isotopic data to international scales using isotopic reference materials, and (v) generate multi-sheet paper templates for convenient sample loading of automated mass-spectrometer sample preparation manifolds. Such a database program is presented herein. Major benefits of this system include (i) an increase in laboratory efficiency, (ii) reduction in the use of paper, (iii) reduction in workload due to the elimination or reduction of retyping of data by laboratory personnel, and (iv) decreased errors in data reported to sample submitters. Such a database provides a complete record of when and how often laboratory reference materials have been analyzed and provides a record of what correction factors have been used through time. It provides an audit trail for stable isotope laboratories. Since the original publication of the manual for LIMS for Light Stable Isotopes, the isotopes 3 H, 3 He, and 14 C, and the chlorofluorocarbons (CFCs), CFC-11, CFC-12, and CFC-113, have been added to this program.

  9. Modulation of Gene Expression in Contextual Fear Conditioning in the Rat

    Science.gov (United States)

    Macchi, Monica; Ciampini, Cristina; Bernardi, Rodolfo; Baldi, Elisabetta; Bucherelli, Corrado; Brunelli, Marcello; Scuri, Rossana

    2013-01-01

    In contextual fear conditioning (CFC) a single training leads to long-term memory of context-aversive electrical foot-shocks association. Mid-temporal regions of the brain of trained and naive rats were obtained 2 days after conditioning and screened by two-directional suppression subtractive hybridization. A pool of differentially expressed genes was identified and some of them were randomly selected and confirmed with qRT-PCR assay. These transcripts showed high homology for rat gene sequences coding for proteins involved in different cellular processes. The expression of the selected transcripts was also tested in rats which had freely explored the experimental apparatus (exploration) and in rats to which the same number of aversive shocks had been administered in the same apparatus, but temporally compressed so as to make the association between painful stimuli and the apparatus difficult (shock-only). Some genes resulted differentially expressed only in the rats subjected to CFC, others only in exploration or shock-only rats, whereas the gene coding for translocase of outer mitochondrial membrane 20 protein and nardilysin were differentially expressed in both CFC and exploration rats. For example, the expression of stathmin 1 whose transcripts resulted up regulated was also tested to evaluate the transduction and protein localization after conditioning. PMID:24278235

  10. Design and Optimization of a Composite Canard Control Surface of an Advanced Fighter Aircraft under Static Loading

    Directory of Open Access Journals (Sweden)

    Shrivastava Sachin

    2015-01-01

    Full Text Available The minimization of weight and maximization of payload is an ever challenging design procedure for air vehicles. The present study has been carried out with an objective to redesign control surface of an advanced all-metallic fighter aircraft. In this study, the structure made up of high strength aluminum, titanium and ferrous alloys has been attempted to replace by carbon fiber composite (CFC skin, ribs and stiffeners. This study presents an approach towards development of a methodology for optimization of first-ply failure index (FI in unidirectional fibrous laminates using Genetic-Algorithms (GA under quasi-static loading. The GAs, by the application of its operators like reproduction, cross-over, mutation and elitist strategy, optimize the ply-orientations in laminates so as to have minimum FI of Tsai-Wu first-ply failure criterion. The GA optimization procedure has been implemented in MATLAB and interfaced with commercial software ABAQUS using python scripting. FI calculations have been carried out in ABAQUS with user material subroutine (UMAT. The GA's application gave reasonably well-optimized ply-orientations combination at a faster convergence rate. However, the final optimized sequence of ply-orientations is obtained by tweaking the sequences given by GA's based on industrial practices and experience, whenever needed. The present study of conversion of an all metallic structure to partial CFC structure has led to 12% of weight reduction. Therefore, the approach proposed here motivates designer to use CFC with a confidence.

  11. [Cystic Fibrosis Cloud database: An information system for storage and management of clinical and microbiological data of cystic fibrosis patients].

    Science.gov (United States)

    Prieto, Claudia I; Palau, María J; Martina, Pablo; Achiary, Carlos; Achiary, Andrés; Bettiol, Marisa; Montanaro, Patricia; Cazzola, María L; Leguizamón, Mariana; Massillo, Cintia; Figoli, Cecilia; Valeiras, Brenda; Perez, Silvia; Rentería, Fernando; Diez, Graciela; Yantorno, Osvaldo M; Bosch, Alejandra

    2016-01-01

    The epidemiological and clinical management of cystic fibrosis (CF) patients suffering from acute pulmonary exacerbations or chronic lung infections demands continuous updating of medical and microbiological processes associated with the constant evolution of pathogens during host colonization. In order to monitor the dynamics of these processes, it is essential to have expert systems capable of storing and subsequently extracting the information generated from different studies of the patients and microorganisms isolated from them. In this work we have designed and developed an on-line database based on an information system that allows to store, manage and visualize data from clinical studies and microbiological analysis of bacteria obtained from the respiratory tract of patients suffering from cystic fibrosis. The information system, named Cystic Fibrosis Cloud database is available on the http://servoy.infocomsa.com/cfc_database site and is composed of a main database and a web-based interface, which uses Servoy's product architecture based on Java technology. Although the CFC database system can be implemented as a local program for private use in CF centers, it can also be used, updated and shared by different users who can access the stored information in a systematic, practical and safe manner. The implementation of the CFC database could have a significant impact on the monitoring of respiratory infections, the prevention of exacerbations, the detection of emerging organisms, and the adequacy of control strategies for lung infections in CF patients. PMID:26895996

  12. Determination of interlaminar shear strength of carbon fibre-reinforced carbons applying the compression-shear test in the temperature range from room temparature up to 2000 C; Die Ermittlung der interlaminaren Scherfestigkeit von Kohlenstoffaser-verstaerkten Kohlenstoffen mit dem Druck-Scherversuch im Temperaturbereich zwischen Raumtemperatur und 2000 C

    Energy Technology Data Exchange (ETDEWEB)

    Thielicke, B.

    1997-07-01

    There are several testing methods that can be selected to determine the interlaminar shear strength, but the results obtained may differ considerably in terms of strength data or failure modes derived. The work reported here therefore was to apply the established testing methods to determination of the interlaminar shear strength of CFC, and to verify and evaluate their results by means of stress analyses and the observed failure modes. On this basis, a novel testing method was to be developed and, if suitable, modified and optimized particularly for laminated CFCs. One major criterion was applicability of the novel testing method over the entire range of hitherto known service temperatures, i.e. up to at least 2000 C. (orig./CB) [Deutsch] Zur Ermittlung der ILSF (Interlaminare Scherfestigkeit) existieren verschiedene Pruefmethoden, deren Anwendung zum Teil zu sehr unterschiedlichen Versagensmustern und Festigkeitswerten fuehrt. Erstes Ziel der vorgelegten Arbeit war es deshalb, die etablierten Methoden zur Ermittlung der Interlaminaren Schwerfestigkeit auf CFC anzuwenden und die Aussagekraft der ermittelten Werte mit Hilfe von Spannungsanalysen und anhand der beobachteten Versagensmuster zu ueberpruefen und zu bewerten. Darauf aufbauend sollte zweitens ein fuer laminiertes CFC geeignetes Pruefverfahren ausgewaehlt, gegebenenfalls modifiziert und optimiert oder ein neues Verfahren entwickelt werden. Hierbei sollte die Anwendbarkeit der Pruefmethode im gesamten Bereich der moeglichen Einsatztemperaturen, d.h. bis mindestens 2000 C, ein wesentliches Kriterium sein. (orig./MM)

  13. Effect of Bearing Cleaning on Long Term Bearing Life

    Science.gov (United States)

    Jett, Tim; Thom, R. L.

    1999-01-01

    For many years chlorofluorocarbon (CFC) based solvents, such as CFC-113 and 1,1,1, trichloroethane (TCA), were used as bearing cleaning solvents for space mechanism bearings. The 1995 ban on the production of ozone depleting chemicals (ODC) such as CFCs caused a change requiring the use of ODC-free cleaners for precision bearing cleaning. With this change the question arises; what effect if any do these new cleaners have on long term bearing life? The purpose of this study was to evaluate this effect. A one year test using 60 small electrical motors (two bearings per motor) was conducted in a high vacuum environment (2.0 x 10(exp -6) torr) at a temperature of 90 C. Prior to testing the bearings were cleaned with one of four cleaners. These cleaners included two aqueous based cleaners, a CFC based cleaner and supercritical carbon dioxide. Three space compatible greases were tested. After testing, the mass of each lubricated bearing was measured both pre and post test. Along with mass loss measurements a profilometer trace of each bearing was taken to measure post test wear of the bearings. In addition, the bearings were visually examined and analyzed using an optical microscope.

  14. Airborne gas chromatograph for in situ measurements of long-lived species in the upper troposphere and lower stratosphere

    Science.gov (United States)

    Elkins, J. W.; Fahey, D. W.; Gilligan, J. M.; Dutton, G. S.; Baring, T. J.; Volk, C. M.; Dunn, R. E.; Myers, R. C.; Montzka, S. A.; Wamsley, P. R.; Hayden, A. H.; Butler, J. H.; Thompson, T. M.; Swanson, T. H.; Dlugokencky, E. J.; Novelli, P. C.; Hurst, D. F.; Lobert, J. M.; Ciciora, S. J.; McLaughlin, R. J.; Thompson, T. L.; Winkler, R. H.; Fraser, P. J.; Steele, L. P.; Lucarelli, M. P.

    A new instrument, the Airborne Chromatograph for Atmospheric Trace Species IV (ACATS-IV), for measuring long-lived species in the upper troposphere and lower stratosphere is described. Using an advanced approach to gas chromatography and electron capture detection, the instrument can detect low levels of CFC-11 (CCl3F), CFC-12 (CCl2F2), CFC-113 (CCl2F-CClF2), methyl chloroform (CH3CCl3), carbon tetrachloride (CCl4), nitrous oxide (N2O), sulfur hexafluoride (SF6), Halon-1211 (CBrClF2), hydrogen (H2), and methane (CH4) acquired in ambient samples every 180 or 360 s. The instrument operates fully-automated onboard the NASA ER-2 high-altitude aircraft on flights lasting up to 8 hours or more in duration. Recent measurements include 24 successful flights covering a broad latitude range (70°S-61°N) during the Airborne Southern Hemisphere Ozone Experiment/Measurements for Assessing the Effects of Stratospheric Aircraft (ASHOE/MAESA) campaign in 1994.

  15. Balloonborne in situ gas chromatograph for measurements in the troposphere and stratosphere

    Science.gov (United States)

    Moore, F. L.; Elkins, J. W.; Ray, E. A.; Dutton, G. S.; Dunn, R. E.; Fahey, D. W.; McLaughlin, R. J.; Thompson, T. L.; Romashkin, P. A.; Hurst, D. F.; Wamsley, P. R.

    2003-03-01

    An in situ gas chromatograph (GC) instrument on a balloonborne package is described in detail and data from seven science deployments are presented. This instrument, the Lightweight Airborne Chromatograph Experiment (LACE), operates on the Observations of the Middle Stratosphere (OMS) in situ gondola and has taken data from the upper troposphere to near 32 km with a vertical resolution of better than 300 m. LACE chromatography has been developed to measure halon-1211, the chlorofluorocarbons (CFC-11, CFC-113, CFC-12), nitrous oxide (N2O), and sulfur hexafluoride (SF6) every 70 s and methyl chloroform (CH3CCl3), carbon tetrachloride (CCl4), hydrogen (H2), methane (CH4), and carbon monoxide (CO) every 140 s. In the introduction we present scientific motivation for choosing this suite of molecules and for the use of faster sample rates resulting in unprecedented vertical resolution from an in situ GC. Results from an intercomparison with the Airborne Chromatograph for Atmospheric Trace Species (ACATS-IV) instrument are shown to quantitatively connect this LACE data set to the complementary data set generated on board the NASA ER-2 aircraft.

  16. Evaluation of non-azeotropic mixtures containing HFOs as potential refrigerants in refrigeration and high-temperature heat pump systems

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    With the increasing environmental concern on global warming, hydrofluoro-olefin (HFOs), possessing low GWP, has attracted great attention of many researchers recently. In this study, non-azeotropic mixtures composed of HFOs (HFO-1234yf, HFO-1234ze(z), HFO-1234ze(e) and HFO-1234zf) are developed to substitute for HFC-134a and CFC-114 in air-conditioning and high-temperature heat pump systems, respectively. The cycle performances were evaluated by an improved theoretical cy-cle evaluation methodology. The results showed that all the mixtures proposed herein were favorable refrigerants with excel-lent thermodynamic cycle performances. M1A presented lower discharge temperature and pressure ratio and higher COPc than that of HFC-134a. The volumetric cooling capacity was similar to HFC-134a. It can be served as a good environmentally friendly alternative to replace HFC-134a. M3H delivered similar discharge temperature as CFC-114 did. And the COPh was 3% higher. It exhibits excellent cycle performance in high-temperature heat pump and is a promising refrigerant to substitute for CFC-114. And the gliding temperature differences enable them to exhibit better coefficient of performance by matching the sink/source temperature in practice. Because the toxicity, flammability and other properties are not investigated in detail, ex-tensive toxicity and flammability testing needs to be conducted before they are used in a particular application.

  17. Assessment of human embryos by time-lapse videography: A comparison of quantitative and qualitative measures between two independent laboratories.

    Science.gov (United States)

    Liu, Yanhe; Copeland, Christopher; Stevens, Adam; Feenan, Katie; Chapple, Vincent; Myssonski, Kim; Roberts, Peter; Matson, Phillip

    2015-12-01

    A total of 488 Day 3 human embryos with known implantation data from two independent in vitro fertilization laboratories were included for analysis, with 270 from Fertility North (FN) and 218 from Canberra Fertility Centre (CFC). Implanting embryos grew at different rates between FN and CFC as indicated in hours of the time intervals between pronuclear fading and the 4- (13.9 ± 1.1 vs. 14.9 ± 1.8), 5- (25.7 ± 1.9 vs. 28.4 ± 3.7) and 8-cell stages (29.0 ± 3.2 vs. 32.2 ± 4.6), as well as the durations of 2- (10.8 ± 0.8 vs. 11.6 ± 1.1), 3- (0.4 ± 0.5 vs. 0.9 ± 1.2), and 4-cell stages (11.8 ± 1.4 vs. 13.6 ± 2.9), all pqualitative measures including poor conventional morphology, direct cleavage, reverse cleavage and 0.05) or non-implanting embryos (30.4% vs. 38.3%, p>0.05) between FN and CFC. Furthermore, implanting embryos favored lower proportions of the above biological events compared to the non-implanting ones in both laboratories (both pquantitative timing parameters may have reduced inter-laboratory transferability; qualitative measures are independent of cell division timings, with potentially improved inter-laboratory reproducibility.

  18. REM Sleep-Dependent Bidirectional Regulation of Hippocampal-Based Emotional Memory and LTP.

    Science.gov (United States)

    Ravassard, Pascal; Hamieh, Al Mahdy; Joseph, Mickaël Antoine; Fraize, Nicolas; Libourel, Paul-Antoine; Lebarillier, Léa; Arthaud, Sébastien; Meissirel, Claire; Touret, Monique; Malleret, Gaël; Salin, Paul-Antoine

    2016-04-01

    Prolonged rapid-eye-movement (REM) sleep deprivation has long been used to study the role of REM sleep in learning and memory processes. However, this method potentially induces stress and fatigue that may directly affect cognitive functions. Here, by using a short-term and nonstressful REM sleep deprivation (RSD) method we assessed in rats the bidirectional influence of reduced and increased REM sleep amount on hippocampal-dependent emotional memory and plasticity. Our results indicate that 4 h RSD impaired consolidation of contextual fear conditioning (CFC) and induction of long-term potentiation (LTP), while decreasing density of Egr1/Zif268-expressing neurons in the CA1 region of the dorsal hippocampus. LTP and Egr1 expression were not affected in ventral CA1. Conversely, an increase in REM sleep restores and further facilitates CFC consolidation and LTP induction, and also increases Egr1 expression in dorsal CA1. Moreover, CFC consolidation, Egr1 neuron density, and LTP amplitude in dorsal CA1 show a positive correlation with REM sleep amount. Altogether, these results indicate that mild changes in REM sleep amount bidirectionally affect memory and synaptic plasticity mechanisms occurring in the CA1 area of the dorsal hippocampus.

  19. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Servais

    2008-10-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and -12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10% above 20 km altitude, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences

  20. Isolation of cytotoxic glucoerebrosides and long-chain bases from sea cucumber Cucumaria frondosa using high speed counter-current chromatography.

    Science.gov (United States)

    Xu, Jie; Guo, Shuang; Du, Lei; Wang, Yu-Ming; Sugawara, Tatsuya; Hirata, Takashi; Xue, Chang-Hu

    2013-01-01

    Total glucocerebrosides of the sea cucumber Cucumaria frondosa (CFC) have been isolated from the less polar lipid fraction of the chloroform-methanol extract using high speed counter-current chromatography (HSCCC) with a two-phase solvent system composed of petroleum ether-methanol-water (5:4:1, v/v). Three glucocerebroside molecular species (CFC-1, CFC-2 and CFC-3) were isolated from crude total cerebrosides with repeated column chromatography. The structures of these three glucocerebroside molecular species were determined on the basis of chemical and spectroscopic evidence: fatty acids were mainly saturated (C22:0 and C18:0), monounsaturated (C24:1 and C20:1) and α-hydroxyl fatty acids (C24:1h, C23:0h, C23:1h and C22:0h), the structures of long-chain bases were dihydroxy (d17:1, d18:2 and d18:1) and trihydroxy (t17:0 and t16:0), and the glycosylation was glucose. High purity long-chain bases of sea cucumber Cucumaria frondosa (CF-LCB) were prepared from total lipids by HSCCC with a two-phase solvent system composed of n-hexane-methyl tert butyl ether-methanol-water (1:1:2:1, v/v). Compare with traditional preparative methods, the method of HSCCC is short cycle, high yield and less solvent consumption. The composition analysis of CF-LCB showed that the ratio of d18:2 and d17:1 was approximately 2:1. The four glucocerebrosides and long-chain bases from sea cucumber Cucumaria frondosa were evaluated for activity in vitro assays for the cytotoxic activities against Caco-2 colon cancer cells. The results indicated that both glucocerebrosides and long-chain bases exhibited an inhibitory effect on cell proliferation. Moreover, CFC-3 was most effective in four glucocerebrosides to Caco-2 cell viability. The inhibition effect of CF-LCB was much stronger than glucocerebrosides. PMID:23470440

  1. Global stratospheric chlorine inventories for 2004–2009 from Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS measurements

    Directory of Open Access Journals (Sweden)

    A. T. Brown

    2013-09-01

    Full Text Available We present chlorine budgets calculated between 2004 and 2009 for four latitude bands (70° N–30° N, 30° N–0° N, 0° N–30° S, and 30° S–70° S. The budgets were calculated using ACE-FTS version 3.0 retrievals of the volume mixing ratios (VMRs of 9 chlorine-containing species: CCl4, CFC-12 (CCl2F2, CFC-11 (CCl3F, COCl2, COClF, HCFC-22 (CHF2Cl, CH3Cl, HCl and ClONO2. These data were supplemented with calculated VMRs from the SLIMCAT 3-D chemical transport model (CFC-113, CFC-114, CFC-115, H-1211, H-1301, HCFC-141b, HCFC-142b, ClO and HOCl. The total chlorine profiles are dominated by chlorofluorocarbons (CFCs and halons up to 24 km in the tropics and 19 km in the extra-tropics. In this altitude range CFCs and halons account for 58% of the total chlorine VMR. Above this altitude HCl increasingly dominates the total chlorine profile, reaching a maximum of 95% of total chlorine at 54 km. All total chlorine profiles exhibit a positive slope with altitude, suggesting that the total chlorine VMR is now decreasing with time. This conclusion is supported by the time series of the mean stratospheric total chlorine budgets which show mean decreases in total stratospheric chlorine of 0.38 ± 0.03% per year in the Northern Hemisphere extra-tropics, 0.35 ± 0.07% per year in the Northern Hemisphere tropical stratosphere, 0.54 ± 0.16% per year in the Southern Hemisphere tropics and 0.53 ± 0.12% per year in the Southern Hemisphere extra-tropical stratosphere for 2004–2009. Globally stratospheric chlorine is decreasing by 0.46 ± 0.02% per year. Both global warming potential-weighted chlorine and ozone depletion potential-weighted chlorine are decreasing at all latitudes. These results show that the Montreal Protocol has had a significant effect in reducing emissions of both ozone-depleting substances and greenhouse gases.

  2. Stirring by deep cyclones and the evolution of Denmark strait overflow water observed at line W

    Science.gov (United States)

    Andres, M.; Toole, J. M.; Torres, D. J.; Smethie, W. M.; Joyce, T. M.; Curry, R. G.

    2016-03-01

    Shipboard velocity and water property data from 18 transects across the North Atlantic Deep Western Boundary Current (DWBC) near 40 °N are examined to study the evolution of the Denmark Strait Overflow Water (DSOW) component of the DWBC and mixing between DSOW and the interior. The examined transects along Line W - which stretches from the continental shelf south of New England to Bermuda - were made between 1994 and 2014. The shipboard data comprise measurements at regular stations of velocity from lowered acoustic Doppler current profilers, CTD profiles and trace gas chlorofluorocarbon (CFC) concentrations from bottle samples at discrete depths. Comparison of the Line W velocity sections with concurrent sea surface height maps from satellite altimetry indicates that large cyclones in the deep ocean accompany intermittent quasi-stationary meander troughs in the Gulf Stream path at Line W. A composite of 5 velocity sections along Line W suggests that a typical cyclone reaches swirl speeds of greater than 30 cm s-1 at 3400-m depth and has a radius (distance between the center and the maximum velocity) of 75 km. Tracer data suggest that these cyclones affect not only the deep velocity structure along Line W, but also provide a mechanism for water exchange between the DWBC's DSOW and the interior. Vigorous exchange is corroborated by a mismatch in the CFC-11:CFC-12 and CFC-113:CFC-12 ratio ages calculated for DSOW at Line W. During the most recent 5-year period (2010-2014), a decrease in DSOW density has been driven by warming (increasing by almost 0.1 °C) as salinity has increased only slightly (by 0.003, which is close to the 0.002 uncertainty of the measurements). The abyssal ocean offshore of the DWBC and Gulf Stream and deeper than 3000-m depth has freshened at a rate of 6×10-4 yr-1 since at least 2003. Density here remains nearly unchanged over this period, due to temperature compensation, though a linear cooling trend in the abyssal ocean (to compensate the

  3. An evaluation of total and inhalable samplers for the collection of wood dust in three wood products industries.

    Science.gov (United States)

    Harper, Martin; Muller, Brian S

    2002-10-01

    In 1998 the American Conference for Governmental Industrial Hygienists (ACGIH) proposed size selective sampling for wood dust based on the inhalable fraction. Thus the proposed threshold limit values (TLVs) require the use of a sampler whose performance matches the inhalable convention. The Institute of Occupational Medicine (IOM) sampler has shown good agreement with the inhalable convention under controlled conditions, and the Button sampler, developed by the University of Cincinnati, has shown reasonable agreement in at least one laboratory study. The Button sampler has not been previously evaluated under wood working conditions, and the IOM has been shown to sample more mass than expected when compared to the standard closed-face cassette, which may be due to the collection of very large particles in wood working environments. Some projectile particles may be > 100 microm aerodynamic diameter and thus outside the range of the convention. Such particles, if present, can bias the estimates of concentration considerably. This study is part of an on-going research focus into selecting the most appropriate inhalable sampler for use in these industries, and to examine the impact of TLV changes. This study compared gravimetric analyses (National Institute of Occupational Safety and Health Method 0500) of side-by-side personal samples using the Button, IOM, and 37 mm closed-face cassette (CFC) under field-use conditions. A total of 51 good sample pairs were collected from three wood products industries involved in the manufacturing of cabinets, furniture, and shutters. Paired t-tests were run on each sample pair using Statistical Package for the Social Sciences (SPSS) version 10. The IOM and the CFC measured statistically different concentrations (p woodworking environments, and, taken together, the data imply a conversion factor greater than the 2.5 normally applied to CFC results to approximate inhalable values, as measured by the IOM. Raising the limit values by

  4. Conversion of 5-fluorocytosine to 5-fluorouracil by human intestinal microflora

    International Nuclear Information System (INIS)

    5-Fluorocytosine (FC) is used to treat systemic fungal infections in man. Its clinical effectiveness has been limited by hematologic toxicity which may be secondary to the formation of 5-fluorouracil (FU). It is unclear how FU is formed since human cells lack cytosine deaminase. The present study examined if intestinal microflora (IMF) could convert FC to FU in man. An in vitro semicontinuous culture system was inoculated with human feces and maintained with sterile nutrient suspension. The microbial community was assessed for cell count and anaerobes as well as formation of volatile fatty acids and CH4. The system approximated that believed to occur in vivo. The study was initiated with addition of purified [6-14C]-FC. Unlabelled FC was then added to the system daily for 2 weeks following which [6-14C]-FC was again added. Following each addition of [6-14C]-FC, samples were removed at 2,4,8,24,48,72, and 96 hr. Utilizing HPLC, FC and FU could be separated with quantitation of radioactivity in each peak. Following the initial dose, no detectable FU was observed during the first 8 hr, but after 24 hr increasing levels were detected (9.42 μg FU/ml after 4 days). Following chronic administration of FC, increased levles of FU were noted without an 8 hr lag time in the production of FU (31.86 μg FU/ml after 4 days). In summary, these studies demonstrate that IMF can convert FC to FU possibly accounting for toxicity observed following administration of FC

  5. Syntheses, characterization and electrochemical and spectroscopic properties of ruthenium-iron complexes of 2,3,5,6-tetrakis(2-pyridyl)pyrazine and ferrocene-acetylide ligands.

    Science.gov (United States)

    Wen, Hui-Min; Wang, Jin-Yun; Zhang, Li-Yi; Shi, Lin-Xi; Chen, Zhong-Ning

    2016-06-28

    Heterodimetallic Ru-Fe complexes [(tppz)(PPh3)2RuL](ClO4) (L = C[triple bond, length as m-dash]CFc, [](ClO4); C[triple bond, length as m-dash]C-C6H4-C[triple bond, length as m-dash]CFc), [](ClO4); C[triple bond, length as m-dash]C-C6H4-C6H4-C[triple bond, length as m-dash]CFc, [](ClO4)) were synthesized by the reactions of [(tppz)(PPh3)2RuCl](ClO4) (tppz = 2,3,5,6-tetrakis(2-pyridyl)pyrazine) with ferrocence-acetylide ligands and characterized by ESI-MS, and (1)H and (31)P NMR spectroscopies. The structure of [](PF6) was determined by X-ray crystallography. The electrochemical studies show that compounds [](ClO4)-[](ClO4) possess two widely separated anodic peaks, ascribable to one-electron oxidation of Fc and Ru(II), respectively. This assignment is further corroborated by the results of UV-vis-NIR, XPS, and theoretical calculation studies. Compound [](ClO4) exhibits significant RuFe metal-metal interactions across the Ru-C[triple bond, length as m-dash]C-Fc backbone. As revealed by electrochemical, spectroscopic and theoretical computational studies, one-electron oxidized species [](ClO4)2 is between the electronically delocalized and valence-trapped state and shows a typical Robin-Day class II mixed-valence behavior. PMID:27273611

  6. Nitrate source indicators in ground water of the Scimitar Subdivision, Peters Creek area, Anchorage, Alaska

    Science.gov (United States)

    Wang, Bronwen; Strelakos, Pat M.; Jokela, Brett

    2000-01-01

    A combination of aqueous chemistry, isotopic measurement, and in situ tracers were used to study the possible nitrate sources, the factors contributing to the spatial distribution of nitrate, and possible septic system influence in the ground water in the Scimitar Subdivision, Municipality of Anchorage, Alaska. Two water types were distinguished on the basis of the major ion chemistry: (1) a calcium sodium carbonate water, which was associated with isotopically heavier boron and with chlorofluorocarbons (CFC's) that were in the range expected from equilibration with the atmosphere (group A water) and (2) a calcium magnesium carbonate water, which was associated with elevated nitrate, chloride, and magnesium concentrations, generally isotopically lighter boron, and CFC's concentrations that were generally in excess of that expected from equilibration with the atmosphere (group B water). Water from wells in group B had nitrate concentrations that were greater than 3 milligrams per liter, whereas those in group A had nitrate concentrations of 0.2 milligram per liter or less. Nitrate does not appear to be undergoing extensive transformation in the ground-water system and behaves as a conservative ion. The major ion chemistry trends and the presence of CFC's in excess of an atmospheric source for group B wells are consistent with waste-water influences. The spatial distribution of the nitrate among wells is likely due to the magnitude of this influence on any given well. Using an expanded data set composed of 16 wells sampled only for nitrate concentration, a significant difference in the static water level relative to bedrock was found. Well water samples with less than 1 milligram per liter nitrate had static water levels within the bedrock, whereas those samples with greater than 1 milligram per liter nitrate had static water levels near or above the top of the bedrock. This observation would be consistent with a conceptual model of a low-nitrate fractured bedrock

  7. Encoding of emotion-paired spatial stimuli in the rodent hippocampus

    Directory of Open Access Journals (Sweden)

    Rebecca eNalloor

    2012-06-01

    Full Text Available Rats can acquire the cognitive component of CS-US associations between sensory and aversive stimuli without a functional basolateral amygdala. Thus, other brain regions should support such associations. Some septal/dorsal CA1 (dCA1 neurons respond to both spatial stimuli and footshock, suggesting that dCA1 could be one such region. We report that, in both dorsal and ventral hippocampus, different neuronal ensembles express immediate-early genes when a place is experienced alone vs. when it is associated with foot shock. We assessed changes in the size and overlap of hippocampal neuronal ensembles activated by two behavioral events using a cellular imaging method, Arc/Homer1a catFISH. The control group (A-A experienced the same place twice, while the experimental group (A-CFC received the same training plus two foot shocks during the second event. During fear conditioning, A-CFC, compared to A-A, rats had a smaller ensemble size in dCA3, dCA1 and vCA3, but not vCA1. Additionally, A-CFC rats had a lower overlap score in dCA1 and vCA3. Locomotion did not correlate with ensemble size. Importantly, foot shocks delivered in a training paradigm that prevents establishing shock-context associations, did not induce significant Arc expression, rejecting the possibility that the observed changes in ensemble size and composition simply reflect experiencing a foot shock. Combined with data that Arc is necessary for lasting synaptic plasticity and long-term memory, the data suggests that Arc/H1a+ hippocampal neuronal ensembles encode aspects of fear conditioning beyond space and time. Rats, like humans, may use the hippocampus to create integrated episodic-like memory during fear conditioning.

  8. Precision and linearity targets for validation of an IFNγ ELISPOT, cytokine flow cytometry, and tetramer assay using CMV peptides

    Directory of Open Access Journals (Sweden)

    Lyerly Herbert K

    2008-03-01

    Full Text Available Abstract Background Single-cell assays of immune function are increasingly used to monitor T cell responses in immunotherapy clinical trials. Standardization and validation of such assays are therefore important to interpretation of the clinical trial data. Here we assess the levels of intra-assay, inter-assay, and inter-operator precision, as well as linearity, of CD8+ T cell IFNγ-based ELISPOT and cytokine flow cytometry (CFC, as well as tetramer assays. Results Precision was measured in cryopreserved PBMC with a low, medium, or high response level to a CMV pp65 peptide or peptide mixture. Intra-assay precision was assessed using 6 replicates per assay; inter-assay precision was assessed by performing 8 assays on different days; and inter-operator precision was assessed using 3 different operators working on the same day. Percent CV values ranged from 4% to 133% depending upon the assay and response level. Linearity was measured by diluting PBMC from a high responder into PBMC from a non-responder, and yielded R2 values from 0.85 to 0.99 depending upon the assay and antigen. Conclusion These data provide target values for precision and linearity of single-cell assays for those wishing to validate these assays in their own laboratories. They also allow for comparison of the precision and linearity of ELISPOT, CFC, and tetramer across a range of response levels. There was a trend toward tetramer assays showing the highest precision, followed closely by CFC, and then ELISPOT; while all three assays had similar linearity. These findings are contingent upon the use of optimized protocols for each assay.

  9. Chlorofluorocarbons, Sulfur Hexafluoride, and Dissolved Permanent Gases in Ground Water from Selected Sites In and Near the Idaho National Engineering and Environmental Laboratory, Idaho, 1994 - 1997

    Energy Technology Data Exchange (ETDEWEB)

    Busenberg, E.; Plummer, L.N.; Bartholomay, R.C.; Wayland, J.E.

    1998-08-01

    From July 1994 through May 1997, the U.S. Geological Survey, in cooperations with the Department of Energy, sampled 86 wells completed in the Snake River Plain aquifer at and near the Idaho National Engineering and Environmental Laboratory (INEEL). The wells were sampled for a variety of constituents including one- and two-carbon halocarbons. Concentrations of dichlorodifluoromethane (CFC-12), trichlorofluoromethane (CFC-11), and trichlorotrifluororoethane (CFC-113) were determined. The data will be used to evaluate the ages of ground waters at INEEL. The ages of the ground water will be used to determine recharge rates, residence time, and travel time of water in the Snake River Plain aquifer in and near INEEL. The chromatograms of 139 ground waters are presented showing a large number of halomethanes, haloethanes, and haloethenes present in the ground waters underlying the INEEL. The chromatograms can be used to qualitatively evaluate a large number of contaminants at parts per trillion to parts per billion concentrations. The data can be used to study temporal and spatial distribution of contaminants in the Snake River Plain aquifer. Representative compressed chromatograms for all ground waters sampled in this study are available on two 3.5-inch high density computer disks. The data and the program required to decompress the data can be obtained from the U.S. Geological Survey office at Idaho Falls, Idaho. Sulfur hexafluoride (SF6) concentrations were measured in selected wells to determine the feasibility of using this environmental tracer as an age dating tool of ground water. Concentrations of dissolved nitrogen, argon, carbon dioxide, oxygen, and methane were measured in 79 ground waters. Concentrations of dissolved permanent gases are tabulated and will be used to evaluate the temperature of recharge of ground water in and near the INEEL.

  10. Coupling groundwater residence time and 234U/238U isotopic ratios in a granitic catchment (Vosges, Eastern France)

    Science.gov (United States)

    Viville, Daniel; Aquilina, Luc; Ackerer, Julien; Chatton, Eliot; Labasque, Thierry; Pierret, Marie-Claire; Granet, Mathieu; Perrone, Thierry; Chabaux, François

    2016-04-01

    Weathering processes are active in surface waters but groundwater also represents no neglectable chemical fluxes. As residence-time in groundwater are high, silicate weathering might take place and control Si, Ca and C fluxes. Weathering processes can be deduced from U isotopic ratios but the kinetics of these processes remain relatively poorly constrained. In order to better characterize these processes, we have coupled residence-times deduced from anthropogenic gases (CFC and SF6) analysis and 234U/238U isotopic ratios determination. Samples were collected in the Strengbach catchment (Hydro-geochemical Observatory OHGE, Vosges, eastern France). Two campaigns were carried out in May and August 2015 during two highly contrasted hydro-climatic periods. Both springs and boreholes down to 80 m depth have been sampled. A very clear geochemical distinction is observed between groundwater from surface springs and deeper groundwater from boreholes. Springs show much lower residence-time (few years) and specific chemical composition. Deeper groundwater have residence-time of several decades and different geochemical composition. A clear SF6 production is observed with increasing SF6 concentrations with residence-time. The campaign of May is characterized by highly groundwater levels and spring fluxes. All groundwater show very low residence time, except in the boreholes at depth greater than 40 m. Conversely, during low groundwater-level period in August, the residence times are much higher and CFC concentrations indicate a large mixing process between surface groundwater and deeper levels. The 234U/238U isotopic ratios confirm this vertical zonation in the boreholes, with much higher activity ratios in the deep ground-waters from borehole than in the surface and spring waters; Such high U activity ratios are indicative of long water-rock interactions, which is consistent with the long residence times deducted from the CFC and SF6 data.

  11. European emissions of halogenated greenhouse gases inferred from atmospheric measurements.

    Science.gov (United States)

    Keller, Christoph A; Hill, Matthias; Vollmer, Martin K; Henne, Stephan; Brunner, Dominik; Reimann, Stefan; O'Doherty, Simon; Arduini, Jgor; Maione, Michela; Ferenczi, Zita; Haszpra, Laszlo; Manning, Alistair J; Peter, Thomas

    2012-01-01

    European emissions of nine representative halocarbons (CFC-11, CFC-12, Halon 1211, HCFC-141b, HCFC-142b, HCFC-22, HFC-125, HFC-134a, HFC-152a) are derived for the year 2009 by combining long-term observations in Switzerland, Italy, and Ireland with campaign measurements from Hungary. For the first time, halocarbon emissions over Eastern Europe are assessed by top-down methods, and these results are compared to Western European emissions. The employed inversion method builds on least-squares optimization linking atmospheric observations with calculations from the Lagrangian particle dispersion model FLEXPART. The aggregated halocarbon emissions over the study area are estimated at 125 (106-150) Tg of CO(2) equiv/y, of which the hydrofluorocarbons (HFCs) make up the most important fraction with 41% (31-52%). We find that chlorofluorocarbon (CFC) emissions from banks are still significant and account for 35% (27-43%) of total halocarbon emissions in Europe. The regional differences in per capita emissions are only small for the HFCs, while emissions of CFCs and hydrochlorofluorocarbons (HCFCs) tend to be higher in Western Europe compared to Eastern Europe. In total, the inferred per capita emissions are similar to estimates for China, but 3.5 (2.3-4.5) times lower than for the United States. Our study demonstrates the large benefits of adding a strategically well placed measurement site to the existing European observation network of halocarbons, as it extends the coverage of the inversion domain toward Eastern Europe and helps to better constrain the emissions over Central Europe.

  12. Recovery of hematopoietic colony-forming cells in irradiated mice pretreated with interleukin 1 (IL-1)

    International Nuclear Information System (INIS)

    Data in this report determined the effect of a single injection of recombinant interleukin 1 alpha (rIL-1) prior to irradiation of B6D2F1 mice on the recovery of colony-forming cells (CFC) at early and late times after sublethal and lethal doses of radiation. Injection of rIL-1 promoted an earlier recovery of mature cells in the blood and CFC in the bone marrow and spleen. For example, 8 days after 6.5 Gy irradiation, the number of CFU-E (colony-forming units-erythroid), BFU-E (burst-forming units-erythroid), and GM-CFC (granulocyte-macrophage colony-forming cells) per femur was approximately 1.5-fold higher in rIL-1-injected mice than in saline-injected mice. Also, 5, 9, and 12 days after irradiation, the number of both day 8 and day 12 CFU-S (colony-forming units-spleen) was almost twofold greater in bone marrow from rIL-1-injected mice. The earlier recovery of CFU-S in rIL-1-injected mice was not associated with an increase in the number of CFU-S that survived immediately after irradiation. Also, 7 months after irradiation, the number of CFU-S per femur of both saline- and rIL-1-injected mice was still less than 50% of normal values. Data in this report demonstrate that a single injection of rIL-1 prior to irradiation accelerates early hematopoietic recovery in irradiated mice, but does not prevent expression of radiation-induced frontend damage or long-term damage to hematopoietic tissues

  13. Flow paths and mixing properties of groundwater using hydrogeochemistry and environmental tracers in the southwestern area of Jeju volcanic island

    Science.gov (United States)

    Koh, Dong-Chan; Ha, Kyoochul; Lee, Kwang-Sik; Yoon, Yoon-Yeol; Ko, Kyung-Seok

    2012-04-01

    SummaryGroundwater from springs, test boreholes and domestic wells was investigated to assess the flow system of basaltic aquifers at base-flow conditions in the southwestern part of Jeju Island, South Korea. This study utilized hydrogeochemical parameters and environmental tracers of 18O, 2H, 3H and chlorofluorocarbons (CFCs), which showed that well-connected flow paths exist between coastal springs regardless of flow rates. In contrast, test boreholes near the coastal springs exhibited various flow paths. Nitrate concentrations were much higher than baseline values in mountainous groundwater while those decreased in coastal areas (<50 m asl) despite stronger anthropogenic land uses. Cl- was seemingly contributed from nitrate contamination sources and seawater sources were minimal due to low-permeability layers near sea level. The water-stable isotopes indicated little evaporation and were comparable to the local meteoric water line during the rainy season, which was confirmed by deuterium excess values, demonstrating that effective infiltration primarily occurs during the rainy season. From the effects of altitude on δ18O, the mean recharge altitudes for both mountainous and coastal springs were estimated as 300-400 m, which implies longer flow paths for the coastal springs. The relationship of CFC-12-CFC-113 and that of CFC-12-3H concordantly indicated that the groundwater consists mainly of binary mixtures composed of 15-25-year-old young water and old water with ages greater than 60 years. Lower nitrate levels in the coastal springs were well represented by the mixing models. Recharge altitudes for coastal springs increased up to 700 m, assuming that old water corresponds to high-altitude recharge, using the binary mixing model. Integration of hydrochemical and environmental tracer characteristics revealed that pahoehoe lava flows and hydrovolcanic tuffs play key roles in controlling the groundwater occurrence and quality.

  14. Flunisolide hydrofluoroalkane with integrated spacer for treating asthma: an updated review.

    Science.gov (United States)

    Berger, William E; Tashkin, Donald P

    2015-01-01

    Flunisolide hydrofluoroalkane (HFA) with integrated spacer is the most recent reformulated inhaled corticosteroid (ICS) for asthma available in the United States. It is the only product that combines a corticosteroid extrafine aerosol with a built-in spacer. The potential clinical benefit of the flunisolide HFA formulation and its integrated spacer for treating persistent asthma was assessed through a comprehensive review of the published literature and data from the past 10 years focusing on (1) flunisolide, the molecule, and the impact of the HFA reformulation; (2) updated information on the anti-inflammatory response to flunisolide HFA, particularly in the distal airways; and (3) the usefulness of an integrated spacer. Flunisolide HFA was found effective and safe in clinical studies and comparable with the chlorofluorocarbon (CFC) formulation, but at about one-third the dose of flunisolide CFC, likely reflecting both the device and the particle size of the reformulated product. Compared with the CFC formulation, the extrafine aerosol and smaller particle size of flunisolide HFA substantially increased pulmonary deposition and decreased oropharyngeal deposition. The integrated spacer further enhanced the pulmonary/oropharyngeal deposition ratio. Examination of lung biopsy specimens indicated a favorable anti-inflammatory response to flunisolide HFA in peripheral airways. Pediatric studies showed no significant effects on growth. The data indicate that flunisolide HFA is a safe and effective maintenance therapy for asthma patients. The integrated spacer may provide an added advantage for patients, especially those who may be more likely to experience adverse effects of ICSs, both local and systemic, including children susceptible to adverse effects on growth.

  15. Pumping-induced ebullition: a unified and simplified method for measuring multiple dissolved gases.

    Science.gov (United States)

    Browne, Bryant A

    2004-11-01

    The incorporation of multiple dissolved gas measurements in biogeochemical studies remains a difficult and expensive challenge. Incompatibilities in collection, handling, and storage procedures generally force the application of multiple sampling procedures for multiple gases. This paper introduces the concept and application of pumping-induced ebullition (PIE), a unified approach for routine measurement of multiple dissolved gases in natural waters and establishes a new platform for development of in situ real-time dissolved gas monitoring tools. Ebullition (spontaneous formation of bubbles) is induced by pumping a water sample through a narrow-diametertube (a "restrictor") to decrease hydrostatic pressure (PH) below total dissolved gas pressure (PT). Buoyancy is used to trap bubbles within a collection tower where gas accumulates rapidly (1 mL/min) to support multiple chemical analyses. Providing for field collection of an essentially unlimited and unified volume of gas sample, PIE afforded accurate and precise measurements of major (N2, 02, Ar), trace (CO2, N20, CH4) and ultratrace (CFC11, CFC12, CFC113, SF6) dissolved gases in Wisconsin groundwater, revealing interrelationships between denitrification, apparent recharge age-dates, and historical land use. Compared to conventional approaches, PIE eliminates multiple gas-specific sampling methods, reduces data computations, simplifies laboratory instrumentation, and avoids aqueous production and consumption of biogenic gases during sample storage. A lake depth profile for CO2 demonstrates PIE's flexibility as an in situ real-time platform for dissolved gas measurements. The apparent departures of some gases (SF6, H2, N2O, CO2) from solubility equilibrium behavior warrant further confirmation and theoretical investigation. PMID:15575293

  16. Expansion of CD34+ cells from human umbilical cord blood by FL and/or TPO gene transfected human marrow stromal cell lines

    Institute of Scientific and Technical Information of China (English)

    张毅; 唐佩弦; 金滢; 李秀森; 张双喜; 吴英; 毛宁

    2001-01-01

    To elucidate the effect of gene transfected marrow stromal cell on expansion of human cord blood CD34+ cells, a culture system was established in which FL and TPO genes were transfected into human stromal cell line HFCL. To establish gene transfected stromal cells co-culture system, cord blood CD34+ cells were purified by using a magnetic beads sorting system. The number of all cells and the number of CD34+ cells and CFC (CFU-GM and BFU-E) were counted in different culture systems. The results showed that in all 8 culture systems, SCF+IL-3+HFT manifested the most potent combination, with the number of total nucleated cells increasing by (893.3±52.1)-fold, total progenitor cells (CFC) by (74.5±5.2)-fold and CD34+ cells by 15.7-fold.Maximal expansions of CFC and CD34+ cells were observed at the end of the second week of culture. Within 14 days of culture, (78.1 ± 5.5)-fold and (57.0 ± 19.7)-fold increases in CFU-GM and BFU-E were obtained. Moreover, generation of LTC-IC from amplified CD34+ cells within 28 days was found only in two combinations, I.e. SCF+IL-3+FL+TPO and SCF+IL-3+HFT, and there was no significant difference between these two groups statistically. These results suggest that human umbilical cord blood CD34+ cells can be extensively expanded ex vivo by using gene transfected stromal cells along with cytokines.

  17. Potential therapeutic role of cisplatinum in autologous bone marrow transplantation: in vitro eradication of neuroblastoma cells from bone marrow.

    OpenAIRE

    Bettan-Renaud, L.; De Vathaire, F.; Bénard, J.; Morardet, N.; Pauzie, N.; Bayet, S.; Hartmann, O; Parmentier, C.

    1989-01-01

    Cisplatinum may prove to be a valuable agent for the elimination of diseased cells in the bone marrow of patients with neuroblastoma. In this study, we measured the efficacy of cisplatinum on human neuroblastoma cell lines and on normal human bone marrow progenitors, GM-CFC and CFU-F. Data indicate that the therapeutic index of cisplatinum is high. We set up an experimental model consisting of a mixture of human bone marrow and human neuroblastoma cells in order to confirm these preliminary r...

  18. Influence of Tube‘s Diameter on Boling Heat Transfer Performance in Small Diameter Tubes

    Institute of Scientific and Technical Information of China (English)

    GanChengjun; WangWeicheng; 等

    1998-01-01

    This paper reports the experiments of evaporation study in 6 mm inner copper diameter tubes using HFC-134a,HCFC-22 and CFC-12 as working fluid.The results show that the evaporation heat transfer cofeeicient increasese with the decreasing of inner diameter of tubes,A new concept of nondimensional tube diameter U is proposed in this paper for correction of the influence of the tube diameter on the evaporation heat transfer coefficient.And further,a conveinent empirical correction method is preseted.

  19. 应力腐蚀

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    STRESS CORROSION CRACKING OF 304L STAINLESS STEEL IN SODIUM SULFIDE-CONTAINING CAUSTIC SOLUTIONS,STRESS CORROSION CRACKING OF H.C.P.METALS AND ALLOYS IN IODINE-METHANOL SOLUTIONS,STRESS CORROSION CRACKING (SCC) AND CORROSION FATIGUE CRACKING (CFC) OF A DUPLEX STAINLESS STEEL IN WHITE WATER ENVIRONMENTS,EFFECT OF PROTECTIVE COATINGS ON THE STRESS CORROSION CRACKING OF API 5L-X52 LOW CARBON STEEL IN SOIL AND NS4 SOLUTIONS,CORROSION FATIGUE AND NEAR-NEUTRAL pH STRESS CORROSION CRACKING OF PIPELINE STEEL IN VERY DILUTE CARBONATE/BICARBONATE WITH AND WITHOUT THE PRESENCE OF HYDROGEN SULFIDE USING THE COMPLIANCE TECHNIQUE.

  20. Individual phases of contextual fear conditioning differentially modulate dorsal and ventral hippocampal GluA1-3, GluN1-containing receptor complexes and subunits.

    Science.gov (United States)

    Sase, Sunetra; Sase, Ajinkya; Sialana, Fernando J; Gröger, Marion; Bennett, Keiryn L; Stork, Oliver; Lubec, Gert; Li, Lin

    2015-12-01

    In contextual fear conditioning (CFC), the use of pharmacological and lesion approaches has helped to understand that there are differential roles for the dorsal hippocampus (DH) and the ventral hippocampus (VH) in the acquisition, consolidation and retrieval phases. Concomitant analysis of the DH and the VH in individual phases with respect to α-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptors and N-methyl-D-aspartate receptor subtype N1 (GluN1)-containing complexes (RCC) and subunits has not been reported so far. Herein, CFC was performed in mice that were euthanized at different time points. DH and VH samples were taken for the determination of RCC and subunit levels using BN- and SDS-PAGE, respectively, with subsequent Western blotting. Evaluation of spine densities, morphology, and immunohistochemistry of GluA1 and GluA2 was performed. In the acquisition phase levels of GluA1-RCC and subunits in VH were increased. In the consolidation phase GluA1- and GluA2-RCC levels were increased in DH and VH, while both receptor subunit levels were increased in the VH only. In the retrieval phase GluA1-RCC, subunits thereof and GluA2-RCC were increased in DH and VH, whereas GluA2 subunits were increased in the VH only. GluN1-RCC levels were increased in acquisition and consolidation phase, while subunit levels in the acquisition phase were increased only in the DH. The immunohistochemical studies in the individual phases in subareas of hippocampus supported immunochemical changes of GluA1 and GluA2 RCC's. Dendritic spine densities and the prevalence of thin spines in the acquisition phase of VH and mushroom spines in the retrieval phase of the VH and DH were increased. The findings from the current study suggest different receptor and receptor complex patterns in the individual phases in CFC and in DH and VH. The results propose that different RCCs are formed in the individual phases and that VH and DH may be involved in CFC.

  1. Influence of tube's diameter on boiling heat transfer performance in small diameter tubes

    Science.gov (United States)

    Gan, Chengjun; Wang, Weicheng; Zhang, Lining

    1998-03-01

    This paper reports the experiments of evaporation study in 6 mm inner copper diameter tubes using HFC-134a, HCFC-22 and CFC-12 as working fluid. The results show that the evaporation heat transfer coefficient increases with the decreasing of inner diameter of tubes. A new concept of non-dimensional tube diameter U is proposed in this paper for correction of the influence of the tube diameter on the evaporation heat transfer coefficient. And further, a convenient empirical correction method is presented.

  2. Development of a transcritical two-stage supermarket refrigerator for deep freezing and normal chilling (2); Entwicklung einer transkritischen zweistufigen Supermarktkaelteanlage fuer Tief- und Normalkuehlung (2)

    Energy Technology Data Exchange (ETDEWEB)

    Gebhardt, D.; Kruse, H. [FKW, Hannover (Germany); Schiesaro, P. [Arneg S.p.a., Campo S.Martinoa (Italy)

    2003-10-01

    Investigations (Schiesaro und Kruse 1999; TEWI-3 AFEAS/DOE 1997) showed that centralized supermarket systems with H-CFC refrigerations cannot be a solution for the future unless measures are taken to reduce leakages and gaseous emissions of such fluids. (orig.) [German] Aufgrund einer frueheren Studie (Schiesaro und Kruse 1999) ueber zukuenftige Supermarktsysteme unter Beruecksichtigung der umwelttechnischen Anforderungen, die auf den TEWI-3 AFEAS/DOE Resultaten (1997) basierte, wurde festgestellt, dass zentrale Supermarktsysteme mit H-FKW Kaeltemitteln nicht die Loesung fuer die Zukunft sein koennen, wenn nicht spezielle Massnahmen getroffen werden, um die Leckage zum Zweck der Begrenzung von direkten Treibhausgasemissionen dieser Fluide zu verringern. (orig.)

  3. CONTRIBUTION A L’AMELIORATION DU SYSTEME DE CLIMATISATION DES VOITURES DE VOYAGEURS DE LA SNTF

    OpenAIRE

    YOUCEF, Ahmed

    2011-01-01

    L’accroissement de l’effet de serre et la diminution de la couche d’ozone ont marqué ces dix dernières années, les gaz frigorigènes classiques tels que les CFC (chlorofluorocarbones),HCFC (hydrochlorofluorocarbones) participent respectivement à la destruction de la couche d’ozone et à l’effet de serre. Les secteurs du froid et de la climatisation sont des domaines en pleine expansion non seulement dans les pays industrialisés mais aussi dans les pays en voie de développement. La communa...

  4. Isotope Method for Confined Groundwater Recharge of the Lower Reaches of the Heihe River, Inner Mongolia, China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Environmental isotopes have been applied to analyze confined groundwater recharge in the lower reaches of the Heihe River, Inner Mongolia. CFC is regarded as a tracer that determines the date of groundwater, the date being less than 45 a. The confined groundwater within the Gurinai area and Ejin Basin other than the surface water of Heihe River might have originated from precipitation from Qilian Mountain or/and the Tibetan Plateau. The deep confined groundwater overflows into an upper aquifer and emerges into the ground, forming springs and lakes within the low-lying area. The recharge volume is estimated to be around 400 million-cubic meters.

  5. Drug diffusion and biological responses of arteries using a drug-eluting stent with nonuniform coating

    Directory of Open Access Journals (Sweden)

    Saito N

    2016-03-01

    Full Text Available Noboru Saito, Yuhei Mori, Sayaka Uchiyama Terumo Corporation R&D Center, Inokuchi, Nakai-machi, Ashigarakami-gun, Kanagawa, Japan Abstract: The purpose of this study was to determine the effect of a nonuniform coating, abluminal-gradient coating (AGC, which leaves the abluminal surface of the curves and links parts of the stent free from the drug coating, on the diffusion direction of the drug and the biological responses of the artery to drug-eluting stent (DES by comparing the AGC-sirolimus stent and the conventional full-surface coating (CFC sirolimus stent. The study aimed to verify whether the AGC approach was appropriate for the development of a safer DES, minimizing the risks of stent thrombosis due to delayed endothelialization by the drug and distal embolization due to cracking of the coating layer on the hinge parts of the DES on stent expansion. In the in vitro local drug diffusion study, we used rhodamine B as a model drug, and rhodamine B released from the AGC stent diffused predominantly into the abluminal side of the alginate artery model. Conversely, rhodamine B released from the CFC stent quickly spread to the luminal side of the artery model, where endothelial cell regeneration is required. In the biological responses study, the luminal surface of the iliac artery implanted with the AGC-sirolimus stent in a rabbit iliac artery for 2 weeks was completely covered with endothelial-like cells. On the other hand, the luminal surface of the iliac artery implanted with the CFC-sirolimus stent for 2 weeks only showed partial coverage with endothelial-like cells. While thrombosis was observed in two of the three CFC-sirolimus stents, it was observed in only one of the three AGC-sirolimus stents. Taken together, these findings indicate that the designed nonuniform coating (AGC is an appropriate approach to ensure a safer DES. However, the number of studies is limited and a larger study should be conducted to reach a statistically

  6. Contribution of Kenya's house-hold activities to global warming

    Energy Technology Data Exchange (ETDEWEB)

    Oteng' i, Silvery Beddar Buluma [Nairobi Univ., Dept. of Meteorology, Nairobi (Kenya)

    1999-07-01

    The use of energy sources that release green house gases to the atmosphere by different social classes in different parts of Kenya was studied. Charcoal, wood-fuel, liquid gas, kerosene, refrigerators and motor vehicles were used as proxies to quantify the trace gases: CO{sub 2}, CO, H{sub 2}O and CFC. The results show that all social classes in most parts of Kenya release substantial trace gases to the atmosphere depending on the sources of energy and population density. (Author)

  7. 'Blends' substitute R 502 and R 22. New knowledge about mixtures as substituting refrigerants; 13th seminar of the Research Center for Refrigeration Engineering and Heat Pumps. 'Blends' loesen R 502 und R 22 ab. Neue Erkenntnisse ueber Gemische als Ersatzkaeltemittel; 13. Seminar des Forschungszentrums fuer Kaeltetechnik und Waermepumpen

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1993-06-01

    Only refrigerant mixtures are suitable as substitutes for CFC 502 and H-FCKW 22. In the frame of a seminar of the research center for cooling technology and heat pumps, the present state-of-the-art was discussed in March. This contribution gives a summary of further special lectures (start of the report in the edition of May) on the following topics: hydrocarbons as refrigerants in house-hold devices; expansion valves for refrigerant mixtures; further advantages of the application of zeotropic refrigerant mixtures. (BWI)

  8. The president speaks: prevention is best: lessons from protecting the ozone layer.

    Science.gov (United States)

    Woodcock, Ashley

    2012-12-01

    The Montreal Protocol was signed 25 years ago. As a result, the irreversible destruction of the ozone layer was prevented. However, stratospheric ozone will not recover completely until 2060 and the consequent epidemic in skin cancer cases will persist until 2100. Many millions of patients with asthma and chronic obstructive pulmonary disease have safely switched from chlorofluorocarbon (CFC)-powered metered-dose inhalers (MDIs) to either hydrofluorocarbon (HFC) or DPIs. China will be the last country to phase out CFCs by 2016. HFCs are global warming gases which will be controlled in the near future. HFCs in MDIs may be phased out over the next 10-20 years. PMID:23019254

  9. Thermophysical Properties of a New Environment Friendly Alternative—Trifluoroiodomethane

    Institute of Scientific and Technical Information of China (English)

    DuanYuanyuan; ShiLin; 等

    1999-01-01

    Trifluoroiodomethane(CF3I) is considered as a promising refrigerant alternative,especially as a component in mixtures,to replace CFC-12,But reliable thermophysical property data for CF3I are still limited.The investigations on thermophysical properties of CF3I developed by us are summarized in this paper,Experimental data of critical parameters,and the correlations of saturated liquid and vapor density,enthalpy of vaporization ,vapor pressure PVT properties,second virial coefficient,ideal-gas heat capacity,surface tension,viscosity and thermal conductivity are given in the present paper.

  10. Cogeneration and beyond: The need and opportunity for high efficiency, renewable community energy systems

    International Nuclear Information System (INIS)

    The justification, strategies, and technology options for implementing advanced district heating and cooling systems in the United States are presented. The need for such systems is discussed in terms of global warming, ozone depletion, and the need for a sustainable energy policy. Strategies for implementation are presented in the context of the Public Utilities Regulatory Policies Act and proposed new institutional arrangements. Technology opportunities are highlighted in the areas of advanced block-scale cogeneration, CFC-free chiller technologies, and renewable sources of heating and cooling that are particularly applicable to district systems

  11. Chemical and thermal stability of refrigerant-lubricant mixtures with metals

    Energy Technology Data Exchange (ETDEWEB)

    Huttenlocher, D.F.

    1992-10-09

    This report presents the results of a sealed tube stability study on twenty-one refrigerant-lubricant mixtures selected from the following groupings: HFCs R-32, R-125, R-134, R-134a, R-143a, and R-152a with one or more lubricants selected from among three pentaerythritol esters and three polyalkylene glycols. All lubricants were carefully predried to 25 ppm or less moisture content. HCFCs R-22, R-123, R-124, and R-142b, as well as CFC R-11, with one or more lubricants selected from among two mineral oils and one alkylbenzene fluid. Bach test mixture was aged at three temperature levels.

  12. Chemical and thermal stability of refrigerant-lubricant mixtures with metals. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Huttenlocher, D.F.

    1992-10-09

    This report presents the results of a sealed tube stability study on twenty-one refrigerant-lubricant mixtures selected from the following groupings: HFCs R-32, R-125, R-134, R-134a, R-143a, and R-152a with one or more lubricants selected from among three pentaerythritol esters and three polyalkylene glycols. All lubricants were carefully predried to 25 ppm or less moisture content. HCFCs R-22, R-123, R-124, and R-142b, as well as CFC R-11, with one or more lubricants selected from among two mineral oils and one alkylbenzene fluid. Bach test mixture was aged at three temperature levels.

  13. Hats off to CERN's Master of Apprenticeships!

    CERN Multimedia

    2004-01-01

    Roland Gay of the HR Department (at right) recently received a special diploma from the Geneva Industrial Union (UIG). Presented by Carlo Lamprecht, Head of the Department of Economy, Employment and External Affairs of the State of Geneva, the diploma was awarded in recognition of the 199 CERN apprentices Roland has guided through the Certificat Fédéral de Capacité (CFC), an end-of-apprenticeship certificate awarded by the Cantonal authorities. Roland will be retiring in December 2004 after 37 years of service, 32 of which he spent in the role of apprenticeship supervisor.

  14. Effects of Humic Acid and Solution pH on Dispersion of Na—and Ca—Soil Clays

    Institute of Scientific and Technical Information of China (English)

    LANYEQING; HUQIONGYING; 等

    1996-01-01

    Dispersed soil clays have a negative impact on soil structure and contribute to soil erosion and contaminant movement.In this study,two typical soils from the south of China were chosen for investigating roles of pH and humic acid(HA) on dispersion of soil clays.Critical flocculation concentration (CFC) of the soil clay suspension was determined by using light transmission at a wavelength of 600 nm.The results indicated that effects of pH and HA on dispersion of the soil clays were closely related to the type of the major minerals makin up the soil and to the valence of the exchangeable cations as well.At four rates of pH(4,6,8and 10),the CFC for the Na-yellow-brown soil treated with H2O2 was increased from 0.32 to 0.56,6.0 to 14.0,10.0 to 24.6 and 26.0 to 52.0mmol L-1 NaCl,respectively when Na-HA was added at the rate of from 0 to 40mgL-1,With the same Na-HA addition and three pH(6,8and 10)treatments,the CFC for the Na-red soil was incresed from 0.5 to 20.0,1.0 to 40.0 and 6.0 to 141.0mmol L-1 NaCl,respectively.Obviously,pH and HA has greater effects on clay dispersion of the red soil(dominated by 1:1 minerals and oxides) than on that of the yellow-brown soil(dominated by 2:1minerals).However,at three rates of pH(6,8and 10) and with the addition of Ca-HA from 0 to 40mg L-1,the CFC of the Ca-yellow-brown soil and Ca-red soil treated with H2O2 was increased from 0.55 to 0.81,0.75 to 1.28,0.55 to 1.45and 0.038 to 0.266.0.25 to 0.62,0.7to 1.6mmol CaCl2 L-1,respectively.So,Na-soil claye are more sensitive to pH and HA than Ca-soil clays.

  15. Cogeneration and beyond: The need and opportunity for high efficiency, renewable community energy systems

    Energy Technology Data Exchange (ETDEWEB)

    Gleason, T.C.J.

    1992-06-01

    The justification, strategies, and technology options for implementing advanced district heating and cooling systems in the United States are presented. The need for such systems is discussed in terms of global warming, ozone depletion, and the need for a sustainable energy policy. Strategies for implementation are presented in the context of the Public Utilities Regulatory Policies Act and proposed new institutional arrangements. Technology opportunities are highlighted in the areas of advanced block-scale cogeneration, CFC-free chiller technologies, and renewable sources of heating and cooling that are particularly applicable to district systems.

  16. The president speaks: prevention is best: lessons from protecting the ozone layer.

    Science.gov (United States)

    Woodcock, Ashley

    2012-12-01

    The Montreal Protocol was signed 25 years ago. As a result, the irreversible destruction of the ozone layer was prevented. However, stratospheric ozone will not recover completely until 2060 and the consequent epidemic in skin cancer cases will persist until 2100. Many millions of patients with asthma and chronic obstructive pulmonary disease have safely switched from chlorofluorocarbon (CFC)-powered metered-dose inhalers (MDIs) to either hydrofluorocarbon (HFC) or DPIs. China will be the last country to phase out CFCs by 2016. HFCs are global warming gases which will be controlled in the near future. HFCs in MDIs may be phased out over the next 10-20 years.

  17. 汽车空调制冷剂回收与再生方法%Principle and Ways for Recycling and Regeneration of the Automotive Air Conditioning Refrigerant

    Institute of Scientific and Technical Information of China (English)

    王启祥; 郑就

    2009-01-01

    本文阐述了汽车空调CFCs-12制冷剂回收与再生的工艺流程、设备装置和操作方法,提出了减少制冷剂排放和保护臭氧层的建议.%This paper introduces the mechanism of the CFC-12 refrigerant to ozone layer destruction.It elaborates the refrigerant recycling and the technical process of regeneration,equipment installment and operating procedure,and puts forward the suggestion of reduced refrigerant emissions and the protection of ozone layer.

  18. Investigations on a Thermoacoustic Refrigerator

    CERN Document Server

    Dhuley, Ram C

    2016-01-01

    Thermoacoustic Refrigerators use acoustic power for generating cold temperatures. Development of refrigerators based on the thermoacoustic technology is a novel solution to the present day need of cooling, without causing environmental hazards. With added advantages such as minimal moving parts and absence of CFC refrigerants, these devices can attain low temperatures maintaining a compact size. The present work describes an in-depth theoretical analysis of standing wave thermoacoustic refrigerators. This consists of detailed parametric studies, transient state analysis, and a design using an available simulation software. Design and construction of a thermoacoustic refrigerator using a commercially available electro-dynamic motor is also presented.

  19. Environmentally Sound Processing Technology: JANNAF Safety and Environmental Protection Subcommittee and Propellant Development and Characterization Subcommittee Joint Workshop

    Science.gov (United States)

    Pickett, Lorri A. (Editor)

    1995-01-01

    Topics covered include: Risk assessment of hazardous materials, Automated systems for pollution prevention and hazardous materials elimination, Study design for the toxicity evaluation of ammonium perchlorate, Plasma sprayed bondable stainless surface coatings, Development of CFC-free cleaning processes, New fluorinated solvent alternatives to ozone depleting solvents, Cleaning with highly fluorinated liquids, Biotreatment of propyleneglycol nitrate by anoxic denitrification, Treatment of hazardous waste with white rot fungus, Hydrothermal oxidation as an environmentally benign treatment technology, Treatment of solid propellant manufacturing wastes by base hydrolysis, Design considerations for cleaning using supercritical fluid technology, and Centrifugal shear carbon dioxide cleaning.

  20. 怎样维修"HFC-134a"制冷剂冰箱

    Institute of Scientific and Technical Information of China (English)

    徐进华

    2003-01-01

    @@ 美国杜邦(DuPont)公司推出了HFC-I34a,即四氯乙烷,它仍属于卤代烃类,但不含氟和溴,所以ODP(Ozone Deplete Potentia即臭氧消耗潜值)为零.家用电冰箱发展到现在,主要采用的制冷剂有:R12(CFC-12)、R134a(HFC-134a)、HC-600a等.

  1. Theoretical foundation for measuring the groundwater age distribution.

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, William Payton; Arnold, Bill Walter

    2014-01-01

    In this study, we use PFLOTRAN, a highly scalable, parallel, flow and reactive transport code to simulate the concentrations of 3H, 3He, CFC-11, CFC-12, CFC-113, SF6, 39Ar, 81Kr, 4He and themean groundwater age in heterogeneous fields on grids with an excess of 10 million nodes. We utilize this computational platform to simulate the concentration of multiple tracers in high-resolution, heterogeneous 2-D and 3-D domains, and calculate tracer-derived ages. Tracer-derived ages show systematic biases toward younger ages when the groundwater age distribution contains water older than the maximum tracer age. The deviation of the tracer-derived age distribution from the true groundwater age distribution increases with increasing heterogeneity of the system. However, the effect of heterogeneity is diminished as the mean travel time gets closer the tracer age limit. Age distributions in 3-D domains differ significantly from 2-D domains. 3D simulations show decreased mean age, and less variance in age distribution for identical heterogeneity statistics. High-performance computing allows for investigation of tracer and groundwater age systematics in high-resolution domains, providing a platform for understanding and utilizing environmental tracer and groundwater age information in heterogeneous 3-D systems. Groundwater environmental tracers can provide important constraints for the calibration of groundwater flow models. Direct simulation of environmental tracer concentrations in models has the additional advantage of avoiding assumptions associated with using calculated groundwater age values. This study quantifies model uncertainty reduction resulting from the addition of environmental tracer concentration data. The analysis uses a synthetic heterogeneous aquifer and the calibration of a flow and transport model using the pilot point method. Results indicate a significant reduction in the uncertainty in permeability with the addition of environmental tracer data, relative

  2. An Investigation About the Distribution and Isolation of Pseudomonas from Raw Milk Samples Obtained from Different Areas

    OpenAIRE

    Uraz, Güven; ÇITAK, Sumru

    1998-01-01

    In this research, a total of 48 Pseudomonas had been isolated using PseudomonasCN and CFC Agar, Pseudomonas P(King A) and PseudomonasF(King B) and Crystal Violet Tetrazolium Agar (CVT) from 200 raw milk samples. Of 48 isolated Pseudomonas, (41.66%) 20 have been named as P. fluorescens, (22.51%) 11 as P. aeruginosa,22.91%) 11 as P. putida, (4.16%) 2 as P. aurefa-ciens, (6.25%) 3 as P. pseudomallei, (2.08%) 1 as P. cepacia. When the distribution of Pseudomonas species has been evaluated acc...

  3. System design and analysis of the trans-critical carbon-dioxide automotive air-conditioning system

    Institute of Scientific and Technical Information of China (English)

    穆景阳; 陈江平; 陈芝久

    2003-01-01

    As an environmentally harmless and feasible alternate refrigerant, CO2 has attracted worldwide attention, especially in the area of automobile air-conditioning (AAC). The thermal property of CO2 and its trans-eritical refrigeration cycle is very different from that of the traditional CFC or HCFC system. The detailed process of CO2 system thermal cycle design and optimization is described in this paper. System prototype and performance test bench were developed to analyze the performance of the CO2 AAC system.

  4. System design and analysis of the trans-critical carbon-dioxide automotive air-conditioning system

    Institute of Scientific and Technical Information of China (English)

    穆景阳; 陈江平; 陈芝久

    2003-01-01

    As an environmentally harmless and feasible alternate refrigerant, CO2 has attracted worldwide attention, especially in the area of automobile air-conditioning (AAC). The thermal property of CO2 and its trans-critical refrigeration cycle is very different from that of the traditional CFC or HCFC system. The detailed process of CO2 system thermal cycle design and optimization is described in this paper. System prototype and performance test bench were developed to analyze the performance of the CO2 AAC system.

  5. Role of mesoscale eddies in the global ocean uptake of anthropogenic CO{sub 2}; Role des tourbillons de meso-echelle oceaniques dans la distribution et les flux air-mer de CO{sub 2} anthropique a l'echelle globale

    Energy Technology Data Exchange (ETDEWEB)

    Zouhair, Lachkar

    2007-02-15

    Mesoscale eddies play a fundamental role in ocean dynamics particularly in the Southern Ocean. Global-scale tracer simulations are typically made at coarse resolution without explicitly modeling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of anthropogenic CO{sub 2}, CFC-11 and bomb {delta}{sup 14}C. We made global anthropogenic transient tracer simulations in coarse-resolution, ORCA2, and eddy-permitting, ORCA05 and ORCA025, versions of the ocean modelling system NEMO. We focus on the Southern Ocean where tracer air-sea fluxes are largest. Eddies have little effect on bomb {delta}{sup 14}C uptake and storage. Yet for CFC-11 and anthropogenic CO{sub 2}, increased eddy activity reduces southern extra-tropical uptake by 28% and 25% respectively, thereby providing better agreement with observations. It is shown that the discrepancies in the equilibration times between the three tracers determine their respective sensitivities to the model horizontal resolution. Applying Gent and McWilliams (1990) (GM) parameterization of eddies in the non-eddying version of the model does improve results, but not enough. An in-depth investigation of the mechanisms by which eddies affect the uptake of the transient tracers shows that including mesoscale eddies leads to an overall reduction in the Antarctic Intermediate Water (AAIW) ventilation, and modifies substantially the spatial distribution of their source regions. This investigation reveals also that the GM parameterization still overestimates the ventilation and the subduction of AAIW in the Indian Ocean where the simulated mixed layer is particularly deep during the winter. This work suggests that most current coarse-resolution models may overestimate the ventilation of AAIW in the Indian sector of the Southern Ocean. This study shows also that the use of the GM parameterization may be of limited utility where mixed layer is relatively deep and confirms the general need for a

  6. 预成型纺织材料用于纤维增强复合材料%Textile preforms with high level of pre-fabrication for fiber reinforced composites

    Institute of Scientific and Technical Information of China (English)

    H. Illing-Günther; R. Helbig; R. Arnold; H. Erth; P. Schiebel; H. Purol; A. S. Herrmann; 李丽敏

    2009-01-01

    研究了利用双针床多轴向经编技术编织生产可反复拉挤的玻璃纤维或碳纤维增强聚合物复合材料(GFC或CFC)的发展和制造状况,并基于优化的挤压成型工艺过程(MVI,挤压和牵拉技术),对这些预成型材料进行测试,对其用于复合材料的经济适用性进行了评估.

  7. Confocal microscopy: A new tool for erosion measurements on large scale plasma facing components in tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Gauthier, E., E-mail: eric.gauthier@cea.fr [CEA/DSM/IRFM, CEA Cadarache, Saint-Paul-lez-Durance (France); Brosset, C.; Roche, H.; Tsitrone, E.; Pégourié, B.; Martinez, A. [CEA/DSM/IRFM, CEA Cadarache, Saint-Paul-lez-Durance (France); Languille, P. [PIIM, CNRS-Université de Provence, Centre de St Jérôme, 13397 Marseille, Cedex 20 (France); Courtois, X.; Lallier, Y. [CEA/DSM/IRFM, CEA Cadarache, Saint-Paul-lez-Durance (France); Salami, M. [AVANTIS CONCEPT, 75 Rue Marcelin Berthelot, 13858 Aix en Provence (France)

    2013-07-15

    A diagnostic based on confocal microscopy was developed at CEA Cadarache in order to measure erosion on large plasma facing components during shutdown in situ in Tore Supra. This paper describes the diagnostic and presents results obtained on Beryllium and Carbon Fibre Composite (CFC) materials. Erosion in the range of 800 μm was found on one sector of the Toroidal Pumped Limiter (TPL) which provides, by integration to the full limiter a net carbon erosion of about 900 g over the period 2002–2007.

  8. Hydrogen-plasticity interactions in austenitic alloys; Interactions hydrogene-plasticite dans les alliages austenitiques

    Energy Technology Data Exchange (ETDEWEB)

    Delafosse, D.; Girardin, G. [Ecole Nationale Superieure des Mines de Saint-Etienne, Centre SMS, PECM-CNRS, 42 - Saint-Etienne (France)

    2007-07-01

    The aim of this work is to validate and to experimentally characterize the potential and limits of an approach based on an elastic theory of crystal defects. At first, is macroscopically characterized the dynamic interactions of hydrogen-dislocations by aging tests. Then, the hydrogen influence on plasticity mechanisms is estimated while being supported by classical analytical models of the elastic theory of dislocations. At last, is experimentally analyzed the hydrogen influence on the gliding stress of CFC materials with model materials. (O.M.)

  9. Stratospheric cooling and polar ozone loss due to H2 emissions of a global hydrogen economy

    Science.gov (United States)

    Feck, T.; Grooß, J.-U.; Riese, M.; Vogel, B.

    2009-04-01

    "Green" hydrogen is seen as a major element of the future energy supply to reduce greenhouse gas emissions substantially. However, due to the possible interactions of hydrogen (H2) with other atmospheric constituents there is a need to analyse the implications of additional atmospheric H2 that could result from hydrogen leakage of a global hydrogen infrastructure. Emissions of molecular H2 can occur along the whole hydrogen process chain which increase the tropospheric H2 burden. Across the tropical tropopause H2 reaches the stratosphere where it is oxidised and forms water vapour (H2O). This causes increased IR-emissions into space and hence a cooling of the stratosphere. Both effects, the increase of stratospheric H2O and the cooling, enhances the potential of chlorine activation on liquid sulfate aerosol and polar stratospheric clouds (PSCs), which increase polar ozone destruction. Hence a global hydrogen economy could provoke polar ozone loss and could lead to a substantial delay of the current projected recovery of the stratospheric ozone layer. Our investigations show that even if 90% of the current global fossil primary energy input could be replaced by hydrogen and approximately 9.5% of the product gas would leak to the atmosphere, the ozone loss would be increased between 15 to 26 Dobson Units (DU) if the stratospheric CFC loading would retain unchanged. A consistency check of the used approximation methods with the Chemical Lagrangian Model of the Stratosphere (CLaMS) shows that this additional ozone loss can probably be treated as an upper limit. Towards more realistic future H2 leakage rate assumptions (< 3%) the additional ozone loss would be rather small (? 10 DU). However, in all cases the full damage would only occur if stratospheric CFC-levels would retain unchanged. Due to the CFC-prohibition as a result of the Montreal Protocol the forecasts suggest a decline of the stratospheric CFC loading about 50% until 2050. In this case our calculations

  10. An Equilibrium-Based Model of Gas Reaction and Detonation

    International Nuclear Information System (INIS)

    During gaseous diffusion plant operations, conditions leading to the formation of flammable gas mixtures may occasionally arise. Currently, these could consist of the evaporative coolant CFC-114 and fluorinating agents such as F2 and ClF3. Replacement of CFC-114 with a non-ozone-depleting substitute is planned. Consequently, in the future, the substitute coolant must also be considered as a potential fuel in flammable gas mixtures. Two questions of practical interest arise: (1) can a particular mixture sustain and propagate a flame if ignited, and (2) what is the maximum pressure that can be generated by the burning (and possibly exploding) gas mixture, should it ignite? Experimental data on these systems, particularly for the newer coolant candidates, are limited. To assist in answering these questions, a mathematical model was developed to serve as a tool for predicting the potential detonation pressures and for estimating the composition limits of flammability for these systems based on empirical correlations between gas mixture thermodynamics and flammability for known systems. The present model uses the thermodynamic equilibrium to determine the reaction endpoint of a reactive gas mixture and uses detonation theory to estimate an upper bound to the pressure that could be generated upon ignition. The model described and documented in this report is an extended version of related models developed in 1992 and 1999

  11. Energy deposition and thermal effects of runaway electrons in ITER-FEAT plasma facing components

    International Nuclear Information System (INIS)

    The profile of energy deposited by runaway electrons (RAEs) of 10 or 50 MeV in International Thermonuclear Experimental Reactor-Fusion Energy Advanced Tokamak (ITER-FEAT) plasma facing components (PFCs) and the subsequent temperature pattern have been calculated by using the Monte Carlo code FLUKA and the finite element heat conduction code ANSYS. The RAE energy deposition density was assumed to be 50 MJ/m2 and both 10 and 100 ms deposition times were considered. Five different configurations of PFCs were investigated: primary first wall armoured with Be, with and without protecting CFC poloidal limiters, both port limiter first wall options (Be flat tile and CFC monoblock), divertor baffle first wall, armoured with W. The analysis has outlined that for all the configurations but one (port limiter with Be flat tile) the heat sink and the cooling tube beneath the armour are well protected for both RAE energies and for both energy deposition times. On the other hand large melting (W, Be) or sublimation (C) of the surface layer occurs, eventually affecting the PFCs lifetime

  12. Infrared thermography inspection for monoblock divertor target in JT-60SA

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Shigetoshi, E-mail: nakamura.shigetoshi@jaea.go.jp; Sakurai, Shinji; Ozaki, Hidetsugu; Seki, Yohji; Yokoyama, Kenji; Sakasai, Akira; Tsuru, Daigo

    2014-10-15

    Highlights: • Infrared thermography inspection is modified to inspect JT-60SA divertor targets. • Infrared thermography inspection is effective to detect joining defects of targets. • Numerical analysis is in good agreement with inspection results of mock-up targets. • Database for setting screening criteria has been constructed by numerical analysis. - Abstract: Carbon fiber composite (CFC) monoblock divertor target is required for power handling in JT-60SA. Quality of the targets depends on a joining technology in manufacturing process. To inspect the quality of more than 900 target pieces, efficient non-destructive inspection is needed. An infrared thermography inspection (IR inspection), has been proposed by ITER and IRFM, where the quality between CFC and a cooling tube is examined by a use of transient thermal response at a rapid switch from hot to cold water flow. In JT-60SA divertor target, a screw tube will be employed to obtain high heat transfer efficiency with simple structure. Since the time response of the screw tube is much faster than that of smooth tube, it is required to confirm the feasibility of this IR inspection. Thus, the effect of joining defects on transient thermal response of the targets has been investigated experimentally by using the mock-up targets containing defects which are artificially made. It was found that the IR inspection can detect the defects. Moreover, screening criteria of IR inspection for acceptable monoblock target is discussed.

  13. Effective Thermal-Conductivity Measurements on Supporting Structures of the Mercury Probe Bepi Colombo

    Science.gov (United States)

    Vidi, S.; Rausch, S.; Ebert, H. P.; Löhberg, A.; Petry, D.

    2013-05-01

    Measurements were done on a carbon fiber reinforced composite (CFC) sample tested for the space probe Bepi Colombo by using the guarded hot-plate (GHP) method. The values of interest were the thermal transmittance through the samples, (56.3 ± 3.6) W · m-2 · K-1, and the effective thermal conductivity (1.06 ± 0.07) W · m-1 · K-1. The samples consist of a light honeycomb core attached to thicker surface plates. Due to this construction, the effective thermal conductivity parallel to the face plates is higher than the effective thermal conductivity through the sample. This leads to lateral heat gains or losses during the GHP measurement, which in return can lead to erroneous results. Furthermore, due to the high rigidity of the CFC material, there will be high contact resistances between the samples and the GHP apparatus plates. The separation of these thermal contact resistances from the total measured thermal resistance is essential in order to achieve correct results. Good results were achieved using a special measurement setup and a lateral correction method designed to reduce errors due to lateral heat flows.

  14. Dynamic erosion of plasma facing materials under ITER relevant thermal shock loads in the electron beam facility, JUDITH

    International Nuclear Information System (INIS)

    ITER relevant thermal shock loads have been performed in the electron beam facility, JUDITH. Dynamic erosion processes of fine grain graphite, carbon fiber composite (CFC) and W-1%La2O3 were observed by optical diagnostics. Collective small particle release which may correspond to erosion of graphite binder phase was observed at 2 GW/m2 in graphite, whereas, distinguished particle release was observed at the same power density in CFC. The distinguished particle release was concluded to be due to brittle destruction of overheated PAN fibers which has lower thermal conductivity in vertical direction. Most particles released from W-1%La2O3 were appeared to be droplets splashed from the molten surface. The contribution of brittle destruction in W-1%La2O3 was not clearly observed in this particular thermal shock loads. Release of tungsten atoms and WO molecules was not observed by emission spectrometer even at high power density, 1.1 GW/m2 which caused melting of the surfaces, however, release of LaO molecules was detected even at lower power density, 0.6 GW/m2 where and the surface did not show significant modification. (author)

  15. Alternative refrigerants for supermarket refrigerators; Alternative Kaeltemittel fuer Supermarkt-Kaelteanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Haaf, S.; Heinbokel, B. [Linde AG, Geschaeftsbereich Kaeltetechnik, Koeln (Germany)

    2003-07-01

    Most supermarket refrigerators are still equipped with H-CFC (R404A and R134a), which contribute to global warming. Natural refrigerants were tested as substitutes, i.e. NH{sub 3}, propene and CO{sub 2}, but H-CFC systems are still the best solution. Attempts are now made to reduce refrigerant filling levels and prevent leakage. [German] Die in Supermarkt-Kaelteanlagen ueberwiegend eingesetzten HFKW-Kaeltemittel R404A und R134a weisen betraechtliche Treibhauspotentiale auf. Im Zusammenhang mit auftretenden Kaeltemittel-Leckagen wirkt sich dies auf die Hoehe des gesamten Treibhauseffekts TEWI derartiger Anlagen aus. Im Laufe der letzten Jahre wurde von Linde eine grosse Anzahl von Anlagen mit den natuerlichen Kaeltemitteln NH{sub 3}, Propen und fuer die Tiefkuehlung auch mit CO{sub 2} installiert. Waehrend die Betriebssicherheit dieser Anlagen als gut bezeichnet werden kann, weisen die Anlagen mit NH{sub 3} und Propen, bei denen die Kuehlung der Verbraucher ueber Kaeltetraegerkreislaeufe erfolgt, deutlich hoehere Energieverbraeuche und Investitionskosten auf. Gute Chancen fuer eine wirtschaftliche Betriebsweise bieten hingegen CO{sub 2}-Kaskadenanlagen fuer die Tiefkuehlung. Da fuer den Bereich der Normalkuehlung kurzfristig keine akzeptable Loesung mit CO{sub 2} als Kaeltemittel zur Verfuegung stehen wird, bilden Anlagen mit HFKW-Kaeltemitteln weiterhin die beste Loesung, wobei weitere Reduzierung der Kaeltemittel-Fuellmengen und Leckagen zur Steigerung der Umweltfreundlichkeit notwendig und moeglich sind. (orig.)

  16. A new method used to evaluate organic working fluids

    International Nuclear Information System (INIS)

    In this paper, we propose a method named “Weight Classification-Hasse Dominance” to evaluate organic working fluids. This new method combines the advantages of both the method of weight determination and the Hasse Diagram Technique (HDT). It can be used to evaluate the thermodynamic performance, environmental protection indicator, and safety requirement of organic working fluid simultaneously. This evaluation method can offer good reference for working fluid selection. Using this method, the organic working fluids which have been phased out and will be phased out by the Montreal Protocol including CFCs (chlorofluorocarbons), HCFCs (hydrochlorofluorocarbons), and HFCs (hydrofluorocarbons) were evaluated. Moreover, HCs (hydrocarbons) can be considered as a completely different kind of organic working fluid from CFCs, HCFCs, and HFCs according to the comparison based on this new evaluation method. - Highlights: • We propose a new method used to evaluate organic working fluids. • This evaluation method can offer good reference for working fluid selection. • CFC, HCFC, and HFC working fluids were evaluated using this evaluation method. • HC can be considered as a totally different working fluid from CFC, HCFC, and HFC

  17. Calculation of heat flux and evolution of equivalent thermal contact resistance of carbon deposits on Tore Supra neutralizer

    Energy Technology Data Exchange (ETDEWEB)

    Gardarein, Jean-Laurent [Ass. Euratom-CEA, CEA/DSM/IRFM, CEA Cadarache, F-13108 St. Paul lez Durance (France)], E-mail: jean-laurent.gardarein@bordeaux.ensam.fr; Reichle, Roger [Ass. Euratom-CEA, CEA/DSM/IRFM, CEA Cadarache, F-13108 St. Paul lez Durance (France); Rigollet, Fabrice; Le Niliot, Christophe [IUSTI UMR CNRS 65 95, Universite de Provence, Marseille (France); Pocheau, Christine [Ass. Euratom-CEA, CEA/DSM/IRFM, CEA Cadarache, F-13108 St. Paul lez Durance (France)

    2008-10-15

    This paper presents a new heat flux computation applied to the neutralizer of Tore Supra using a deconvolution procedure and the thermal quadrupoles method. A steady deposition of carbon takes place at a rate of about 30 nm/s on the actively cooled carbon fibre composite (CFC) surface of the neutralizer. Thermal measurements of the surface temperature are available through optical fibre-based infrared thermography. These measurements are used to estimate the heat flux and to follow the temporal evolution of a single parameter, representing the thermal properties of the growing thin carbon layer. This parameter corresponds to an equivalent thermal resistance R{sub eq} (in m{sup 2} K W{sup -1}). During the first 2000 s of plasma operation on a new CFC neutralizer surface, R{sub eq} rises about proportionally with exposure time. From then on no significant further evolution of R{sub eq} is observed. We interpret this as indication for a thermal and mechanical detachment of the deposit from the substrate for deposits exceeding a thickness of 60 {mu}m.

  18. Calculation of heat flux and evolution of equivalent thermal contact resistance of carbon deposits on Tore Supra neutralizer

    International Nuclear Information System (INIS)

    This paper presents a new heat flux computation applied to the neutralizer of Tore Supra using a deconvolution procedure and the thermal quadrupoles method. A steady deposition of carbon takes place at a rate of about 30 nm/s on the actively cooled carbon fibre composite (CFC) surface of the neutralizer. Thermal measurements of the surface temperature are available through optical fibre-based infrared thermography. These measurements are used to estimate the heat flux and to follow the temporal evolution of a single parameter, representing the thermal properties of the growing thin carbon layer. This parameter corresponds to an equivalent thermal resistance Req (in m2 K W-1). During the first 2000 s of plasma operation on a new CFC neutralizer surface, Req rises about proportionally with exposure time. From then on no significant further evolution of Req is observed. We interpret this as indication for a thermal and mechanical detachment of the deposit from the substrate for deposits exceeding a thickness of 60 μm.

  19. The Search for Nonflammable Solvent Alternatives for Cleaning Aerospace Oxygen Systems

    Science.gov (United States)

    Mitchell, Mark; Lowrey, Nikki

    2012-01-01

    Oxygen systems are susceptible to fires caused by particle and nonvolatile residue (NVR) contaminants, therefore cleaning and verification is essential for system safety. . Cleaning solvents used on oxygen system components must be either nonflammable in pure oxygen or complete removal must be assured for system safety. . CFC -113 was the solvent of choice before 1996 because it was effective, least toxic, compatible with most materials of construction, and non ]reactive with oxygen. When CFC -113 was phased out in 1996, HCFC -225 was selected as an interim replacement for cleaning propulsion oxygen systems at NASA. HCFC-225 production phase-out date is 01/01/2015. HCFC ]225 (AK ]225G) is used extensively at Marshall Space Flight Center and Stennis Space Center for cleaning and NVR verification on large propulsion oxygen systems, and propulsion test stands and ground support equipment. . Many components are too large for ultrasonic agitation - necessary for effective aqueous cleaning and NVR sampling. . Test stand equipment must be cleaned prior to installation of test hardware. Many items must be cleaned by wipe or flush in situ where complete removal of a flammable solvent cannot be assured. The search for a replacement solvent for these applications is ongoing.

  20. Release and fate of fluorocarbons in a shredder residue landfill cell: 2. Field investigations.

    Science.gov (United States)

    Scheutz, Charlotte; Fredenslund, Anders M; Nedenskov, Jonas; Kjeldsen, Peter

    2010-11-01

    The shredder residues from automobiles, home appliances and other metal containing products are often disposed in landfills, as recycling technologies for these materials are not common in many countries. Shredder waste contains rigid and soft foams from cushions and insulation panels blown with fluorocarbons. The objective of this study was to determine the gas composition, attenuation, and emission of fluorocarbons in a monofill shredder residue landfill cell by field investigation. Landfill gas generated within the shredder waste primarily consisted of CH(4) (27%) and N(2) (71%), without CO(2), indicating that the gas composition was governed by chemical reactions in combination with anaerobic microbial reactions. The gas generated also contained different fluorocarbons (up to 27 μg L(-1)). The presence of HCFC-21 and HCFC-31 indicated that anaerobic degradation of CFC-11 occurred in the landfill cell, as neither of these compounds has been produced for industrial applications. This study demonstrates that a landfill cell containing shredder waste has a potential for attenuating CFC-11 released from polyurethane (PUR) insulation foam in the cell via aerobic and anaerobic biodegradation processes. In deeper, anaerobic zones of the cell, reductive dechlorination of CFCs to HCFCs was evident, while in the shallow, oxic zones, there was a high potential for biooxidation of both methane and lesser chlorinated fluorocarbons. These findings correlated well with both laboratory results (presented in a companion paper) and surface emission measurements that, with the exception from a few hot spots, indicated that surface emissions were negative or below detection. PMID:20444588

  1. High energy flux thermo-mechanical test of 1D-carbon-carbon fibre composite prototypes for the SPIDER diagnostic calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    De Muri, M., E-mail: michela.demuri@igi.cnr.it; Pasqualotto, R.; Dalla Palma, M.; Cervaro, V.; Fasolo, D.; Franchin, L.; Tollin, M.; Serianni, G. [Consorzio RFX, Euratom-ENEA association, Corso Stati Uniti 4, 35127 Padova (Italy); Cavallin, T. [Istituto per l’Energetica e le Interfasi, Corso Stati Uniti 4, 35127 Padova (Italy); Greuner, H.; Böswirth, B. [Max-Planck-Institut für Plasmaphysik, D-85748 Garching bei München (Germany)

    2014-02-15

    Operation of the thermonuclear fusion experiment ITER requires additional heating via injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction in Padova, the production of negative ions will be studied and optimised. STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) is a diagnostic used to characterise the SPIDER beam during short pulse operation (several seconds) to verify if the beam meets the ITER requirements about the maximum allowed beam non-uniformity (below ±10%). The major components of STRIKE are 16 1D-CFC (Carbon-Carbon Fibre Composite) tiles, observed at the rear side by a thermal camera. This contribution gives an overview of some tests under high energy particle flux, aimed at verifying the thermo-mechanical behaviour of several CFC prototype tiles. The tests were performed in the GLADIS facility at IPP (Max-Plank-Institut für Plasmaphysik), Garching. Dedicated linear and nonlinear simulations were carried out to interpret the experiments and a comparison of the experimental data with the simulation results is presented. The results of some morphological and structural studies on the material after exposure to the GLADIS beam are also given.

  2. High energy flux thermo-mechanical test of 1D-carbon-carbon fibre composite prototypes for the SPIDER diagnostic calorimeter.

    Science.gov (United States)

    De Muri, M; Cavallin, T; Pasqualotto, R; Dalla Palma, M; Cervaro, V; Fasolo, D; Franchin, L; Tollin, M; Greuner, H; Böswirth, B; Serianni, G

    2014-02-01

    Operation of the thermonuclear fusion experiment ITER requires additional heating via injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction in Padova, the production of negative ions will be studied and optimised. STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) is a diagnostic used to characterise the SPIDER beam during short pulse operation (several seconds) to verify if the beam meets the ITER requirements about the maximum allowed beam non-uniformity (below ±10%). The major components of STRIKE are 16 1D-CFC (Carbon-Carbon Fibre Composite) tiles, observed at the rear side by a thermal camera. This contribution gives an overview of some tests under high energy particle flux, aimed at verifying the thermo-mechanical behaviour of several CFC prototype tiles. The tests were performed in the GLADIS facility at IPP (Max-Plank-Institut für Plasmaphysik), Garching. Dedicated linear and nonlinear simulations were carried out to interpret the experiments and a comparison of the experimental data with the simulation results is presented. The results of some morphological and structural studies on the material after exposure to the GLADIS beam are also given.

  3. Methods of Boron-carbon Deposited Film Removal

    Science.gov (United States)

    Airapetov, A.; Terentiev, V.; Voituk, A.; Zakharov, A.

    Boron carbide was proposed as a material for in-situ renewable protecting coating for tungsten tiles of the ITER divertor. It is necessary to develop a method of gasification of boron-carbon film which deposits during B4C sputtering. In this paper the results of the first stage investigation of gasification methods of boron-carbon films are presented. Two gasification methods of films are investigated: interaction with the ozone-oxygen mixture and irradiation in plasma with the working gas composed of oxygen, ethanol, and, in some cases, helium. The gasification rate in the ozone-oxygen mixture at 250 °C for B/C films with different B/C ratio and carbon fiber composite (CFC), was measured. For B/C films the gasification rate decreased with increasing B/C ratio (from 45 nm/h at B/C=0.7 to 4 nm/h at B/C=2.1; for CFC - 15 μm/h). Films gasification rates were measured under ion irradiation from ethanol-oxygen-helium plasma at different temperatures, with different ion energies and different gas mixtures. The maximum obtained removal rate was near 230 nm/h in case of ethanol-oxygen plasma and at 150°C of the sample temperature.

  4. Carbon dioxide, hydrographic, and chemical data obtained in the South Pacific Ocean (WOCE Sections P16A/P17A, P17E/P19S, and P19C, R/V Knorr, October 1992--April 1993)

    Energy Technology Data Exchange (ETDEWEB)

    Rubin, S.; Goddard, J.G.; Chipman, D.W.; Takahashi, Taro; Sutherland, S.C. [Columbia Univ., Palisades, NY (United States). Lamont-Doherty Earth Observatory; Reid, J.L.; Swift, J.H.; Talley, L.D. [Univ. of California, San Diego, La Jolla, CA (United States). Scripps Institution of Oceanography

    1998-06-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide concentration (TCO{sub 2}) and partial pressure of CO{sub 2} (pCO{sub 2}) in discrete water samples collected during three expeditions of the Research Vessel (R/V) Knorr in the South Pacific Ocean. Conducted as part of the World Ocean Circulation Experiment (WOCE), the first cruise (WOCE Section P16A/P17A) began in Papeete, Tahiti, French Polynesia, on October 6, 1992, and returned to Papeete on November 25, 1992. The second cruise (WOCE Section P17E/P19S) began in Papeete on December 4, 1992, and finished in Punta Arenas, Chile, on January 22, 1993. The third expedition (WOCE Section P19C) started in Punta Arenas, on February 22 and finished in Panama City, Panama, on April 13, 1993. During the three expeditions, 422 hydrographic stations were occupied. Hydrographic and chemical measurements made along WOCE Sections P16A/P17A, P17E/P19S, and P19C included pressure, temperature, salinity, and oxygen [measured by conductivity, temperature, and depth (CTD) sensor], as well as discrete measurements of salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO{sub 2}, and pCO{sub 2} measured at 4 and 20 C. In addition, potential temperatures were calculated from the measured variables.

  5. Comparison of age distributions estimated from environmental tracers by using binary-dilution and numerical models of fractured and folded karst: Shenandoah Valley of Virginia and West Virginia, USA

    Science.gov (United States)

    Yager, Richard M.; Plummer, L. Niel; Kauffman, Leon J.; Doctor, Daniel H.; Nelms, David L.; Schlosser, Peter

    2013-01-01

    Measured concentrations of environmental tracers in spring discharge from a karst aquifer in the Shenandoah Valley, USA, were used to refine a numerical groundwater flow model. The karst aquifer is folded and faulted carbonate bedrock dominated by diffuse flow along fractures. The numerical model represented bedrock structure and discrete features (fault zones and springs). Concentrations of 3H, 3He, 4He, and CFC-113 in spring discharge were interpreted as binary dilutions of young (0–8 years) water and old (tracer-free) water. Simulated mixtures of groundwater are derived from young water flowing along shallow paths, with the addition of old water flowing along deeper paths through the model domain that discharge to springs along fault zones. The simulated median age of young water discharged from springs (5.7 years) is slightly older than the median age estimated from 3H/3He data (4.4 years). The numerical model predicted a fraction of old water in spring discharge (0.07) that was half that determined by the binary-dilution model using the 3H/3He apparent age and 3H and CFC-113 data (0.14). This difference suggests that faults and lineaments are more numerous or extensive than those mapped and included in the numerical model.

  6. Étude par la méthode de Monte Carlo de la phase plastique de la quinuclidine à différentes températures

    Science.gov (United States)

    Jumeau, Daniel; André, Daniel

    La phase plastique (c.f.c.) de la quinuclidine est étudiée à différentes températures par la méthode de Monte Carlo utilisant la technique des matrices de compatibilité. Afin de ne pas modifier la symétrie moyenne du réseau, les centres de masse de molécules sont supposés fixes. Les orientations moléculaires sont choisies de façon aléatoire parmi les 48 orientations équivalentes et discernables du groupe c.f.c. Cela permet une mémorisation préalable des énergies d'interaction entre molécules voisines et un gain de temps de calcul considérable. Nous observons alors un blocage des réorientations moléculaires à basse température, tandis que la symétrie cristalline devient monoclinique. Ceci est interprété en termes de transition de phase dont la température (215 K) et la variation d'énergie (5 kJ mol-1) sont très proches des valeurs expérimentales.

  7. Neutron computed tomography of plasma facing components for fusion experiments

    International Nuclear Information System (INIS)

    In nuclear fusion experiments, divertor plates are used to remove energy and particles from the plasma. These divertor plates can be made of water-cooled copper heat sinks covered by carbon fiber composite (CFC) protection tiles. During operation, surface temperatures in excess of 1000 oC are reached for typical heat loads of 10 MW/m2. The large mismatch in the coefficients of thermal expansion for CFC and Cu causes high stresses and possibly bonding defects. Growing joint defects, which lead to unacceptable overheating of the protection tiles, are critical for the lifetime of the components. A prototype component was subjected to 10,000 cycles at 10 MW/m2 to study the crack growth mechanism. Neutron computed tomography offers the possibility to analyze such structures on centimeter-sized samples non-destructively with a high spatial resolution. At the ANTARES neutron imaging facility of the FRM II reactor, the samples were loaded with a contrast agent and examined with neutron computed tomography.

  8. Effect of hemopoietic microenvironment on splenic suppressor macrophages in congenitally anemic mice of genotype S1/sup d/

    Energy Technology Data Exchange (ETDEWEB)

    1985-01-01

    Mechanisms underlying mononuclear phagocyte specialization are being probed by studying suppressor macrophages as a reference population in mouse models with impaired blood monocyte formation. Splenic suppressor macrophages, defined by PGE-mediated inhibition of Con A-induced T lymphocyte proliferation are induced by the i.p. administration of Corynebacterium parvum (CP). Mice severely depleted of bone marrow and blood monocytes by treatment with /sup 89/Sr fail to show this suppressor macrophages response to CP, although macrophages-forming stem cells, assessed as splenic M-CFC in vitro, are increased 20-fold. These observations suggest that radiosensitive bone marrow stem cells are necessary for the generation of both suppressor macrophages and monocytes and that one such stem cell may be common to both types of mononuclear phagocytes. This notion was explored further by employing congenitally anemic mice of the genotype S1/S1 superscript d in which the hemopoietic microenvironment is genetically defective and thus unable to support the proliferation, differentiation, and function of stem cells. The congenital defect was found to be additionally expressed in the S1/S1/sup d/ mouse by a monocytopenia of less than 10% of the values in normal congenic littermate controls and by the failure of splenic M-CFC to increase in response to cp. PGE-producing suppressor macrophages expressing Fcy2b receptors, however, were induced by CP in S1/S1/sup d/ mice with no significant diminution of suppressor activity.

  9. [Source emission characteristics and impact factors of volatile halogenated organic compounds from wastewater treatment plant].

    Science.gov (United States)

    He, Jie; Wang, Bo-Guang; Liu, Shu-Le; Zhao, De-Jun; Tang, Xiao-Dong; Zou, Yu

    2011-12-01

    A low enrichment method of using Tenax as absorbent and liquid nitrogen as refrigerant has been established to sample the volatile halogenated organic compounds in Guangzhou Liede municipal wastewater treatment plant as well as its ambient air. The composition and concentration of target halogenated hydrocarbons were analyzed by combined thermal desorption/GC-MS to explore its sources profile and impact factors. The result showed that 19 halogenated organic compounds were detected, including 11 halogenated alkanets, 3 halogenated alkenes, 3 halogenated aromatic hydrocarbons and 2 haloesters, with their total concentrations ranged from 34.91 microg x m(-3) to 127.74 microg x m(-3) and mean concentrations ranged from n.d. to 33.39 microg x m(-3). Main pollutants of the studied plant were CH2Cl2, CHCl3, CFC-12, C2H4Cl2, CFC-11, C2HCl3 and C2Cl4, they came from the wastewater by volatilization. Among the six processing units, the dehydration room showed the highest level of halogenated organic compounds, followed by pumping station, while the sludge thickener was the lowest. The emissions from pumping station, aeration tank and biochemical pool were significantly affected by temperature and humidity of environment. PMID:22468521

  10. Anti-Avoidance Rules di Indonesia Pasca Amandemen UU Pajak Penghasilan

    Directory of Open Access Journals (Sweden)

    Adrianto Dwi Nugroho

    2012-02-01

    Full Text Available The fourth amendment to the Indonesian Income Tax Act (UU PPh has inserted three new provisions encountering three newly-identified tax avoidance schemes. However, the previous regulations in respect of thin capitalization, CFC and interest stripping were not carefully be given attention and be made in conformity with their newest developments. As an illustration, the term “company” has never been defined in the Act. Instead, the Act introduces the same term in the conduit company rules. Another example involves the CFC rule which does not put additional provisions to define “control”. Another interesting development is the regulation of the International-hiring out of labor which instead of making it in conformity with the OECD MC, the rule empowers the country to increase the taxable income of an employee in respect of employment excercised abroad. This article attempts to demonstrate how the Indonesian anti-avoidance rules work out and prove how taxpayers may well, ironically, abuse those rules.

  11. Drawing from memory in focal epilepsy: a cognitive and neural perspective.

    Science.gov (United States)

    Giovagnoli, Anna R; Bell, Brian

    2011-03-01

    This study provides evidence of non-verbal cognitive functioning in temporal (TLE) and frontal lobe epilepsy (FLE) patients by exploring the mechanisms and neural correlates of drawing abilities. Sixty-six patients with left (n=32) or right TLE (n=34), 30 patients with left (n=18) or right FLE (n=12), and 30 healthy subjects were compared. The Drawing from Memory (DfM) test required participants to design 16 living or non-living items; the total score was the sum of all scores blindly provided by three judges who had to identify the drawings. The verbal and visual Pyramid and Palm Trees Test (PPTT), Raven Colored Progressive Matrices (Raven CPM), Cube Analysis, Token Test, Word Fluency, Card Classification, and Rey Complex Figure Test Copy trial (Rey CFC) assessed different verbal and non-verbal functions. Non-parametric statistics indicated that, with respect to controls, both TLE groups and the left FLE patients had significantly lower DfM scores. In the TLE group, hierarchical regression analyses revealed that the DfM score was predicted by the Raven CPM and PPTT scores, while, in the FLE group, it was predicted by the Rey CFC. Thus, drawing abilities may be impaired by TLE or FLE owing to different mechanisms that involve semantic or executive abilities. Implying cooperation between temporal and frontal areas that support these functions, DfM may be a sensitive index of integrity of cortical areas or neural pathways damaged by focal epilepsy. PMID:21324651

  12. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Knorr Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Sections A20_2003 (22 September-20 October 2003) and A22_2003 (23 October-13 November, 2003)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2008-09-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb carbon-14 system parameters performed during the A20_2003 and A22_2003 cruises, which took place between September 22 and November 13, 2003, aboard research vessel (R/V) Knorr under the auspices of the National Oceanic and Atmospheric Administration (NOAA) and National Science Foundation (NSF). The R/V Knorr departed Woods Hole, Massachusetts, on September 22 for the Repeat Section A20, and ended this line in Port of Spain, Trinidad, on October 20. The Repeat Section A22 started on October 23 in Port of Spain, Trinidad, and finished on November 13, 2003, in Woods Hole, Massachusetts. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and NSF as part of the Climate Variability Program (CLIVAR)/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 88 stations on section A20 and 82 stations on section A22. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), total alkalinity (TALK), dissolved organic carbon (DOC), CFC, carbon-14, hydrographic, and other chemical measurements.

  13. Carbon dioxide, hydrographic, and chemical data obtained during the Thomas Washington Cruise TUNES-3 in the equatorial Pacific Ocean (WOCE Section P16C)

    Energy Technology Data Exchange (ETDEWEB)

    Goyet, C. [Woods Hole Oceanographic Institution, MA (United States); Guenther, P.R.; Keeling, C.D.; Talley, L.D. [Scripps Institution of Oceanography, La Jolla, CA (United States); Kozyr, A. [Oak Ridge National Lab., TN (United States). Carbon Dioxide Information Analysis Center

    1996-12-01

    This data documentation discusses the procedures and methods used to obtain total carbon dioxide (TCO{sub 2}), total alkalinity (TALK), hydrographic, and chemical data during the Research Vessel Thomas Washington Expedition TUNES-3 in the Equatorial Pacific Ocean (Section P16C). Conducted as a part of the World Ocean Circulation Experiment (WOCE), the cruise began in Papeete, Tahiti, on August 31, 1991, and finished in Honolulu, Hawaii, on October 1, 1991. WOCE Meridional Section P16C along 150{degree}W and between 18{degree}S and 19{degree}N was completed during the 31-day expedition. All 105 hydrographic and 8 large-volume stations were completed to the full water column depth. Station spacing was 30 nautical miles (nm), except between 3{degree}N and 3{degree}S where it was 10 nm. Twenty-five bio-optics stations were sampled for the Joint Global Ocean Flux Study, and at 21 stations carbon dioxide measurements were provided for the US Department of Energy`s CO{sub 2} program. Hydrographic and chemical measurements made along WOCE Section P16C included pressure, temperature, salinity, and oxygen measured by conductivity, temperature, and depth sensor; and bottle salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbon (CFC)-11, CFC-12, TCO{sub 2}, and TALK. In addition, potential temperatures were calculated from the measured variables.

  14. Carbon dioxide, hydrographic, and chemical data obtained during the R/V Thomas Washington TUNES-1 in the equatorial Pacific Ocean (WOCE Section P17C)

    Energy Technology Data Exchange (ETDEWEB)

    Goyet, C. [Woods Hole Oceanographic Institution, MA (United States); Key, R.M. [Princeton Univ., NJ (United States); Sullivan, K.F. [Univ. of Miami, FL (United States). Rosensteil School of Marine and Atmospheric Sciences; Tsuchiya, M. [Univ. of California, San Diego, CA (United States). Scripps Institution of Oceanography; Kozyr, A. [Oak Ridge National Lab., TN (United States). Carbon Dioxide Information Analysis Center]|[Univ. of Tennessee, Knoxville, TN (United States). Energy, Environment, and Resources Center

    1997-06-01

    This report discusses the procedures and methods used to obtain measurements of total carbon dioxide (TCO{sub 2}), total alkalinity (TALK), and radiocarbon ({Delta} {sup 14}C), as well as hydrographic and chemical data, during the Research Vessel Thomas Washington Expedition TUNES-1 in the Equatorial Pacific Ocean (Section P17C). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in San Diego, California, on May 31, 1991, and ended in Papeete, Tahiti, on July 11, 1991. WOCE Meridional Section P17C, along 135{degree}W and between {approximately}5{degree}S and 36{degree}N, was completed during the 42-day expedition. All 123 hydrographic stations (including 9 large-volume stations) were completed to the full water-column depth. Spacing between stations was 30 nautical miles, except between 3{degree}N and 3{degree}S, where it was 10 nautical miles. At 30 stations, CO{sub 2} measurements were provided for the US Department of Energy`s Carbon Dioxide Program. Hydrographic and chemical measurements made along WOCE Section P17C included pressure, temperature, salinity, and oxygen (measured by conductivity, temperature, and depth sensor), as well as bottle measurements of salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbon (CFC)-11, CFC-12, {Delta} {sup 14}C, TCO{sub 2}, and TALK. In addition, potential temperatures were calculated from the measured variables.

  15. Report of the results of the fiscal 1997 regional consortium R and D project. Regional consortium energy field / Development of an environmentally friendly industrial cleaning system using near-critical and supercritical carbon dioxide (first fiscal year); 1997 nendo chiiki consortium kenkyu kaihatsu jigyo. Chiiki consortium energy bun`ya / chorinkai ryutai wo mochiita kankyo chowagata kogyo senjo sochi no kaihatsu (daiichi nendo) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    In the manufacturing process of semiconductors and in the high tech industry, cleaning is indispensable. At present, when regulation of the use of CFC which used to be much used has been decided on, the conversion to the use of substitutes for CFC cleaning is urgently needed. Transfer to cleaning by water/alcohol/hydrocarbon has been proceeded with, but there are a lot of problems. Out of the development of the cleaning method using supercritical fluid, the paper described the fiscal 1997 result. As to enhancement of efficiency and decrease in size of equipment, a cleaning experiment by high pressure CO2 around the critical point was conducted by integrating nozzle, ultrasonic generator and cavitation generator and adding solvent circulating system. Multi-purpose and energy saving of the equipment were also studied. To establish an analysis method for the cleaning degree, the contaminated component film of trace organic matter with a specified thickness was formed on the silicon wafer, and using the Fourier transform ultrared spectroscopy, a method to determine the film thickness was studied. For the function evaluation for precision machine parts and determination of optimum cleaning conditions, the cleaning/degreasing process of valves were compared with the conventional method. For the product manufacturing, the paper investigated and prepared the data in Japan and from abroad. 55 refs., 79 figs., 18 tabs.

  16. Infrared imaging diagnostics for INTF ion beam

    Science.gov (United States)

    Sudhir, D.; Bandyopadhyay, M.; Pandey, R.; Joshi, J.; Yadav, A.; Rotti, C.; Bhuyan, M.; Bansal, G.; Soni, J.; Tyagi, H.; Pandya, K.; Chakraborty, A.

    2015-04-01

    In India, testing facility named INTF [1] (Indian test facility) is being built in Institute for Plasma Research to characterize ITER-Diagnostic Neutral Beam (DNB). INTF is expected to deliver 60A negative hydrogen ion beam current of energy 100keV. The beam will be operated with 5Hz modulation having 3s ON/20s OFF duty cycle. To characterize the beam parameters several diagnostics are at different stages of design and development. One of them will be a beam dump, made of carbon fiber composite (CFC) plates placed perpendicular to the beam direction at a distance lm approximately. The beam dump needs to handle ˜ 6MW of beam power with peak power density ˜ 38.5MW/m2. The diagnostic is based on thermal (infra-red - IR) imaging of the footprint of the 1280 beamlets falling on the beam dump using four IR cameras from the rear side of the dump. The beam dump will be able to measure beam uniformity, beamlet divergence. It may give information on relative variation of negative ion stripping losses for different beam pulses. The design of this CFC based beam dump needs to address several physics and engineering issues, including some specific inputs from manufacturers. The manuscript will describe an overview of the diagnostic system and its design methodology highlighting those issues and the present status of its development.

  17. Graphene-coated carbon fiber cloth for flexible electrodes of glucose fuel cells

    Science.gov (United States)

    Hoshi, Kazuki; Muramatsu, Kazuo; Sumi, Hisato; Nishioka, Yasushiro

    2016-02-01

    In this work, we fabricated flexible electrodes for a miniaturized, simple structured, and flexible glucose biofuel cell (BFC) using a graphene-coated carbon fiber cloth (GCFC). The areas of the anode and cathode electrodes were 3 × 10 mm2. The anode area was coated with the enzyme glucose oxidase, and the cathode area was coated with the enzyme bilirubin oxidase. No ion-exchange film was needed because glucose oxidase selectively oxidizes glucose and bilirubin oxidase selectively reduces oxygen. The power density of the BFC with GCFC electrodes in a phosphate buffer solution of 200 mM glucose solution at room temperature was 34.3 µW/cm2 at 0.43 V. The power density of a BFC using carbon fiber cloth (CFC) without graphene modification was 18.5 µW/cm2 at 0.13 V. The BFC with the GCFC electrode continued to function longer than 24 h with a power density higher than 5 µW/cm2. These effects were attributed to the much larger effective surface areas of the GCFC electrodes that maintain more enzymes than those of the CFC electrodes.

  18. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Ronald H. Brown Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Section A16S_2005 (11 January - 24 February, 2005)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2006-08-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb 14C system parameters performed during the A16S_2005 cruise, which took place from January 11 to February 24, 2005, aboard research vessel (R/V) Ronald H. Brown under the auspices of the National Oceanic and Atmospheric Administration (NOAA). The R/V Ronald H. Brown departed Punta Arenas, Chile, on January 11, 2005, and ended its cruise in Fortaleza, Brazil, on February 24, 2005. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and the National Science Foundation as part of the CLIVAR/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 121 stations. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), fugacity of CO2 (fCO2), total alkalinity (TALK), pH, dissolved organic carbon (DOC), CFC, 14C, hydrographic, and other chemical measurements. The R/V Ronald H. Brown A16S_2005 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of the oceanographic data files and this printed documentation, which describes the procedures and methods used to obtain the data.

  19. Comparison of filters for concentrating microbial indicators and pathogens in lake-water samples

    Science.gov (United States)

    Francy, Donna S.; Stelzer, Erin A.; Brady, Amie M.G.; Huitger, Carrie; Bushon, Rebecca N.; Ip, Hon S.; Ware, Michael W.; Villegas, Eric N.; Gallardo, Vincent; Lindquist, H.D. Alan

    2013-01-01

    Bacterial indicators are used to indicate increased health risk from pathogens and to make beach closure and advisory decisions; however, beaches are seldom monitored for the pathogens themselves. Studies of sources and types of pathogens at beaches are needed to improve estimates of swimming-associated health risks. It would be advantageous and cost-effective, especially for studies conducted on a regional scale, to use a method that can simultaneously filter and concentrate all classes of pathogens from the large volumes of water needed to detect pathogens. In seven recovery experiments, stock cultures of viruses and protozoa were seeded into 10-liter lake water samples, and concentrations of naturally occurring bacterial indicators were used to determine recoveries. For the five filtration methods tested, the highest median recoveries were as follows: glass wool for adenovirus (4.7%); NanoCeram for enterovirus (14.5%) and MS2 coliphage (84%); continuous-flow centrifugation (CFC) plus Virocap (CFC+ViroCap) for Escherichia coli (68.3%) and Cryptosporidium (54%); automatic ultrafiltration (UF) for norovirus GII (2.4%); and dead-end UF for Enterococcus faecalis (80.5%), avian influenza virus (0.02%), and Giardia (57%). In evaluating filter performance in terms of both recovery and variability, the automatic UF resulted in the highest recovery while maintaining low variability for all nine microorganisms. The automatic UF was used to demonstrate that filtration can be scaled up to field deployment and the collection of 200-liter lake water samples.

  20. Development of W coatings for fusion applications

    Energy Technology Data Exchange (ETDEWEB)

    Ruset, C., E-mail: ruset@infim.ro [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); National Institute for Laser, Plasma and Radiation Physics, Euratom-MEdC Association, Bucharest (Romania); Grigore, E. [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); National Institute for Laser, Plasma and Radiation Physics, Euratom-MEdC Association, Bucharest (Romania); Maier, H.; Neu, R.; Greuner, H.; Mayer, M. [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Max-Plank Institut fuer Plasma Physik, Euratom Association, 85748 Garching (Germany); Matthews, G. [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Culham Centre for Fusion Energy, Euratom Association, Abingdon (United Kingdom)

    2011-10-15

    The paper gives a short overview on tungsten (W) coatings deposited by various methods on carbon materials (carbon fibre composite - CFC and fine grain graphite - FGG). Vacuum Plasma Spray (VPS), Chemical Vapor Deposition (CVD) and Physical Vapor Deposition (PVD) techniques are analyzed in respect with the characteristics and performances of the W coatings. A particular attention is paid to the Combined Magnetron Sputtering and Ion Implantation (CMSII) technique, which was developed during the last 4 years from laboratory to industrial scale and it is successfully applied for W coating (10-15 {mu}m and 20-25 {mu}m) of more than 2500 tiles for the ITER-like Wall project at JET and ASDEX Upgrade. This technique involves simultaneously magnetron sputtering and high energy (tens of keV) ion implantation. Due to the ion bombardment a stress relief occurs within the coating enabling its growth without delamination to a relatively large thickness. In addition, in order to adjust the thermal expansion mismatch between CFC and W, a Mo interlayer of 2-3 {mu}m is currently used. Experimentally, W/Mo coatings with a thickness up to 50 {mu}m were produced and successfully tested in the GLADIS ion beam facility up to 23 MW/m{sup 2}.

  1. Infrared thermography inspection for monoblock divertor target in JT-60SA

    International Nuclear Information System (INIS)

    Highlights: • Infrared thermography inspection is modified to inspect JT-60SA divertor targets. • Infrared thermography inspection is effective to detect joining defects of targets. • Numerical analysis is in good agreement with inspection results of mock-up targets. • Database for setting screening criteria has been constructed by numerical analysis. - Abstract: Carbon fiber composite (CFC) monoblock divertor target is required for power handling in JT-60SA. Quality of the targets depends on a joining technology in manufacturing process. To inspect the quality of more than 900 target pieces, efficient non-destructive inspection is needed. An infrared thermography inspection (IR inspection), has been proposed by ITER and IRFM, where the quality between CFC and a cooling tube is examined by a use of transient thermal response at a rapid switch from hot to cold water flow. In JT-60SA divertor target, a screw tube will be employed to obtain high heat transfer efficiency with simple structure. Since the time response of the screw tube is much faster than that of smooth tube, it is required to confirm the feasibility of this IR inspection. Thus, the effect of joining defects on transient thermal response of the targets has been investigated experimentally by using the mock-up targets containing defects which are artificially made. It was found that the IR inspection can detect the defects. Moreover, screening criteria of IR inspection for acceptable monoblock target is discussed

  2. Comparison the physicochemical properties of bunch press fibre cellulose and cyclone fibre cellulose of waste from industry Crude Palm Oil (CPO

    Directory of Open Access Journals (Sweden)

    Irfan Gustian

    2013-10-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE Study on comparison the physicochemical properties of bunch press fibre cellulose (Bpfc and cyclone fibre cellulose (Cfc wastes from industry Crude Palm oil (CPO have been performed. The physicochemical properties both of celluloses have been done such as the average degree of polymerization (DP, solubility properties, functional group analysis, thermal properties and X-ray diffraction patterns. The average degrees of polymerization (DP have been obtained 2195 and 567 for Bpfc and Cfc. Bunch press fibre cellulose and cyclone fibre cellulose were soluble in cupriethylenediamine (CED. FT-IR analysis showed the same pattern of spectrum but different intensities. Thermal stability of bunch press fibre cellulose and cyclone fibre cellulose remains stable up to a temperature of 250 °C. Glass transition bunch press fibre cellulose greater than the glass transition cyclone fibre cellulose and X-ray diffraction pattern shows the same pattern and intensity varies.

  3. A new design of groundwater sampling device and its application

    Institute of Scientific and Technical Information of China (English)

    Yih-Jin Tsai; Ming-Ching T.Kuo

    2005-01-01

    Compounds in the atmosphere contaminate samples of groundwater. An inexpensive and simple method for collecting groundwater samples is developed to prevent contamination when the background concentration of contaminants is high. This new design of groundwater sampling device involves a glass sampling bottle with a Teflon-lined valve at each end. A cleaned and dried sampling bottle was connected to a low flow-rate peristaltic pump with Teflon tubing and was filled with water. No headspace volume was remained in the sampling bottle. The sample bottle was then packed in a PVC bag to prevent the target component from infiltrating into the water sample through the valves. In this study, groundwater was sampled at six wells using both the conventional method and the improved method.The analysis of trichlorofluoromethane(CFC-11 ) concentrations at these six wells indicates that all the groundwater samples obtained by the conventional sampling method were contaminated by CFC-11 from the atmosphere. The improved sampling method greatly eliminated theproblems of contamination, preservation and quantitative analysis of natural water.

  4. Age dating ground water by use of chlorofluorocarbons (CCl3F and CCl2F2), and distribution of chlorofluorocarbons in the unsaturated zone, Snake River Plain aquifer, Idaho National Engineering Laboratory, Idaho

    International Nuclear Information System (INIS)

    Detectable concentrations of chlorofluorocarbons (CFC's) were observed in ground water and unsaturated-zone air at the Idaho National Engineering Laboratory (INEL) and vicinity. The recharge ages of waters were determined to be from 4 to more than 50 years on the basis of CFC concentrations and other environmental data; most ground waters have ages of 14 to 30 years. These results indicate that young ground water was added at various locations to the older regional ground water (greater than 50 years) within and outside the INEL boundaries. The wells drilled into the Snake River Plain aquifer at INEL sampled mainly this local recharge. The Big Lost River, Birch Creek, the Little Lost River, and the Mud Lake-Terreton area appear to be major sources of recharge of the Snake River Plain aquifer at INEL. An average recharge temperature of 9.7±1.3 degrees C (degrees Celsius) was calculated from dissolved nitrogen and argon concentrations in the ground waters, a temperature that is similar to the mean annual soil temperature of 9 degrees C measured at INEL. This similarity indicates that the aquifer was recharged at INEL and not at higher elevations that would have cooler soil temperatures than INEL. Soil-gas concentrations at Test Area North (TAN) are explained by diffusion theory

  5. [Experimental studies on the recovery of anesthetic gases].

    Science.gov (United States)

    Marx, T; Gross-Alltag, F; Ermisch, J; Hähnel, J; Weber, L; Friesdorf, W

    1992-02-01

    The volatile anesthetic agents halothane, enflurane, and isoflurane are chlorofluorocarbons (CFC) and contribute to ozone depletion. Although the contribution is small, its importance is rising, as technical CFCs will be phased out according to the Montreal protocol (1987) and the London conference (1990) by the year 2000. Alternative procedures and CFC-free volatile agents such as des- and sevoflurane do not contribute to depletion of the ozone layer, but will not replace standard methods using volatile anesthetic agents in the near future. METHODS. In an experimental setup, we filtered anesthetic waste gases from scavenging systems of rebreathing circles by activated carbon filters. The filtered substances were desorbed by a heat chamber and condensed in a cold trap. RESULTS. By this method, it was possible to retrieve 50%-60% of the applied gases. Gas chromatographic analysis showed halothane containing traces of pollutants and isoflurane and enflurane as pure substances. DISCUSSION. The retrieval of anesthetic waste gases is easy; no sophisticated technical equipment is necessary. Purity of substances could make recycling possible and offer a method to avoid environmental pollution by volatile anesthetics. PMID:1562100

  6. Environmental tradeoffs between CFCs and alternative refrigerants

    International Nuclear Information System (INIS)

    In 1987, an international group of scientists and government officials established the Montreal Protocol, an agreement to control the use and release of chlorofluorocarbons (CFCs), and to schedule a timeline for eliminating their production. This agreement is a historic step in the ongoing process of building consensus regarding environmental impacts of CFCs. This paper reports on the Montreal Protocol and provisions of the 1990 Clean Air Act which specify schedules for phasing out CFC production. For either schedule, all CFCs are to be eliminated from production by the year 2000. In addition, the hydrochlorofluorocarbons (HCFCs) are likely to face similar restrictions, but probably not for another 25 years. An aggressive tax on CFCs accompanies the phase-out schedule. This tax applies to existing supplier floorstock as well as new production. The results of taxes and regulations are that CFCs users must pay a premium price and may face availability problems. The users of CFC-based air conditioning and refrigeration equipment will have to consider their options and, eventually, will have to install alternative refrigerants or systems

  7. Ammonia-a refrigerant in the past and present, more and more in the future

    International Nuclear Information System (INIS)

    The harmful influence on the global climate of CFCs (R11, R12, R502) and HCFCs (R22) refrigerants causes the depletion of the stratospheric ozone and the greenhouse effect. The international activity for the phase-out of the ozone depletion substances (ODSS) is the Montreal Protocol. The alternative refrigerants on the market are natural working fluids: ammonia, hydrocarbons (HCs), carbon dioxide, water and air. HFCs are for some applications the alternatives for CFC/HCFCs and have no ozone depletion (ODP=O), but the HFCs are greenhouse gases and have GWP and are regulated in the Kyoto Protocol. Ammonia has been in use for more than 125 years. The advantages of ammonia are excellent thermodynamic and heat transport properties, but ammonia is regarded as toxic and flammable. The ammonia refrigerating systems are liable under codes and standards, which shall be followed. With better knowledge and understanding, good practice and right comprehension of people involved in ammonia refrigeration, this refrigerant is a winner. There are many research projects and activities in order to widen the use of ammonia in the applications where CFC/HCFCs were used in the past. Regarding to this trend, it is a paradoxical situation in Macedonia and other developing countries where ammonia systems of cold stores, diaries, breweries and food processing go out of use. (Author)

  8. CERN apprenticeship scheme honoured

    CERN Multimedia

    2008-01-01

    Prestigious awards for two apprentices who did their practical training at CERN. Sylvain Heinzen, apprentice physics lab technician at CERN, receiving his award from Pierre-François UNGER, State Councillor responsible for the Federal Department of the Economy and Health. The other award-winner, Cédric Gerber, is on the right of the photo.Among Geneva’s top apprentices who were honoured by the Fondation sociale de l’Union industrielle genevoise (UIG) on 28 October this year, were two CERN apprentices. Electronics technician Cédric Gerber and physics lab technician Sylvain Heinzen both did their four-year sandwich course at CERN, obtaining their professional qualification, the Certificat fédéral de capacité (CFC), in June. On top of that, Cédric Gerber, who had been a particularly outstanding apprentice, received two further distinctions at the CFC awards ceremony - the State Council prize for achieving one of the top-ten o...

  9. Building Child Friendly Cities in the MENA region

    Science.gov (United States)

    Nour, Osman El Hassan M.

    2013-09-01

    The notion of Child Friendly Cities (CFCs) was first developed during the Second United Nations Conference on Human Settlements (HABITAT II), held in Istanbul in 1996. The concept is based on four general principles of the United Nations Convention on the rights of the child: (1) fair treatment of every child, regardless of ethnicity, gender, religion, socioeconomic background etc.; (2) top priority of the best interests of the child; (3) the child's right to a better life and development; and (4) respect of children's views. In a CFC, children are encouraged to take part in the decision making processes that affect their lives. Instead of starting yet another programme for children, the development of a CFC mobilises and connects existing agencies and actors. Giving examples of some cities in the Middle East and North Africa (MENA) region, this paper demonstrates that building CFCs has induced the development of mechanisms and structures which have enabled cities to address children's issues in a systematic manner. These mechanisms and structures include: a municipal child-friendly legal framework, local development councils and NGO networks and local municipal development offices. The author argues that in building CFCs, the role of municipal authorities is indispensable in responding to the needs of children and young people within the municipalities' mandates.

  10. UV-VIS Spectroscopy Applied to Stratospheric Chemistry, Methods and Results

    Energy Technology Data Exchange (ETDEWEB)

    Karlsen, K.

    1996-03-01

    This paper was read at the workshop ``The Norwegian Climate and Ozone Research Programme`` held on 11-12 March 1996. Numerous observations and modeling have shown with a very high degree of certainty that the man-made emissions of chlorofluorocarbons (CFC) and halons are responsible for the Antarctica ozone hole. It is also evident that the ozone layer of the Northern Hemisphere has suffered a certain decline over the last 10-15 years, possibly because of CFC and halons. 20-30% of the observed reduction is ascribed to coupled chlorine and bromine chemistry via a catalytic cycle resulting in the net conversion of 2O{sub 3} to 3O{sub 2}. But the details are not fully understood. The author plans to assemble a UV-VIS spectrometer for measuring the species OClO and BrO and to compare and discuss measured diurnal variations of OClO and BrO with model calculations. The use of Differential Optical Absorption Spectroscopy (DOAS) is discussed and some results from late 1995 presented. 6 refs., 2 figs.

  11. Combined steady state and high cycle transient heat load simulation with the electron beam facility JUDITH 2

    International Nuclear Information System (INIS)

    The increasing world energy needs lead to strong efforts in today's energy R and D trying to open up new energy resources. One possible option to access energy in large scale power plants is to use the process of nuclear fusion to generate heat and, from that, electricity with conventional steam turbine technology. However, the realisation is technologically and scientifically very challenging. The heat fluxes that load the inner walls of a fusion device, especially the most severely loaded part, the divertor, are one of the issues currently being under investigation. A distinction is made between steady state heat loads (SSHLs) that are continuously active during operation and transient heat loads (THLs) that are superimposed short-time events. The potentially most harmful THLs during normal operation are type I Edge Localised Modes (ELMs). They are estimated to have a power density of 1 - 10 GWm-2 for 0.2 - 0.5 ms duration in the upcoming next step fusion experiment ITER. Because of high pulse repetition frequency more than 106 ELM events are expected during the foreseen lifetime of divertor components. However, only data regarding behaviour of materials for a low number of pulses (typically 100 - 1000) exists. This work describes the development of a procedure to simulate THLs at high repetition frequency using an electron beam facility and the tests done on tungsten and carbon-based (carbon fibre composite, CFC) plasma facing materials. The developed procedure uses a pulse frequency of 25 Hz, hence actively cooled components are necessary and were designed. A novel electron beam guidance procedure, called circular loading method, was a result of the developmental process. It was used for all later tests because it provides a stabilisation of the applied power density against test parameter fluctuations (e.g. vacuum quality). The electron beam guidance is flexible enough to provide a SSHL pattern during the interpulse time (between two successive THLs

  12. Preliminary estimates of residence times and apparent ages of ground water in the Chesapeake Bay watershed, and water-quality data from a survey of springs

    Science.gov (United States)

    Focazio, Michael J.; Plummer, L. Neil; Bohlke, John K.; Busenberg, Eurybiades; Bachman, L. Joseph; Powars, David S.

    1998-01-01

    Knowledge of the residence times of the ground-water systems in Chesapeake Bay watershed helps resource managers anticipate potential delays between implementation of land-management practices and any improve-ments in river and estuary water quality. This report presents preliminary estimates of ground-water residence times and apparent ages of water in the shallow aquifers of the Chesapeake Bay watershed. A simple reservoir model, published data, and analyses of spring water were used to estimate residence times and apparent ages of ground-water discharge. Ranges of aquifer hydraulic characteristics throughout the Bay watershed were derived from published literature and were used to estimate ground-water residence times on the basis of a simple reservoir model. Simple combinations of rock type and physiographic province were used to delineate hydrogeomorphic regions (HGMR?s) for the study area. The HGMR?s are used to facilitate organization and display of the data and analyses. Illustrations depicting the relation of aquifer characteristics and associated residence times as a continuum for each HGMR were developed. In this way, the natural variation of aquifer characteristics can be seen graphically by use of data from selected representative studies. Water samples collected in September and November 1996, from 46 springs throughout the watershed were analyzed for chlorofluorocarbons (CFC?s) to estimate the apparent age of ground water. For comparison purposes, apparent ages of water from springs were calculated assuming piston flow. Additi-onal data are given to estimate apparent ages assuming an exponential distribution of ages in spring discharge. Additionally, results from previous studies of CFC-dating of ground water from other springs and wells in the watershed were compiled. The CFC data, and the data on major ions, nutrients, and nitrogen isotopes in the water collected from the 46 springs are included in this report. The apparent ages of water

  13. Fundamentals of heterogeneously catalyzed reactions of environmental importance

    Science.gov (United States)

    Deshmukh, Subodh Shrinivas

    Reaction kinetics and spectroscopic characterization are valuable tools for understanding heterogeneously catalyzed chemical reactions. The objective of this work was to apply the tools of catalysis and reaction kinetics to understand the fundamentals of chemical surface phenomena for environmentally important reactions. This thesis presents our work in two areas of catalytic reactions for pollution abatement---"chlorofluorocarbon (CFC) treatment chemistry" and "sulfur-tolerant auto exhaust catalysts." The ozone depletion potential of CFCs has resulted in a great interest in the academic and industrial communities to find replacements for these chemicals. Hydrofluorocarbons (HFCs) are amongst the best "environmentally benign" candidates for CFC replacement. One selective pathway for the synthesis of HFCs is via the hydrodechlorination of CFCs. This route has the added benefit of destroying harmful CFC stockpiles and converting them into more useful chemicals. The work in Chapter 3 shows that parallel hydrogenation pathways starting from a common CF2 species can explain the formation of the products CH2F2 and CH4 for the hydrodechlorination of CF2Cl2 over Pd/AlF3. Transient kinetics experiments using C2H4 as a trapping agent for surface carbenes have provided evidence for the presence of CH2 species on the catalyst surface during this reaction. The absence of either coupling products or trapped products containing F suggests that the rate of hydrogenation of surface CF2 species is faster than that of surface CH2 species. Another important class of CFC reactions is oxide-catalyzed disproportionations to control the number and position of halogen atoms in the CFC/HFC molecule. Chapter 4 combines the use of reaction kinetics tools and spectroscopic characterization techniques to understand the adsorption and reaction of CF3CFCl 2 over gamma-Al2O3. The CF3CFCl 2 reaction over gamma-Al2O3 lead to a modification of the gamma-Al2O3 surface due to fluorination and the

  14. Observation of Xuanyou decoction combined with Zengye decoction on exogenous - caused chronic functional constipation with YIN - deficiency type%宣幽汤合增液汤治疗外感引起阴虚型慢性功能性便秘临床观察

    Institute of Scientific and Technical Information of China (English)

    盛冬梅; 高长远; 程艳丽

    2012-01-01

    Objective To observe the effect of Xuanyou decoction combined with Zengye decoction on exogenous — caused chronic functional constipation ( CFC) with YIN — deficiency type, and effect of exogenous pathogenic factor on CFC. Methods 160 cases of CFC with YIN - deficiency type were randomly divided into two groups. Control group ( n = 78) received oral Zengye decoction. Treatment group received Xuanyou decoction combined with Zengye decoction. Quantify integral change of the main symptoms, export symptoms, obstructive symptoms, and systemic symptoms were compared before and after treatment in two groups after two courses. Results The total effective rate was 95. 1% in treatment group and 71. 8% in control group. There was significant difference between two groups (P <0. 05). There was significant difference between before and after treatment on quantify integral change of the main symptoms, export symptoms, obstructive symptoms, and systemic symptoms in two groups ( P < 0. 01 ). There was significant difference between two groups on quantify integral change of the main symptoms, export symptoms, obstructive symptoms, and systemic symptoms after treatment (P <0.05). Conclusion Xuanyou decoction combined with Zengye decoction has definite effect on exogenous — caused chronic functional constipation with YIN — deficiency type, has more significantly improvement in particular the main symptoms and export symptoms. Starting from the exogenous factors defibering exterior eil plays an important role on the treatment of CFC with YIN - deficiency type.%目的 观察宣幽汤合增液汤治疗外感引起阴虚型慢性功能性便秘(CFC)的临床疗效,并探讨外感因素对阴虚型CFC的影响.方法 将160例阴虚型CFC患者随机分为2组.对照组78例采用增液汤口服治疗;治疗组82例采用宣幽汤合增液汤口服治疗.均治疗2个疗程,比较2组治疗前后主症、出口症状、梗阻症状及全身症状的量化积分变化,

  15. FORMA DE ADIÇÃO AO SOLO DA CAMA-DE-FRANGOS DE CORTE SEMIDECOMPOSTA PARA PRODUÇÃO DE TARO APPLICATION OF SEMIDECOMPOSED CHICKEN MANURE TO THE SOIL FOR TARO YIELD

    Directory of Open Access Journals (Sweden)

    Cristiane Gomes da Silva

    2007-09-01

    Full Text Available

    Um experimento foi conduzido, em Dourados-MS, entre 02/out./1998 e 04/jun./1999, em Latossolo Vermelho distroférrico, de textura argilosa, para avaliar a resposta produtiva de cinco clones e taro (Japonês, Branco, Cem-Um, Macaquinho e Chinês, sob so de 14 t.ha-1 de cama-de-frangos de corte semi-decomposta CFC, adicionadas ao solo no sulco de plantio, incorporada ou em cobertura. Os fatores foram arranjados no delineamento experimental e blocos completos casualizados, como fatorial 5x3, com rês repetições. As mudas utilizadas foram rizomas-filhos. Os limbos, pecíolos, rizomas-mãe (RM e rizomas-filhos (RF dos clones Japonês, Cem-Um, Branco e Macaquinho foram colhidos os 210 dias e os do clone Chinês, aos 245 dias. As produções das matérias frescas dos limbos dos cinco clones foram baixas e variaram de 3,0 t.ha-1 (Macaquinho a 1,2 t.ha-1 (Branco, enquanto as produções de pecíolos e de RM foram altas, com variações de 19,4 t.ha-1 e 17,4 t.ha-1 (Macaquinho a 4,8 t.ha-1e 7,8 t.ha-1 (Branco, respectivamente. O efeito da interação entre clones e formas de adição ao solo de CFC foi detectado na produção de RM sendo melhor com a incorporação da CFC (20,6 t.ha-1 para o clone Macaquinho. A menor produção de RM (7,8 t.ha-1 e a maior de RF (56,9 t.ha-1 foram do clone Branco. Pelos resultados obtidos para matérias fresca e seca de RM e de RF concluiu-se que as plantas de taro têm capacidade produtiva característica do clone e que a CFC pode ser incorporada no solo.

    PALAVRAS-CHAVE: Colocasia esculenta; inhame; resíduo orgânico; produtividade.

    An experiment was carried out in Dourados-MS, from ctober 2, 1998, to June 4, 1999, in a clay

  16. Measurements of HFC-134a and HCFC-22 in groundwater and unsaturated-zone air: implications for HFCs and HCFCs as dating tracers

    Science.gov (United States)

    Haase, Karl B.; Busenberg, Eurybiades; Plummer, L. Niel; Casile, Gerolamo; Sanford, Ward E.

    2014-01-01

    A new analytical method using gas chromatography with an atomic emission detector (GC–AED) was developed for measurement of ambient concentrations of hydrochlorofluorocarbons (HCFCs) and hydrofluorocarbons (HFCs) in soil, air, and groundwater, with the goal of determining their utility as groundwater age tracers. The analytical detection limits of HCFC-22 (difluorochloromethane, CHClF2) and HFC-134a (1,2,2,2-tetrafluoroethane, C2H2F4) in 1 L groundwater samples are 4.3 × 10− 1 and 2.1 × 10− 1 pmol kg− 1, respectively, corresponding to equilibrium gas-phase mixing ratios of approximately 5–6 parts per trillion by volume (pptv). Under optimal conditions, post-1960 (HCFC-22) and post-1995 (HFC-134a) recharge could be identified using these tracers in stable, unmixed groundwater samples. Ambient concentrations of HCFC-22 and HFC-134a were measured in 50 groundwater samples from 27 locations in northern and western parts of Virginia, Tennessee, and North Carolina (USA), and 3 unsaturated-zone profiles were collected in northern Virginia. Mixing ratios of both HCFC-22 and HFC-134a decrease with depth in unsaturated-zone gas profiles with an accompanying increase in CO2 and loss of O2. Apparently, ambient concentrations of HCFC-22 and HFC-134a are readily consumed by methanotrophic bacteria under aerobic conditions in the unsaturated zone. The results of this study indicate that soils are a sink for these two greenhouse gases. These observations contradict the previously reported results from microcosm experiments that found that degradation was limited above-ambient HFC-134a. The groundwater HFC and HCFC concentrations were compared with concentrations of chlorofluorocarbons (CFCs, CFC-11, CFC-12, CFC-113) and sulfur hexafluoride (SF6). Nearly all samples had measured HCFC-22 or HFC-134a that were below concentrations predicted by the CFCs and SF6, with many samples showing a complete loss of HCFC-22 and HFC-134a. This study indicates that HCFC-22 and HFC-134

  17. Efficacy and safety of eco-friendly inhalers: focus on combination ipratropium bromide and albuterol in chronic obstructive pulmonary disease

    Directory of Open Access Journals (Sweden)

    Panos RJ

    2013-04-01

    Full Text Available Ralph J Panos1,2 1Pulmonary, Critical Care, and Sleep Medicine Division, Cincinnati Veterans Affairs Medical Center, 2Pulmonary, Critical Care, and Sleep Medicine Division, University of Cincinnati College of Medicine, Cincinnati, OH, USA Background: Chronic obstructive pulmonary disease (COPD is a major cause of morbidity and mortality and its treatment is critical to improve quality of life, reduce symptoms, and diminish the frequency of COPD exacerbations. Due to the harmful environmental effects of pressurized metered-dose inhalers (pMDIs containing chlorofluorocarbons (CFCs, newer systems for delivering respiratory medications have been developed. Methods: A search of the literature in the PubMed database was undertaken using the keywords “COPD,” “albuterol,” “ipratropium bromide,” and “Respimat® Soft Mist Inhaler™”; pertinent references within the identified citations were included. The environmental effect of CFC-pMDIs, the invention of the Respimat® Soft Mist Inhaler™ (SMI (Boehringer Ingelheim, Ingelheim, Germany, and its use to deliver the combination of albuterol and ipratropium bromide for the treatment of COPD were reviewed. Results: The adverse environmental effects of CFC-pMDIs stimulated the invention of novel delivery systems including the Respimat SMI. This review presents its development, internal mechanism, and use to deliver the combination of albuterol and ipratropium bromide. Conclusion: CFC-pMDIs contributed to the depletion of the ozone layer and the surge in disorders caused by harmful ultraviolet B radiation. The banning of CFCs spurred the development of novel delivery systems for respiratory medications. The Respimat SMI is an innovative device that produces a vapor of inhalable droplets with reduced velocity and prolonged aerosol duration that enhance deposition within the lower airway and is associated with improved patient satisfaction. Clinical trials have demonstrated that the Respimat SMI

  18. Observation of vapor bubble of non-azeotropic binary mixture in microgravity with a two-wavelength interferometer

    Energy Technology Data Exchange (ETDEWEB)

    Abe, Yoshiyuki; Iwasaki, Akira

    1999-07-01

    Although non-azeotropic mixtures are considered to be promising working fluids in advanced energy conversion systems, the primary technical problems in the heat transfer degradation in phase change processes cause economical handicap to wide-spread applications. The boiling behavior of mixtures still remains a number of basic questions being not answered yet, and the present authors believe that the most essential information for the boiling process in non-azeotropic mixtures is how temperature and concentration profiles are developed around the bubbles. The present study attempts at understanding fundamental heat and mass transfer mechanisms in nucleate pool boiling of non-azeotropic binary mixtures, and with the knowledge to develop a passive boiling heat transfer enhancement eventually. To this end, the authors have employed microgravity environment for rather detailed observation around vapor bubbles in the course of boiling inception and bubble growth. A two-wavelength Mach-Zehnder interferometer has been developed, which withstands mechanical shock caused by gravity change from very low gravity of the order of 10{sup {minus}5} g to relatively high gravity of approximately 8 g exposed during deceleration period. A series of experiments on single vapor bubbles for CFC113 single component and CFC12/CFC112 non-azeotropic binary mixture have been conducted under a high quality microgravity conditions available in 10-second free-fall facility of Japan Microgravity Center (JAMIC). The results for single component liquid showed a strong influence due to Marangoni effect caused by the temperature profile around the bubble. The results for non-azeotropic binary mixture showed, however, considerably different behavior from single component liquid. Both temperature and concentration profiles around a single vapor bubble were evaluated from the interferograms. The temperature and concentration layers established around the bubbles were nearly one order of magnitude larger

  19. Collection and Characterization of Particulate from the Tore Supra Tokamak (Dec. 1999 Vent)

    Energy Technology Data Exchange (ETDEWEB)

    Sharpe, John Phillip

    2002-12-01

    Particulate generated during the operation of a fusion device contributes to the radiological source term associated with accident scenarios in the device.1,2 Understanding the mechanisms generating the particulate and correctly describing its physical and chemical behavior is essential for safety analyses of future fusion devices. Knowledge of these mechanisms is gained by collecting and characterizing particulate matter from operating fusion facilities. Tokamak dust, the particulate matter generated during the operation of a tokamak fusion device, was collected from Tore Supra in December 1999, during the initial phase of the scheduled shutdown for installation of advanced plasma facing components. Tore Supra, located at CEA Cadarache, France, is presently the third largest operating tokamak with the capability of long-pulse operation. Eighteen super-conducting coils produce the 4.5 T magnetic field inside a vessel 2.4 m in major radius and 1.2 m in minor radius. Limiter and divertor regimes of operation are possible. In the divertor regime, the circular magnetic configuration is ergodized by six outboard resonant divertor modules that are covered with 12 m2 of carbon fiber composite (CFC) tiles. In addition, some field lines are diverted to actively cooled neutralizing plates made of CuCrZr bars covered with B4C. In the limiter regime, the plasma leans on the actively cooled inboard first wall or on a set of inertially cooled pumped limiters. The first wall area of 12 m2 is covered with both polycrystalline graphite tiles (83%) and CFC tiles (17%). The single outboard limiter is constructed of pyrolitic graphite, and the four toroidally symmetric bottom limiters are constructed of CFC. Figure 1.1 displays the relative location of plasma facing components within the plasma chamber of Tore Supra. In this report, we present in Section 2 the methods used to collect and analyze this dust and describe the selection of sampling locations. Section 3 includes a

  20. Italian WEEE management system and treatment of end-of-life cooling and freezing equipments for CFCs removal

    Energy Technology Data Exchange (ETDEWEB)

    Sansotera, M., E-mail: maurizio.sansotera@polimi.it [Dipartimento di Chimica, Materiali e Ingegneria Chimica, Politecnico di Milano, via Mancinelli 7, I-20131 Milano (Italy); Istituto Nazionale di Scienza e Tecnologia dei Materiali (INSTM), via Giusti 9, I-50121 Firenze (Italy); Navarrini, W. [Dipartimento di Chimica, Materiali e Ingegneria Chimica, Politecnico di Milano, via Mancinelli 7, I-20131 Milano (Italy); Istituto Nazionale di Scienza e Tecnologia dei Materiali (INSTM), via Giusti 9, I-50121 Firenze (Italy); Talaeemashhadi, S.; Venturini, F. [Dipartimento di Chimica, Materiali e Ingegneria Chimica, Politecnico di Milano, via Mancinelli 7, I-20131 Milano (Italy)

    2013-06-15

    Highlights: • Italian data about WEEE management in the period 2005–2010 have been reported. • In 2001–2004 CFC release was monitored and Po Valley resulted as main source region. • The Italian directive on WEEE management was enacted in 2005 but took effect in 2008. • The CFC analytic procedures of the audit assessments have been discussed. - Abstract: This study presents and analyzes the data of the Italian system for take-back and recovery of waste electrical and electronic equipments (WEEEs) in the start-up period 2008–2010. The analysis was focused particularly on the data about the treatment of end-of-life cooling and freezing equipments. In fact, the wastes of cooling and freezing equipments have a high environmental impact. Indeed, in their compressor oil and insulation polyurethane (PU) foams chlorofluorocarbon (CFC) ozone-depleting gases are still present. In the period 2001–2004 Northern Italy resulted the main source in Europe of CFCs. The European Directive on WEEE management was enacted in 2002, but in Italy it was implemented by the legislative Decree in 2005 and it became operational in 2008. Actually, in 2008 the national WEEE Coordination Centre was founded in order to organize the WEEE pick-up process and to control collection, recovery and recycling targets. As a result, in 2010 the average WEEE collection per capita exceeded the threshold of more than 4 kg per inhabitant, as well as cooling and freezing appliances represented more than one fourth of the Italian WEEE collection stream. During the treatment of end-of-life cooling and freezing equipments, CFCs were recovered and disposed principally by burner methods. The analyses of defined specimens collected in the treatment facilities were standardized to reliably determine the amount of recovered CFCs. Samples of alkaline solid salt, alkaline saline solution, polyurethane matrix and compressor oil collected during the audit assessment procedure were analyzed and the results