WorldWideScience

Sample records for cfc

  1. Temperature-dependent infrared cross sections for CFC-11, CFC-12, CFC-13, CFC-14, CFC-22, CFC-113, CFC-114, and CFC-115. Technical report

    Energy Technology Data Exchange (ETDEWEB)

    Massie, S.T.; Goldman, A.; McDaniel, A.H.; Cantrell, C.A.; Davidson, J.A.

    1991-02-01

    The Technical Note presents absorption cross sections at temperatures of 293, 273, 253, 233, 213, and 203K for the chlorofluorocarbon species CFC-11, (CCI3F), CFC-12 (CCI2F2), CFC-13 (CCIF3), CFC-14 (CF4), CFC-22 (CHCIF2), CFC-113 (C2CI3FI3), CFC-114 (C2CI2F4), and CFC-115 (C2CIF5). The infrared cross sections are those reported by McDaniel et al. (1990), and are displayed in graphical form to facilitate quick identification and quantification of CFC gases in high and medium resolution remote sensing studies.

  2. Atlantic CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    R. Steinfeldt

    2010-01-01

    Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.

  3. CFC Outdoor Tournament 2011

    CERN Multimedia

    2011-01-01

    Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...

  4. Study of groundwater mixing using CFC data

    Institute of Scientific and Technical Information of China (English)

    韩良丰; 庞忠和

    2001-01-01

    CFCs (Chlorofluorocarbons) are sensitive tools in the study of groundwater mixing. Based on results of CFC concentrations, the extent of mixing can be identified by three methods: 1. discrepancy between apparent ages determined by individual CFC compounds; 2. inconsistency between CFC concentration ratios and their respective apparent ages; and 3. correlation between the concentrations of two CFC compounds for a group of samples. The principle of determination of mixing ratios and apparent CFC water age in the case of a two component mixing of CFC-containing water with CFC-free water is described.

  5. Dicty_cDB: CFC294 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC294 (Link to dictyBase) - - - Contig-U16381-1 CFC294F (Link to Original site) CFC2...94F 124 - - - - - - Show CFC294 Library CF (Link to library) Clone ID CFC294 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC294Q.Seq.d/ Representative seq. ID CFC29...4F (Link to Original site) Representative DNA sequence >CFC294 (CFC294Q) /CSM/CF/CFC2-D/CFC294Q.Seq.d/ ATTGT...CFF876 (CFF876Q) /CSM/CF/CFF8-D/CFF876Q.Seq.d/ 157 5e-38 CFC294 (CFC294Q) /CSM/CF/CFC2-D/CFC2

  6. Dicty_cDB: CFC276 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC276 (Link to dictyBase) - - - Contig-U16381-1 CFC276F (Link to Original site) CFC2...76F 124 - - - - - - Show CFC276 Library CF (Link to library) Clone ID CFC276 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-D/CFC276Q.Seq.d/ Representative seq. ID CFC27...6F (Link to Original site) Representative DNA sequence >CFC276 (CFC276Q) /CSM/CF/CFC2-D/CFC276Q.Seq.d/ ATTGT...me 4, contig fragment No. 72. 40 0.026 5 AC148398 |AC148398.4 Medicago truncatula clone mth2-24c23, WORKING

  7. Dicty_cDB: CFC857 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC857 (Link to dictyBase) - - - Contig-U15579-1 CFC857P (Link... to Original site) CFC857F 163 CFC857Z 482 CFC857P 645 - - Show CFC857 Library CF (Link to library) Clone ID CFC857 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...NPINCTSTDPCIFSYCENGVCIP TYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPI Translated Amino Acid sequence (All Fram...CY YDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCIP TYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPI

  8. Chlorine isotope composition in chlorofluorocarbons CFC-11, CFC-12 and CFC-113 in firn, stratospheric and tropospheric air

    Directory of Open Access Journals (Sweden)

    S. J. Allin

    2014-12-01

    Full Text Available The stratospheric degradation of chlorofluorocarbons (CFCs releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O3. A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, similar to effects seen in nitrous oxide (N2O. Using air archives to obtain a long-term record of chlorine isotope ratios in CFCs could help to identify and quantify their sources and sinks. We analyse the three most abundant CFCs and show that CFC-11 (CCl3F and CFC-113 (CClF2CCl2F exhibit significant stratospheric chlorine isotope fractionation, in common with CFC-12. The apparent isotope fractionation (ϵapp for mid- and high-latitude stratospheric samples are (−2.4 ± 0.5 and (−2.3 ± 0.4‰ for CFC-11, (−12.2 ± 1.6 and (−6.8 ± 0.8‰ for CFC-12 and (−3.5 ± 1.5 and (−3.3 ± 1.2‰ for CFC-113, respectively. Assuming a constant source isotope composition, we estimate the expected trends in the tropospheric isotope signature of these gases due to their stratospheric 37Cl enrichment and stratosphere–troposphere exchange. We compare these model results to the long-term δ(37Cl trends of all three CFCs, measured on background tropospheric samples from the Cape Grim air archive (Tasmania, 1978–2010 and tropospheric firn air samples from Greenland (NEEM site and Antarctica (Fletcher Promontory site. Model trends agree with tropospheric measurements within analytical uncertainties. From 1970 to the present-day, we find no evidence for variations in chlorine isotope ratios associated with changes in CFC manufacturing processes. Our study increases the suite of trace gases amenable to direct isotope ratio measurements in small air volumes, using a single-detector gas chromatography-mass spectrometry system.

  9. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC INCINERATION

    Science.gov (United States)

    The report gives results of the collection of combustion emission characterization data from chlorofluorocarbon (CFC) incineration. A bench scale test program to provide emission characterization data from CFC incineration was developed and performed, with emphasis on the format...

  10. Stable carbon isotope fractionation in the UV photolysis of CFC-11 and CFC-12

    Directory of Open Access Journals (Sweden)

    A. Zuiderweg

    2011-12-01

    Full Text Available The chlorofluorocarbons CFC-11 (CCl3F and CFC-12 (CCl2F2 are stable atmospheric compounds that are produced at the earth's surface, but removed only at high altitudes in the stratosphere, where their removal liberates atomic chlorine that then catalytically destroys stratospheric ozone. For such long-lived compounds, isotope effects in the stratospheric removal reactions have a large effect on their global isotope budgets. We have determined the photolytic isotope fractionation for stable carbon isotopes of CFC-11 and CFC-12 in laboratory experiments. 13C/12C isotope fractionations (ϵ range from (−23.7 ± 0.9 to (−17.5 ± 0.4‰ for CFC-11 and (−69.2 ± 3.4 to (−49.4 ± 2.3‰ for CFC-12 between 203 and 288 K, a temperature range relevant to conditions in the troposphere and stratosphere. These results suggest that CFCs should become strongly enriched in 13C with decreasing mixing ratio in the stratosphere, similar to what has been recently observed for CFC chlorine isotopes. In conjunction with the strong variations in CFC emissions before and after the Montréal Protocol, the stratospheric enrichments should also lead to a significant temporal increase in the 13C content of the CFCs at the surface over the past decades, which should be recorded in atmospheric air archives such as firn air.

  11. International research into chlorofluorocarbon (CFC) alternatives

    Energy Technology Data Exchange (ETDEWEB)

    Marseille, T.J.; Shankle, D.L.; Thurman, A.G.

    1992-05-01

    Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.

  12. Release of CFC-11 from disposal of polyurethane foam waste

    DEFF Research Database (Denmark)

    Kjeldsen, Peter; Jensen, M.H.

    2001-01-01

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...

  13. Atmospheric Science and the CFC Industry

    Science.gov (United States)

    Steed, J. M.

    2012-12-01

    Industry involvement with developing atmospheric science and subsequent regulations to protect ozone was unusual. Chlorofluorocarbon manufacturers were research-based businesses accustomed to understanding the science behind product-related issues. When Lovelock's measurements in 1971 implied most of the cumulative production of CFCs remained in the atmosphere, global CFC producers funded academic research to identify natural sinks for the materials. The Fluorocarbon Program Panel (FPP) began in 1972, but changed focus to atmospheric photochemistry following Rowland and Molina's work in 1974. Despite early vociferous opposition, especially by the CFC-using aerosol industry, to any regulations, leaders among the producers worked to build their scientific understanding, expanding FPP funding and launching internal work in modeling and ozone trend analysis. The key first question for industry was not how much depletion might occur, but whether it would occur at all. If so, regardless of the amount, regulations and a major transition would be required in CFC-using industries, and the response would need to be global and prompt. So long as that basic question was in doubt, some businesses and countries would resist the economic cost of action. In the meantime, the producing industry worked to identify potential alternatives and to communicate atmospheric science to the downstream industries. Although the industry science effort was often disparaged as an attack on "real" science, my only assignment when I joined DuPont's Central Research Department in 1979 was to understand and contribute to the science, keeping both the company and our customers informed. Our modeling results were published freely. FPP funding led to better knowledge of the ClO + O rate constant, significantly increasing depletion in model calculations; supported the development of the techniques used to measure in situ atmospheric ClO, so important in later strengthening the case for chlorine

  14. Construction of CFC-programs by LTL-specification

    Directory of Open Access Journals (Sweden)

    D. A. Ryabukhin

    2016-01-01

    Full Text Available This article continues a cycle of papers, which describe an approach to construction and verification of discrete PLC-programs by an LTL-specification. The approach provides a possibility of PLC-program correctness analysis by the model checking method. For the specification of the program behavior the linear-time temporal logic LTL is used. The correctness analysis of an LTL specification is performed automatically by the symbolic model checking tool Cadence SMV. Previously it was shown how ST-, LDand IL-programs are constructed by a correct (with verified program properties LTL-specification. In this article a technology of CFC-program construction by an LTL-specification is described. The language CFC (Continuous Function Chart is a variation of FBD (Function Block Diagram. FBD is a graphical language for microcircuits. CFC provides a possibility of free allocation of program components and connections on a screen. The approach to construction of CFC-programs is shown by an example. PLC-program representation on CFC within the approach to programming by LTL-specification differs from other representations. It gives the visualisation of a data flow from inputs to outputs. Influence and dependence between variables is explicitly shown during program execution within one PLC working cycle. In fact, CFC-program is a scheme of PLC-program data flow.

  15. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  16. Nordic Seas and Arctic Ocean CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    E. Jeansson

    2009-10-01

    Full Text Available Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters from 188 previously non-publicly available cruises in the Arctic, Atlantic, and Southern Ocean have been retrieved and merged into a new database: CARINA (CARbon IN the Atlantic. The data have been subject to rigorous quality control (QC in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the data products, i.e. the three merged files with measured, calculated and interpolated values for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS, the Atlantic (ATL and the Southern Ocean (SO. The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas.

    Here we present an overview of the QC of the CFC data for the Arctic Mediterranean Seas, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of some cruise data, while some other cruises were flagged with questionable quality, which excluded them from the final data product.

  17. A carbon fibre composite (CFC Byelorussian peat corer

    Directory of Open Access Journals (Sweden)

    L.G. Franzén

    2009-01-01

    Full Text Available The design specification, development and manufacture of a Byelorussian (Russian peat corer constructed from carbon fibre composite (CFC are described. The availability of this new composite material introduces new possibilities for constructing field instruments that are as strong as, or stronger than, equipment made from steel and other metals. One advantage is a significant weight reduction. A 10.5 metre coring set in standard stainless and soft steel weighs around 16 kg, whereas the total weight of a similar CFC set is 5.2 kg, giving a weight reduction of almost 70%. The CFC sample chamber is 500 mm long with internal diameter 65 mm, and so contains almost twice the volume of peat that can be collected with a standard 45 mm diameter steel corer. The diameter of the rods is 30 mm, which improves ergonomics, and the CFC has better thermic properties for winter use. Another advantage is that the contamination of samples (notably by chromium and nickel associated with the use of steel corers is eliminated. The CFC sampler works well in soft peats such as Sphagnum and Carex types. It is less suitable for little-decomposed fibrous and forest peats (e.g. Polytrichum type and those containing hardwood remains, especially in the more compacted bottom layers. It should be totally satisfactory for organic lake sediments, but probably not for stiff and coarse mineral deposits.

  18. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC-12 INCINERATION

    Science.gov (United States)

    The report gives results of experiments to determine the effect of flame zone temperature on gas-phase flame formation and destruction of products of incomplete combustion (PICS) during dichlorodi-fluoromethane (CFC-12) incineration. The effect of water injection into the flame ...

  19. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    Science.gov (United States)

    Tegtmeier, S.; Hegglin, M. I.; Anderson, J.; Funke, B.; Gille, J.; Jones, A.; Smith, L.; von Clarmann, T.; Walker, K. A.

    2016-02-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991-2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal structure. The CFC evaluations (based on MIPAS, ACE-FTS and HIRDLS) reveal that the uncertainty in our knowledge of the atmospheric CFC-11 and CFC-12 mean state, as given by satellite data sets, is smallest in the tropics and mid-latitudes at altitudes below 50 and 20 hPa, respectively, with a 1σ multi-instrument spread of up to ±5 %. For HF, the situation is reversed. The two available data sets (HALOE and ACE-FTS) agree well above 100 hPa, with a spread in this region of ±5 to ±10 %, while at altitudes below 100 hPa the HF annual mean state is less well known, with a spread ±30 % and larger. The atmospheric SF6 annual mean states derived from two satellite data sets (MIPAS and ACE-FTS) show only very small differences with a spread of less than ±5 % and often below ±2.5 %. While the overall agreement among the climatological data sets is very good for large parts of the upper troposphere and lower stratosphere (CFCs, SF6) or middle stratosphere (HF), individual discrepancies have been identified. Pronounced deviations between the instrument climatologies exist for particular atmospheric regions which differ from gas to gas. Notable features are differently shaped isopleths in the subtropics, deviations in the vertical gradients in the lower stratosphere and in the meridional gradients in the upper troposphere, and inconsistencies in the seasonal cycle. Additionally, long-term drifts between the instruments have been identified for the CFC-11 and CFC-12 time series. The evaluations as a

  20. Tropospheric observations of CFC-114 and CFC-114a with a focus on long-term trends and emissions

    Science.gov (United States)

    Laube, Johannes C.; Hanif, Norfazrin Mohd; Martinerie, Patricia; Gallacher, Eileen; Fraser, Paul J.; Langenfelds, Ray; Brenninkmeijer, Carl A. M.; Schwander, Jakob; Witrant, Emmanuel; Wang, Jia-Lin; Ou-Yang, Chang-Feng; Gooch, Lauren J.; Reeves, Claire E.; Sturges, William T.; Oram, David E.

    2016-12-01

    Chlorofluorocarbons (CFCs) are ozone-depleting substances as well as strong greenhouse gases, and the control of their production and use under the Montreal Protocol has had demonstrable benefits to both mitigation of increasing surface UV radiation and climate forcing. A global ban on consumption came into force in 2010, but there is evidence of continuing emissions of certain CFCs from a range of sources. One compound has received little attention in the literature, namely CFC-114 (C2Cl2F4). Of particular interest here is the differentiation between CFC-114 (CClF2CClF2) and its asymmetric isomeric form CFC-114a (CF3CCl2F) as atmospheric long-term measurements in the peer-reviewed literature to date have been assumed to represent the sum of both isomers with a time-invariant isomeric speciation. Here we report the first long-term measurements of the two isomeric forms separately, and find that they have different origins and trends in the atmosphere. Air samples collected at Cape Grim (41° S), Australia, during atmospheric background conditions since 1978, combined with samples collected from deep polar snow (firn) enable us to obtain a near-complete record of both gases since their initial production and release in the 1940s. Both isomers were present in the unpolluted atmosphere in comparably small amounts before 1960. The mixing ratio of CFC-114 doubled from 7.9 to 14.8 parts per trillion (ppt) between the start of the Cape Grim record in 1978 and the end of our record in 2014, while over the same time CFC-114a trebled from 0.35 to 1.03 ppt. Mixing ratios of both isomers are slowly decreasing by the end of this period. This is consistent with measurements of recent aircraft-based samples showing no significant interhemispheric mixing ratio gradient. We also find that the fraction of CFC-114a mixing ratio relative to that of CFC-114 increased from 4.2 to 6.9 % over the 37-year period. This contradicts the current tacit assumption used in international climate

  1. CHARACTERIZATION OF H-Y AND CR-Y ZEOLITE CATALYSTS DURING THE OXIDATIVE DESTRUCTION OF CFC11 AND CFC12

    Science.gov (United States)

    The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...

  2. A carbon fibre composite (CFC) Byelorussian peat corer

    OpenAIRE

    2009-01-01

    The design specification, development and manufacture of a Byelorussian (Russian) peat corer constructed from carbon fibre composite (CFC) are described. The availability of this new composite material introduces new possibilities for constructing field instruments that are as strong as, or stronger than, equipment made from steel and other metals. One advantage is a significant weight reduction. A 10.5 metre coring set in standard stainless and soft steel weighs around 16 kg, whereas the tot...

  3. Performance and heat transfer characteristics of HFC-134a and CFC-12 in a water chiller

    Energy Technology Data Exchange (ETDEWEB)

    Devotta, S.; Parande, M.G.; Patwardhan, V.R. [National Chemical Lab., Pune (India)

    1998-07-01

    A water chiller with an open reciprocating compressor has been used to comparatively assess the performance of HFC-134a with reference to CFC-12 under as close to identical conditions as possible. Performance characteristics of the chiller under retrofit conditions show that HFC-134a offers better cooling load and coefficients of performance vis-a-vis CFC-12 for identical operating conditions. Further heat transfer analysis of data for the condenser shows that the condensing heat transfer coefficients for HFC-134a are superior to CFC-12. The better performance of HFC-134a may be ascribed to the better heat transfer coefficient of HFC-134a over CFC-12. (Author)

  4. CFC-11, CFC-12 and HCFC-22 ground-based remote sensing FTIR measurements at Réunion Island and comparisons with MIPAS/ENVISAT data

    Science.gov (United States)

    Zhou, Minqiang; Vigouroux, Corinne; Langerock, Bavo; Wang, Pucai; Dutton, Geoff; Hermans, Christian; Kumps, Nicolas; Metzger, Jean-Marc; Toon, Geoff; De Mazière, Martine

    2016-11-01

    Profiles of CFC-11 (CCl3F), CFC-12 (CCl2F2) and HCFC-22 (CHF2Cl) have been obtained from Fourier transform infrared (FTIR) solar absorption measurements above the Saint-Denis (St Denis) and Maïdo sites at Réunion Island (21° S, 55° E) with low vertical resolution. FTIR profile retrievals are performed by the well-established SFIT4 program and the detail retrieval strategies along with the systematic/random uncertainties of CFC-11, CFC-12 and HCFC-22 are discussed in this study. The FTIR data of all three species are sensitive to the whole troposphere and the lowermost stratosphere, with the peak sensitivity between 5 and 10 km. The ground-based FTIR data have been compared with the collocated Michelson Interferometer for Passive Atmospheric Sounding (MIPAS/ENVISAT) data and found to be in good agreement: the observed mean relative biases and standard deviations of the differences between the smoothed MIPAS and FTIR partial columns (6-30 km) are (-4.3 and 4.4 %), (-2.9 and 4.6 %) and (-0.7 and 4.8 %) for CFC-11, CFC-12 and HCFC-22, respectively, which are within the combined error budgets from both measurements. The season cycles of CFC-11, CFC-12 and HCFC-22 from FTIR measurements and MIPAS data show a similar variation: concentration is highest in February-April and lowest in August-October. The trends derived from the combined St Denis and Maïdo FTIR time series are -0.86 ± 0.12 and 2.84 ± 0.06 % year-1 for CFC-11 and HCFC-22, respectively, for the period 2004 to 2016, and -0.76 ± 0.05 % year-1 for CFC-12 for 2009 to 2016. These measurements are consistent with the trends observed by the National Oceanic and Atmospheric Administration (NOAA) Global Monitoring Division's (GMD) Halocarbons & other Atmospheric Trace Species Group (HATS) measurements at Samoa (14.2° S, 170.5° W) for CFC-11 (-0.87 ± 0.04 % year-1), but slightly weaker for HCFC-22 (3.46 ± 0.05 %) year-1 and stronger for CFC-12 (-0.60 ± 0.02 % year-1).

  5. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2016-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) aboard the European satellite Envisat have been retrieved from versions MIPAS/4.61 to MIPAS/4.62 and MIPAS/5.02 to MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon-borne cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS-STRatospheric aircraft (MIPAS-STR), the satellite-borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS), as well as the ground-based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (full resolution, FR: July 2002-March 2004) and were used to validate MIPAS CFC-11 and CFC-12 products during that time, as well as profiles from the Improved Limb Atmospheric Spectrometer, ILAS-II. In general, we find that MIPAS shows slightly higher values for CFC-11 at the lower end of the profiles (below ˜ 15 km) and in a comparison of HATS ground-based data and MIPAS measurements at 3 km below the tropopause. Differences range from approximately 10 to 50 pptv ( ˜ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11 and is not as obvious in the relative differences between MIPAS and any of the comparison instruments. Differences at the lower end of the profile (below ˜ 15 km) and in

  6. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING THE INCINERATION OF RECOVERED CFC-11

    Science.gov (United States)

    The report gives results of an investigation of the formation of products of incomplete combustion (PICS) during "recovered" trichlorofluoromethane (CFC-11) incineration. Tests involved burning the recovered CFC-11 in a propane gas flame. combustion gas samples were taken and an...

  7. Lefty blocks a subset of TGFbeta signals by antagonizing EGF-CFC coreceptors.

    Directory of Open Access Journals (Sweden)

    Simon K Cheng

    2004-02-01

    Full Text Available Members of the EGF-CFC family play essential roles in embryonic development and have been implicated in tumorigenesis. The TGFbeta signals Nodal and Vg1/GDF1, but not Activin, require EGF-CFC coreceptors to activate Activin receptors. We report that the TGFbeta signaling antagonist Lefty also acts through an EGF-CFC-dependent mechanism. Lefty inhibits Nodal and Vg1 signaling, but not Activin signaling. Lefty genetically interacts with EGF-CFC proteins and competes with Nodal for binding to these coreceptors. Chimeras between Activin and Nodal or Vg1 identify a 14 amino acid region that confers independence from EGF-CFC coreceptors and resistance to Lefty. These results indicate that coreceptors are targets for both TGFbeta agonists and antagonists and suggest that subtle sequence variations in TGFbeta signals result in greater ligand diversity.

  8. Global CFC-11 (CFCl3 and CFC-12 (CF2Cl2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-07-01

    Full Text Available Vertical profiles of CFC-11 (CFCl3 and CFC-12 (CF2Cl2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  9. Global CFC-11 (CCl3F and CFC-12 (CCl2F2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-12-01

    Full Text Available Vertical profiles of CFC-11 (CCl3F and CFC-12 (CCl2F2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  10. CFC and HFC recycling equipments: Test performances; Qualificazione di dispositivi per il riciclaggio dei CFC e degli HFC

    Energy Technology Data Exchange (ETDEWEB)

    Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Pallotti, P. [ICF, Industria Componenti Frigoriferi Srl, Bologna (Italy)

    1996-12-01

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid.

  11. International symposium on environmental impacts of advanced alternative to CFC; CFC shinki daitai busshitsu no kankyo eikyo ni kansuru kokusai symposium hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-07

    The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.

  12. CFC+: Improved dynamics and gravitational waveforms from relativistic core collapse simulations

    CERN Document Server

    Cerdá-Durán, P; Dimmelmeier, H; Font, J A; Ibáñez, J M; Müller, E; Schäfer, G

    2004-01-01

    Core collapse supernovae are a promising source of detectable gravitational waves. Most of the existing (multidimensional) numerical simulations of core collapse in general relativity have been done using approximations of the Einstein field equations. As recently shown by Dimmelmeier et al (2002a,b), one of the most interesting such approximation is the so-called conformal flatness condition (CFC) of Isenberg, Wilson and Mathews. Building on this previous work we present here new results from numerical simulations of relativistic rotational core collapse in axisymmetry, aiming at improving the dynamics and the gravitational waveforms. The computer code used for these simulations evolves the coupled system of metric and fluid equations using the 3+1 formalism, specialized to a new framework for the gravitational field equations which we call CFC+. In this approach we add new degrees of freedom to the original CFC equations, which extend them by terms of second post-Newtonian order. The corrections for CFC+ ar...

  13. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  14. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  15. Distribution and ventilation of water masses in the western Ross Sea inferred from CFC measurements

    Science.gov (United States)

    Rivaro, Paola; Ianni, Carmela; Magi, Emanuele; Massolo, Serena; Budillon, Giorgio; Smethie, William M.

    2015-03-01

    During the CLIMA Project (R.V. Italica cruise PNRA XVI, January-February 2001), hydrographic and chlorofluorocarbons (CFCs) observations were obtained, particularly in the western Ross Sea. Their distribution demonstrated water mass structure and ventilation processes in the investigated areas. In the surface waters (AASW) the CFC saturation levels varied spatially: CFCs were undersaturated in all the areas (range from 80 to 90%), with the exception of few stations sampled near Ross Island. In particular, the Terra Nova Bay polynya, where high salinity shelf water (HSSW) is produced, was a low-saturated surface area (74%) with respect to CFCs. Throughout most of the shelf area, the presence of modified circumpolar deep water (MCDW) was reflected in a mid-depth CFC concentration minima. Beneath the MCDW, CFC concentrations generally increased in the shelf waters towards the seafloor. We estimated that the corresponding CFCs saturation level in the source water region for HSSW was about 68-70%. Waters with high CFC concentrations were detected in the western Ross Sea on the down slope side of the Drygalski Trough, indicating that AABW was being supplied to the deep Antarctic Basin. Estimates of ventilation ages depend strongly on the saturation levels. We calculated ventilation ages using the saturation level calibrated tracer ratio, CFC11/CFC12. We deduced a mean residence time of the shelf waters of about 6-7 years between the western Ross Sea source and the shelf break.

  16. Formulation and evaluation of CFC free inhalers for beclomethasone dipropionate

    Directory of Open Access Journals (Sweden)

    Gopala Krishna Murthy Talasila

    2013-06-01

    Full Text Available Beclomethasone dipropionate CFC free inhalation formulations were developed with a view to treat asthma prophylactically. Dry powder inhalers (DPI for beclomethasone dipropionate were prepared with different grades of lactose monohydrate. The influence of carrier and overages on performance of DPI was studied. Metered dose inhalers (MDI with HFA based propellants were formulated with various doses, overages and different concentrations of alcohol. Formulated DPI and MDI were evaluated for various official and unofficial quality control tests. The influence of over doses on valve delivery, effect of overages on emitted dose and influence of alcohol on spray pattern from MDI were studied. The better fine particle fraction and emitted dose were obtained from the DPI formulated with 10:90 ratio of fine lactose: coarse lactose and with 20% w/w overages. The studies on MDI revealed that the 15% of overdoses are required for effective valve delivery and 20% overages are required for 100% drug delivery. 5-10%v/v alcohol was found to be preferable to get optimum emitted dose and fine particle fraction.

  17. TRACER: an EXCEL workbook to calculate mean residence time in groundwater by use of tracers CFC-11, CFC-12 and tritium

    Science.gov (United States)

    Bayari, Serdar

    2002-06-01

    An EXCEL workbook is presented for calculating the mean residence time of groundwater based on the environmental tracers, tritium, CFC-11 and CFC-12. The program TRACER is written in Visual Basic for Application language and uses piston, exponential, linear, exponential-piston and linear-piston flow types of lumped-parameter models. Input and output data are stored in worksheets and a graph of results that are best fitted to observations is drawn for visual evaluation. Recharge temperature and altitude are used to convert atmospheric partial pressures of CFC-11 and CFC-12 to dissolved concentrations to provide a direct comparison between the models' output and observed data. The model can also be used to check whether an inferred flow type could be valid in the groundwater system being investigated. Other radioactive and gaseous environmental tracers and reactions such as, sorption and degradation can be included either as decay constant or with modifications in the program code. TRACER matches, satisfactorily, the results obtained from other softwares.

  18. Infrared Absorption Spectra, Radiative Efficiencies, and Global Warming Potentials of Newly-Detected Halogenated Compounds: CFC-113a, CFC-112 and HCFC-133a

    Directory of Open Access Journals (Sweden)

    Maryam Etminan

    2014-07-01

    Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.

  19. Evidence of CFC degradation in groundwater under pyrite-oxidizing conditions

    Science.gov (United States)

    Sebol, L.A.; Robertson, W.D.; Busenberg, E.; Plummer, L.N.; Ryan, M.C.; Schiff, S.L.

    2007-01-01

    A detailed local-scale monitoring network was used to assess CFC distribution in an unconfined sand aquifer in southwestern Ontario where the zone of 1-5-year-old groundwater was known with certainty because of prior use of a bromide tracer. Groundwater ???5 years old was confined to an aerobic zone at ???5 m depth and had CFC concentrations consistent with modern atmospheric mixing ratios at recharge temperatures of 7-11 ??C, as was observed in the 3-m thick vadose zone at the site. At depths below 6 m, the groundwater became progressively more reducing, however, with a denitrifying horizon at 6-7 m depth, and a Mn and Fe reducing zone below 7 m depth. In the anaerobic zone, 3H/3He ratios indicated that groundwater-age continued to increase uniformly with depth, to a maximum value of 27 years at 13 m depth. CFC concentrations, however, decreased abruptly within the denitrifying zone, leading to substantial age overestimation compared to the 3H/3He ages. Noble gas data indicated that the apparent CFC mass loss was not likely the result of gas stripping from possible bubble formation; thus, CFC degradation was indicated in the anoxic zone. The field data are consistent with first-order degradation rates of 0.3 yr-1 for CFC-12, 0.7 yr-1 for CFC-11, and 1.6 yr-1 for CFC-113. CFC attenuation at this site coincides with a zone where reduced S (pyrite) is actively oxidized by NO3 and dissolved oxygen (DO). Similar behavior has been observed at other sites [Tesoriero, A.J., Liebscher, H., Cox, S.E., 2000. Mechanism and rate of denitrification in an agricultural watershed: electron and mass balance along groundwater flow path. Water Resour. Res. 36 (6), 1545-1559; Hinsby, K., Hojberg, A.L., Engesgaard, P., Jensen, K.H., Larsen, F., Plummer, L.N., Busenberg, E., Accepted for publication. Transport and degradation of chlorofluorocarbons (CFCs) in a pyritic aquifer, Rabis Creek, Denmark. Water Resour. Res.], further demonstrating that the use of CFCs for age-dating anaerobic

  20. Surface damage characteristics of CFC and tungsten with repetitive ELM-like pulsed plasma irradiation

    Science.gov (United States)

    Kikuchi, Y.; Nishijima, D.; Nakatsuka, M.; Ando, K.; Higashi, T.; Ueno, Y.; Ishihara, M.; Shoda, K.; Nagata, M.; Kawai, T.; Ueda, Y.; Fukumoto, N.; Doerner, R. P.

    2011-08-01

    Surface damage of carbon fiber composite (CFC) and tungsten (W) due to repetitive ELM-like pulsed plasma irradiation has been investigated by using a magnetized coaxial plasma gun. CX2002U CFC and stress-relieved W samples were exposed to repetitive pulsed deuterium plasmas with duration of ˜0.5 ms, incident ion energy of ˜30 eV, and surface absorbed energy density of ˜0.3-0.7 MJ/m2. Bright spots on a CFC surface during pulsed plasma exposures were clearly observed with a high-speed camera, indicating a local surface heating. No melting of a W surface was observed under a single plasma pulse exposure at energy density of ˜0.7 MJ/m2, although cracks were formed. Cracking of the W surface grew with repetitive pulsed plasma exposures. Subsequently, the surface melted due to localized heat absorption.

  1. High RF power test of a CFC antenna module for lower hybrid current drive

    Energy Technology Data Exchange (ETDEWEB)

    Maebara, S.; Seki, M.; Ikeda, Y.; Kiyono, K.; Suganuma, K.; Imai, T. [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment; Goniche, M.; Bibet, Ph.; Brossaud, J.; Cano, V.; Kazarian-Vibert, F.; Froissard, P.; Rey, G. [Association Euratom-CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. de Recherches sur la Fusion Controlee

    1998-07-01

    A mock-up of a 3.7 GHz Lower Hybrid Current Drive (LHCD) antenna module was fabricated from Carbon Fibre Composite (CFC) for the development of heat resistive low Z front facing the plasma. This 2 divided waveguide module is made from CFC plates and rods which are Cu-plated to reduce the RF losses. The withstand-voltage, the RF properties and the outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. A reference module made from Dispersion Strengthened Copper (DSC) was also fabricated. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m{sup 2} were performed with no breakdowns on the CFC module. It was also checked that the highest power density, up to 150 MW/m{sup 2}, could be transmitted when the waveguides are filled with H2 at a pressure of 5 x 10{sup -2} Pa. During a long pulse, the power reflection coefficient remains low in the 0.8-1.3 % range and no significant change in the reflection coefficient is measured after the thermal cycling provided by the long pulse operation. From thermocouple measurements, RF losses of the copper coated CFC and the DSC modules were compared. No significant differences were measured. From pressure measurements, it was found that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of DSC at 300 deg.C. It is concluded that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)

  2. Catalytic hydrolysis of CFC-12 over solid acid Ti(SO4)2

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The catalytic hydrolysis of dichlorodifluoromethane (CFC-12) was investigated over solid acid Ti(SO4)2. The catalytic activity decreased with the calcination temperature. When space velocity was 6 l h-1 g-cat-1, the CFC-12 conversion at 310oC over Ti(SO4)2 calcined at 350oC remained about 98.5% during 360 h on stream, and the selectivity to by-products remained zero. The findings enlarged the scope of traditional catalyst systems for the CFCs decomposition.

  3. Chlorofluorocarbons (CFC's): Regulation and replacement. (Latest citations from the PIRA Ppackaging, Paper, Printing, and Publishing, and Nonwovens abstracts database). Published Search

    Energy Technology Data Exchange (ETDEWEB)

    1993-11-01

    The bibliography contains citations concerning chlorofluorocarbons (CFC's), and efforts to find substitute materials in response to the need to lessen the environmental impact of CFC on the ozone layer, as agreed to in the international Montreal Protocol. CFC alternatives are expected to be used as aerosol propellants, blowing agents, refrigerants, fire extinguishants, and solvents. References to the effects of CFC on ozone are found in separate bibliographies. (Contains 250 citations and includes a subject term index and title list.)

  4. Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G., E-mail: gaelle.chevet@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Martin, E., E-mail: martin@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Boscary, J., E-mail: jean.boscary@ipp.mpg.de [Max-Planck-Institut fuer Plasmaphysik, EURATOM Association, 85748 Garching (Germany); Camus, G., E-mail: camus@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Herb, V., E-mail: herb@lcts.u-bordeaux1.fr [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Bordeaux (France); Schlosser, J., E-mail: jacques.schlosser@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Escourbiac, F., E-mail: frederic.escourbiac@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France); Missirlian, M., E-mail: marc.missirlian@cea.fr [Association EURATOM-CEA, DSM/IRFM, CEA Cadarache, F-13108 Saint Paul lez Durance (France)

    2011-10-01

    The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.

  5. Research on interactions of plasma streams with CFC targets in the Rod Plasma Injector facility

    Directory of Open Access Journals (Sweden)

    Zaloga Dobromil R.

    2016-06-01

    Full Text Available This paper present results of optical spectroscopy studies of interactions of intense plasma streams with a solid target made of carbon fibre composite (CFC. The experiments were carried out within the Rod Plasma Injector (RPI IBIS facility. The optical measurements were performed first for a freely propagating plasma stream in order to determine the optimal operational parameters of this facility. Optical emission spectra (OES were recorded for different operational modes of the RPI IBIS device, and spectral lines were identified originating from the working gas (deuterium as well as some lines from the electrode material (molybdenum. Subsequently, optical measurements of plasma interacting with the CFC target were performed. In the optical spectra recorded with the irradiated CFC samples, in addition to deuterium and molybdenum lines, many carbon lines, which enabled to estimate erosion of the investigated targets, were recorded. In order to study changes in the irradiated CFC samples, their surfaces were analysed (before and after several plasma discharges by means of scanning electron microscope (SEM and energy dispersive spectroscopy (EDS techniques. The analysis of the obtained SEM images showed that the plasma irradiation induces noticeable changes in the surface morphology, for example vaporisation of some carbon fibres and formation of microcracks. The obtained EDS images showed that upon the irradiated target surface, some impurity ions are also deposited, particularly molybdenum ions from the applied electrodes.

  6. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  7. Development of residual thermal stress-relieving structure of CFC monoblock target for JT-60SA divertor

    Energy Technology Data Exchange (ETDEWEB)

    Tsuru, Daigo, E-mail: tsuru.daigo@jaea.go.jp; Sakurai, Shinji; Nakamura, Shigetoshi; Ozaki, Hidetsugu; Seki, Yohji; Yokoyama, Kenji; Suzuki, Satoshi

    2015-10-15

    Highlights: • We carried out numerical simulations on residual thermal stress of targets for the JT-60SA divertor. • We developed three measures to reduce residual thermal stress. • We proposed two structures of CFC monoblock target for the JT-60SA divertor. • We confirmed the effectiveness of the structure by infrared thermography inspection and high heat flux test. - Abstract: Carbon fibre-reinforced carbon composite (CFC) monoblock target for JT-60SA divertor is under development towards the mass-production. CFC monoblocks, WCu interlayers and a CuCrZr cooling tube at the centre of the monoblocks were bonded by vacuum brazing in a high temperature, to a target. If residual thermal stress due to difference of thermal expansions between CFC and CuCrZr exceeds the maximum allowable stress of the CFC after the bonding, cracks are generated in the CFC monoblock and heat removal capacity of the target degrades. In this paper, new structures of the targets were proposed, to reduce residual thermal stress and to mitigate the degradation of heat removal capacity of the targets. Some measures, including slitting of the CFC monoblock aside of the cooling tube, replacement of the interlayer material and shifting the position of the cooling tube, were implemented. The effectiveness of the measures was evaluated by numerical simulations. Target mock-ups with the proposed structures were manufactured. Infrared thermography inspection and high heat flux test were carried out on the mock-ups in order to evaluate the heat removal capacity.

  8. Kinetic characterization of Aspergillus niger chitinase CfcI using a HPAEC-PAD method for native chitin oligosaccharides.

    Science.gov (United States)

    van Munster, Jolanda M; Sanders, Peter; ten Kate, Geralt A; Dijkhuizen, Lubbert; van der Maarel, Marc J E C

    2015-04-30

    The abundant polymer chitin can be degraded by chitinases (EC 3.2.1.14) and β-N-acetyl-hexosaminidases (EC 3.2.1.52) to oligosaccharides and N-acetyl-glucosamine (GlcNAc) monomers. Kinetic characterization of these enzymes requires product quantification by an assay method with a low detection limit, preferably compatible with the use of native, non-labeled substrates. Here we report a quantitative HPAEC-PAD method that allows fast separation of chitin oligosaccharides (COS) ranging from (GlcNac)1-6 at detection limits of 1-3 pmol and a linear range of 5-250 pmol. Quantification under intra- and interday precision conditions was performed with 2.1-5.4% relative standard deviation (RSD) and 1.2-10.3% RSD, respectively. This method was successfully used for the determination of the kinetic parameters of the Aspergillus niger chitinase CfcI with native COS. CfcI was recently shown to release GlcNAc from the reducing end of COS, a new activity for fungal chitinases. A Carbohydrate Binding Module of family 18 (CBM18) is inserted in the CfcI catalytic domain. Site directed mutagenesis was used to assess the functionality of this CfcI-CBM18: four of its key amino acids were replaced by glycine residues, yielding CfcISYNF. Comparison of the kinetic parameters of CfcI and CfcISYNF confirmed that this CBM18 is functionally involved in catalysis.

  9. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  10. Subtractive hybridization identifies chick-cripto, a novel EGF-CFC ortholog expressed during gastrulation, neurulation and early cardiogenesis.

    Science.gov (United States)

    Colas, J F; Schoenwolf, G C

    2000-09-19

    EGF-CFC genes encode a novel class of extracellular, membrane-associated proteins that notably play an important role during vertebrate gastrulation. Whereas the two cysteine-rich domains that characterize these proteins, namely the extracellular EGF-like and the CFC domain, are known to be encoded by two evolutionarily conserved exons, it is generally assumed, based on weak primary sequence identity, that the remaining parts of the protein differ among vertebrates, suggesting that known members of the EGF-CFC family do not represent true orthologs. Here, by characterizing the full cDNA and genomic sequences of a new EGF-CFC gene in chick, and by comparing them with their counterparts in human (CRIPTO), mouse (cripto and cryptic), Xenopus (FRL-1) and zebrafish (one-eyed pinhead), we show that all EGF-CFC genes share an identical genomic organization over the entire coding region. Not only are the central two exons (coding for the EGF-like and CFC motifs) conserved, but also conserved are the total number of exons, their size, their intron phase and their correlation with discrete protein modules, in particular those modules that allow the EGF-CFC motif to become membrane-associated. Therefore, despite apparent divergence between their 5' and 3'-terminal exons, all known CRIPTO-related genes are structurally orthologous. We named this novel ortholog in bird, chick-cripto. We report the mRNA distribution of chick-cripto, which begins in the epiblast of the gastrula, with a pattern similar to EGF-CFC genes of other vertebrates.

  11. Replacement of CFCs in thermodynamical systems; Remplacement des C.F.C. dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    Fleurance, M.

    1996-12-31

    Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)

  12. Tungsten coatings electro-deposited on CFC substrates from oxide molten salt

    Science.gov (United States)

    Sun, Ningbo; Zhang, Yingchun; Lang, Shaoting; Jiang, Fan; Wang, Lili

    2014-12-01

    Tungsten is considered as plasma facing material in fusion devices because of its high melting point, its good thermal conductivity, its low erosion rate and its benign neutron activation properties. On the other hand, carbon based materials like C/C fiber composites (CFC) have been used for plasma facing materials (PFMs) due to their high thermal shock resistance, light weight and high strength. Tungsten coatings on CFC substrates are used in the JET divertor in the frame of the JET ITER-like wall project, and have been prepared by plasma spray (PS) and other techniques. In this study, tungsten coatings were electro-deposited on CFC from Na2WO4-WO3 molten salt under various deposition parameters at 900 °C in air. In order to obtain tungsten coatings with excellent performance, the effects of pulse duration ratio and pulse current density on microstructures and crystal structures of tungsten coatings were investigated by X-ray diffraction (XRD, Rigaku Industrial Co., Ltd., D/MAX-RB) and a scanning electron microscope (SEM, JSM 6480LV). It is found that the pulsed duration ratio and pulse current density had a significant influence on tungsten nucleation and electro-crystallization phenomena. SEM observation revealed that intact, uniform and dense tungsten coatings formed on the CFC substrates. Both the average grain size and thickness of the coating increased with the pulsed current density. The XRD results showed that the coatings consisted of a single phase of tungsten with the body centered cubic (BCC) structure. The oxygen content of electro-deposited tungsten coatings was lower than 0.05%, and the micro-hardness was about 400 HV.

  13. CFC/Cu bond damage in actively cooled plasma facing components

    Energy Technology Data Exchange (ETDEWEB)

    Schlosser, J [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France); Martin, E [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Pessac (France); Henninger, C [LMM, CNRS UMR 7607, Universite P. et M. Curie, Paris (France); Boscary, J [IPP-Euratom Association, Garching (Germany); Camus, G [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Pessac (France); Escourbiac, F [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France); Leguillon, D [LMM, CNRS UMR 7607, Universite P. et M. Curie, Paris (France); Missirlian, M [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France); Mitteau, R [Association Euratom-CEA, CEA/DSM/DRFC, CEA Cadarache, F-13108 Saint Paul Lez Durance (France)

    2007-03-15

    Carbon fibre composite (CFC) armours have been successfully used for actively cooled plasma facing components (PFCs) of the Tore Supra (TS) tokamak. They were also selected for the divertor of the stellarator W7-X under construction and for the vertical target of the ITER divertor. In TS and W7-X a flat tile design for heat fluxes of 10 MW m{sup -2} has been chosen. To predict the lifetime of such PFCs, it is necessary to analyse the damage mechanisms and to model the damage propagation when the component is exposed to thermal cycling loads. Work has been performed to identify a constitutive law for the CFC and parameters to model crack propagation from the edge singularity. The aim is to predict damage rates and to propose geometric or material improvements to increase the strength and the lifetime of the interfacial bond. For ITER a tube-in-tile concept (monoblock), designed to sustain heat fluxes up to 20 MW m{sup -2}, has been developed. The optimization of the CFC/Cu bond, proposed for flat tiles, could be adopted for the monoblock concept.

  14. Thermal fatigue characterization of CFC divertor modules using a one step brazing process

    Science.gov (United States)

    Pintsuk, G.; Casalegno, V.; Ferraris, M.; Koppitz, T.; Salvo, M.

    2012-07-01

    From the European side, three directional carbon fiber composites (CFCs) are foreseen to be used as plasma facing material for the strike point region of the initial ITER divertor installed for the non-tritium operational phase. For such divertor components two designs, the flat tile and the monoblock concept, are feasible, comprising a joint of the CFC with a Cu/Cu-alloy heat sink. This paper deals with the qualification of a reliable and cheap joining technology for such components, i.e. the simultaneous joining of the CuCrZr heat sink to a compliant Cu layer for the accommodation of thermal stresses and of the Cu layer and the CFC using a non-active Cu-Ge brazing material. For this purpose flat tile and monoblock mock-ups were manufactured, microstructurally analyzed, and subsequently exposed to cyclic high heat flux tests in the electron beam facility JUDITH. Applying hundreds of cycles at up to 20 MW/m2 the tested mock-ups underwent partial damaging, which was characterized in post-mortem microstructural investigations to analyze occurring degradation mechanisms, e.g. partial delamination at the CFC/Cu-interface.

  15. Effects of acoustic hood on noise, CFC-11, and particulate matter in a recycling system for waste refrigerator cabinet.

    Science.gov (United States)

    Guo, Jie; Fang, Wenxiong; Yang, Yichen; Xu, Zhenming

    2014-11-01

    The mechanical-physical process was proven to be technologically feasible for waste refrigerator recycling and has been widely used in the typical e-waste recycling factories in China. In this study, effects of the acoustic hood on the reduction of noise level, CFC-11, and heavy metals (Cr, Ni, Cu, Cd, and Pb) in particulate matter (PM) were evaluated. For noise pollution, the noise level inside and outside the acoustic hood was 96.4 and 78.9 dB, respectively. Meanwhile, it had a significant effect on A-weighted sound level with a reduction from 98.3 to 63.6 dB. For CFC-11 exposure, abundant CFC-11 (255 mg/m(3)) was detected in the acoustic hood. However, the mean concentration of CFC-11 at the outline of polyurethane foam collection was obviously diminished to 14 mg/m(3), and no CFC-11 was monitored around the acoustic hood. The concentrations of PM and heavy metals in PM outside the acoustic hood were lower than those inside the acoustic hood due to the physical barriers of the acoustic hood. Based on the risk assessment, only adverse health effect caused by Pb might likely appear. All the results can provide the basic data for pollution control and risk assessment in waste refrigerator recycling system.

  16. Initiation and propagation of damage in actively cooled CFC armoured high heat flux components in fusion machines

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G. [CEA, IRFM, F-13108 Saint-Paul-Lez-Durance (France)], E-mail: gaelle.chevet@cea.fr; Schlosser, J. [CEA, IRFM, F-13108 Saint-Paul-Lez-Durance (France); Martin, E.; Herb, V.; Camus, G. [Universite Bordeaux 1, Laboratoire des Composites Thermostructuraux, F-33600 Pessac (France); Escourbiac, F. [CEA, IRFM, F-13108 Saint-Paul-Lez-Durance (France)

    2009-06-15

    Plasma facing components (PFCs) in magnetic confinement controlled fusion machines are armoured with carbon fibre composite (CFC) bonded to a copper alloy heat sink. The manufacturing process induces high level of residual stresses due to the thermal expansion mismatch between CFC and copper and PFCs have to withstand strong stress ranges during operation. To study the initiation and propagation of damage in the CFC part, the ONERA damage model is used to describe the behaviour of the N11 material. The finite element simulations show that the damage is located near the interface and develops during the manufacturing of the PFCs as a consequence of the high amplitude of shear stresses. Under high heat flux, stresses decrease and the damage does not evolve. Further studies will take into account the damageable behaviour of the composite/copper interface, which will lead to geometrical optimisations and better knowledge of the link between damage and conductivity.

  17. CFCl3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime Uncertainty

    Science.gov (United States)

    McGillen, M.; Fleming, E. L.; Jackman, C. H.; Burkholder, J. B.

    2013-12-01

    CFCl3 (CFC-11) is both a major ozone-depleting substance and a potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95-230 nm) and temperature (216-296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using the NASA Goddard Space Flight Center 2-D coupled chemistry-radiation-dynamics model and the spectrum parameterization developed in this work. The modeled global annually averaged lifetime was 58.1 × 0.7 years (2σ uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current UV spectrum recommendations. CFCl 3 (CFC-11) 2-D model results: Left: Global annually averaged loss rate coefficient (local lifetime) and photolysis and reaction contributions (see legend). Middle: Molecular loss rate and uncertainty limits; the slow and fast profiles were calculated using the 2σ uncertainty estimates in the CFC-11 UV absorption spectrum from this work. Right: CFC-11 concentration profile. CFC-11 loss process contribution to the overall local lifetime uncertainty (2σ) calculated using the 2-D model (see text). Left: Results obtained from this work. Right: Results obtained using model input from Sander et al. [2011] and updates in SPARC [2013].

  18. CFCI3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime and Uncertainty

    Science.gov (United States)

    Mcgillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

    2014-01-01

    CFCl3 (CFC-11) is both an atmospheric ozone-depleting and potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95 - 230 nm) and temperature (216 - 296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using a 2-D model and the spectrum parameterization developed in this work. The obtained global annually averaged lifetime was 58.1 +- 0.7 years (2 sigma uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current spectrum recommendations

  19. High-performance, non-CFC-based thermal insulation: Gas filled panels

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, B.T.; Arasteh, D.; Selkowitz, S.

    1992-04-01

    Because of the forthcoming phase-out of CFCs and to comply with the more stringent building and appliance energy-use standards, researchers in industry and in the public sector are pursuing the development of non-CFC-based, high-performance insulation materials. This report describes the results of research and development of one alternative insulation material: highly insulating GFPs. GFPs insulate in two ways: by using a gas barrier envelope to encapsulate a low-thermal-conductivity gas or gas mixture (at atmospheric pressure), and by using low-emissivity baffles to effectively eliminate convective and radiative heat transfer. This approach has been used successfully to produce superinsulated windows. Unlike foams or fibrous insulations, GFPs are not a homogeneous material but rather an assembly of specialized components. The wide range of potential applications of GFPs (appliances, manufactured housing, site-built buildings, refrigerated transport, and so on) leads to several alternative embodiments. While the materials used for prototype GFPs are commercially available, further development of components may be necessary for commercial products. With the exception of a description of the panels that were independently tested, specific information concerning panel designs and materials is omitted for patent reasons; this material is the subject of a patent application by Lawrence Berkeley Laboratory.

  20. New and improved infrared absorption cross sections for dichlorodifluoromethane (CFC-12

    Directory of Open Access Journals (Sweden)

    J. J. Harrison

    2015-03-01

    Full Text Available Despite its widespread commercial use throughout the twentieth century, primarily in the refrigeration industry, dichlorodifluoromethane (CFC-12 is now known to have the undesirable effect of depleting stratospheric ozone. As this long-lived molecule slowly degrades in the atmosphere, monitoring its vertical concentration profile using infrared sounders on satellite platforms crucially requires accurate laboratory spectroscopic data. This work describes new high-resolution infrared absorption cross sections of dichlorodifluoromethane over the spectral range 800–1270 cm−1, determined from spectra recorded using a high-resolution Fourier transform spectrometer (Bruker IFS 125HR and a 26 cm-pathlength cell. Spectra of dichlorodifluoromethane/dry synthetic air mixtures were recorded at resolutions between 0.01 and 0.03 cm−1 (calculated as 0.9/MOPD; MOPD = maximum optical path difference over a range of temperatures and pressures (7.5–761 Torr and 190–294 K appropriate for atmospheric conditions. This new cross-section dataset improves upon the one currently available in the HITRAN and GEISA databases.

  1. Atmospheric lifetimes, infrared absorption spectra, radiative forcings and global warming potentials of NF3 and CF3CF2Cl (CFC-115)

    Science.gov (United States)

    Totterdill, Anna; Kovács, Tamás; Feng, Wuhu; Dhomse, Sandip; Smith, Christopher J.; Gómez-Martín, Juan Carlos; Chipperfield, Martyn P.; Forster, Piers M.; Plane, John M. C.

    2016-09-01

    Fluorinated compounds such as NF3 and C2F5Cl (CFC-115) are characterised by very large global warming potentials (GWPs), which result from extremely long atmospheric lifetimes and strong infrared absorptions in the atmospheric window. In this study we have experimentally determined the infrared absorption cross sections of NF3 and CFC-115, calculated the radiative forcing and efficiency using two radiative transfer models and identified the effect of clouds and stratospheric adjustment. The infrared cross sections are within 10 % of previous measurements for CFC-115 but are found to be somewhat larger than previous estimates for NF3, leading to a radiative efficiency for NF3 that is 25 % larger than that quoted in the Intergovernmental Panel on Climate Change Fifth Assessment Report. A whole atmosphere chemistry-climate model was used to determine the atmospheric lifetimes of NF3 and CFC-115 to be (509 ± 21) years and (492 ± 22) years, respectively. The GWPs for NF3 are estimated to be 15 600, 19 700 and 19 700 over 20, 100 and 500 years, respectively. Similarly, the GWPs for CFC-115 are 6030, 7570 and 7480 over 20, 100 and 500 years, respectively.

  2. Microstructure characterization of advanced protective Cr/CrN+a-C:H/a-C:H:Cr multilayer coatings on carbon fibre composite (CFC).

    Science.gov (United States)

    Major, L; Janusz, M; Lackner, J M; Kot, M; Major, B

    2016-06-01

    Studies of advanced protective chromium-based coatings on the carbon fibre composite (CFC) were performed. Multidisciplinary examinations were carried out comprising: microstructure transmission electron microscopy (TEM, HREM) studies, micromechanical analysis and wear resistance. Coatings were prepared using a magnetron sputtering technique with application of high-purity chromium and carbon (graphite) targets deposited on the CFC substrate. Selection of the CFC for surface modification in respect to irregularities on the surface making the CFC surface more smooth was performed. Deposited coatings consisted of two parts. The inner part was responsible for the residual stress compensation and cracking initiation as well as resistance at elevated temperatures occurring namely during surgical tools sterilization process. The outer part was responsible for wear resistance properties and biocompatibility. Experimental studies revealed that irregularities on the substrate surface had a negative influence on the crystallites growth direction. Chromium implanted into the a-C:H structure reacted with carbon forming the cubic nanocrystal chromium carbides of the Cr23 C6 type. The cracking was initiated at the coating/substrate interface and the energy of brittle cracking was reduced because of the plastic deformation at each Cr interlayer interface. The wear mechanism and cracking process was described in micro- and nanoscale by means of transmission electron microscope studies. Examined materials of coated CFC type would find applications in advanced surgical tools.

  3. Potential groundwater age tracer found: Halon-1301 (CF3Br), as previously identified as CFC-13 (CF3Cl)

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2014-09-01

    Groundwater dating using anthropogenic and natural tracer substances is a powerful tool for understanding groundwater dynamics for improved management of groundwater resources. Due to limitations in individual dating methods, often multiple tracers are used to reduce ambiguities. It is commonly accepted that there is a need for further complementary age tracers, in addition to current ones (e.g., tritium, SF6, and CFCs). We propose a potential new groundwater age tracer, Halon-1301 (CF3Br), which can easily be determined using gas chromatography with an attached electron capture detector (GC/ECD) developed by Busenberg and Plummer (2008). Its peak was noted by Busenberg and Plummer (2008), but they believed it to be CFC-13 (CF3Cl) at that time. We performed rigorous tests on gases containing or excluding Halon-1301 and CFC-13 and modern water samples and concluded that the two compounds have extremely similar retention times. Additionally, we found that the ECD response of CFC-13 is far too low to be detected in groundwater or air using standard volumes and sampling techniques. However, the peak areas and concentrations Busenberg and Plummer (2008) reported are in line with what would be expected for Halon-1301. Thus, we are confident that the peak formerly identified as CFC-13 is actually Halon-1301. Busenberg agrees with our findings. We further suggest that Halon-1301 has potential as a (complementary) age tracer, due to its established atmospheric history, and could hypothetically be used to date groundwater recharged in the 1970s or onward. We discuss known relevant properties, such as solubility and stability of Halon-1301 in the context of how these effect its potential application as a groundwater age tracer. Some open questions remain concerning how conservative Halon-1301 is—is it subject to degradation, retardation, and/or local contamination in groundwater. We are confident that Halon-1301 possesses important tracer relevant properties, but further

  4. Two-phase flows during draining of liquefied gases initially undersaturated. Validation by water and CFC11; Ecoulements diphasiques lors de la vidange de gaz liquifies initialement sous satures. Validation par l`eau et le CFC11

    Energy Technology Data Exchange (ETDEWEB)

    May, L.

    1996-12-11

    In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.

  5. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    Directory of Open Access Journals (Sweden)

    I MADE RASTA

    2015-06-01

    Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.

  6. Tritium retention measurements by accelerator mass spectrometry and full combustion of W-coated and uncoated CFC tiles from the JET divertor

    Science.gov (United States)

    Stan-Sion, C.; Bekris, N.; Kizane, G.; Enachescu, M.; Likonen, J.; Halitovs, M.; Petre, A.; contributors, JET

    2016-04-01

    Accelerator mass spectrometry (AMS) and the full combustion method (FCM) followed by liquid scintillation counting were applied to quantitatively determine the tritium retention in the tungsten-coated carbon fibre composites (CFC), in comparison to uncoated CFC tiles from the JET divertor. The tiles were adjacent and exposed to plasma operations between 2007 and 2009. The tritium depth profiles are showing that the tritium retention on the W-coated tile was reduced by a factor of 13.5 in comparison to the uncoated tile whereas the bulk tritium concentration is approximately the same for both tiles.

  7. WO3/ZrO2 Strong Acid as a Catalyst for the Decomposition of Chlorofluorocarbon (CFC-12)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction Chlorofluorocarbons (CFCs) diffusing to the stratosphere is a major reason for ozone depletion[1]. Also CFCs has been claimed to be notorious for its greenhouse effect[2]. So, recently it has become very important to eliminate CFCs as far as protecting the ozone layer surrounding the earth is concerned. Among various kinds of approaches to do destruction to CFCs, the catalytic decomposition seems to be the most practical and energetically favorable one, especially for treating small amounts of CFCs[3,4]. Recently, Fu et al.[3] reported that TiO2 modified with H2SO4 was much more active than TiO2 for the decomposition of CFC-12 in the presence of water vapor, and they attributed this tremendous enhancement in activity to the superacidic property of the sulfated catalyst. Their research results substantially stimulate us to investigate the catalytic decomposition of CFC-12 in the presence of water vapor over WO3/ZrO2 strong acid, which is more thermally stable than the sulfated oxides superacids[5].

  8. 40 CFR Appendix E to Subpart B of... - The Standard for Automotive Refrigerant Recycling Equipment Intended for Use With Both CFC-12 and...

    Science.gov (United States)

    2010-07-01

    ... weight) moisture at 21 °C and 45,000 ppm (by weight) mineral oil 525 suspension viscosity nominal and 770... consist of CFC-12 with 200,000 ppm (by weight) mineral oil 525 suspension viscosity nominal. 8.1.5After... liquid phase only. 4.2Seat Leakage Test 4.2.1 Valves, including electrically operated solenoid...

  9. Characterization of the starvation-induced chitinase CfcA and α-1,3-glucanase AgnB of Aspergillus niger.

    Science.gov (United States)

    van Munster, Jolanda M; Dobruchowska, Justyna M; Veloo, Ruud; Dijkhuizen, Lubbert; van der Maarel, Marc J E C

    2015-03-01

    The common saprophyte Aspergillus niger may experience carbon starvation in nature as well as during industrial fermentations. Starvation survival strategies, such as conidiation or the formation of exploratory hyphae, require energy and building blocks, which may be supplied by autolysis. Glycoside hydrolases are key effectors of autolytic degradation of fungal cell walls, but knowledge on their identity and functionality is still limited. We recently identified agnB and cfcA as two genes encoding carbohydrate-active enzymes that had notably increased transcription during carbon starvation in A. niger. Here, we report the biochemical and functional characterization of these enzymes. AgnB is an α-1,3-glucanase that releases glucose from α-1,3-glucan substrates with a minimum degree of polymerization of 4. CfcA is a chitinase that releases dimers from the nonreducing end of chitin. These enzymes thus attack polymers that are found in the fungal cell wall and may have a role in autolytic fungal cell wall degradation in A. niger. Indeed, cell wall degradation during carbon starvation was reduced in the double deletion mutant ΔcfcA ΔagnB compared to the wild-type strain. Furthermore, the cell walls of the carbon-starved mycelium of the mutant contained a higher fraction of chitin or chitosan. The function of at least one of these enzymes, CfcA, therefore appears to be in the recycling of cell wall carbohydrates under carbon limiting conditions. CfcA thus may be a candidate effector for on demand cell lysis, which could be employed in industrial processes for recovery of intracellular products.

  10. 3H/3He ages, CFC ages and He isotopes in the fractured bedrock of the Mirror Lake Basin, NH

    Science.gov (United States)

    Torgersen, T.; Stute, M.; Drenkard, S.; Schlosser, P.; Busenberg, E.; Plummer, N.; Shapiro, A.

    2001-05-01

    Tritium/3He and CFC (chlorofluorocarbon) analyses were conducted on groundwater samples from the fractured bedrock and the overlying drift of Mirror Lake watershed in central New Hampshire. These groundwaters have a significant terrigenic helium component that increases with depth. The 3He/4He ratio of the terrigenic helium indicates the presence of two groundwater types. Where terrigenic sources of 3He are no more than 10 times the 3He signal produced by 3H decay (tritiogenic 3He), 3H/3He ages can be calculated. However, drift age profiles cannot be interpreted as recharge rates because the 2D, 2-layer coupled bedrock/drift system violates the simple homogeneous 1D conditions necessary to interpret age profiles as recharge rates. Secondly, while some agreement is seen between 3H/3He ages and CFC ages, the reconstruction of the 1963 'bomb' 3H peak yields a maximum that is significantly less (1/10) than expected. This apparent loss of 3H is cannot be attributed to dispersion or dual hydraulic conductivity but is consistent with the models of dual porosity. The data also demonstrate that '3H/3Hetri calibrated 4He ages' are invalid and cannot be used to extend the 'age' information contained in He isotope analysis. The results of this study again demonstrate that tracers have an important role in the calibration and definition of flow models for complex groundwater systems. However, it is suggested that tracers should be routinely inserted into groundwater flow models to determine (I) which tracers are best suited to the problem and (ii) where to sample for tracers to best differentiate among model possibilities as well as which parameters constitute the best descriptions of the groundwater system. Such coupling of multiple tracers and flow models at the earliest stages will provide the highest probability for determining the best flow model.

  11. Performance testing of a semi-hermetic compressor with HFC-236EA and CFC-114 at chiller conditions. Report for December 1993-May 1994

    Energy Technology Data Exchange (ETDEWEB)

    Kazachki, G.S.; Hendriks, R.V.

    1994-12-31

    The paper gives results of tests of both HFC-236ea and CFC-114 at a range of temperatures covering surface craft and submarine chiller conditions. Evaporating temperatures ranged from 1.7 to 12.8 C, and condensing temperatures from 40.6 to 65.6 C, in order to develop a nine-point test map. Polyol ester oil was used with the refrigerants. The tests evaluated suction and discharge pressures, their difference and ratio, cooling capacity, electric power input, compressor energy efficiency ratio (coefficient of performance), electric current, and compressor volumetric and isentropic energy efficiency. Compressor discharge, motor winding, and oil temperature were also monitored. HFC-236ea is one of the strongest candidates for a CFC-114 alternative in surface craft and submarine chillers. Some material compatibility and oil miscibility work has also been performed in support of HFC-236ea as a refrigerant.

  12. Analysis of multicomopnent groundwater flow in karst aquifer by CFC, tritium, tracer test and modelling, case study at Skaistkalnes vicinity, Latvia

    Science.gov (United States)

    Bikshe, Janis; Babre, Alise; Delina, Aija; Popovs, Konrads

    2014-05-01

    Groundwater in karst environments tends to have difficulties to distinguish multiple flows if several sources of water are present. Skaistkalne vicinity faces with such situation where old groundwater, fresh groundwater and inflow from river Iecava occurs. Attempts were made to distinguish groundwater residence time of multiple components of water applying CFC and tritium dating techniques supplied by tracer test and numerical model of study area. Study area covers territory between two rivers Iecava and Memele with water level difference of 7 meters and horizontal distance of 2.2 kilometres between both. Study area consists of karst affected Devonian gypsum and carbonaceous rocks covered by Quaternary low to high permeable deposits. Confined groundwater at depth of 10-25 meters where analysed by CFC's and tritium. At this depth groundwater exhibits anoxic reducing environment that has caused degradation of CFC's at similar degree in all samples. Taking it into account, mean residence time based on CFC piston flow model is 22 - 42 years and 28 - 34 years based on binary mixing model. Tritium results show signs of incensement of groundwater residence time towards discharge area. CFC combined with tritium proved increased vertical velocity in middle part between the rivers likely caused by hydrogeological window in Quaternary deposits created by karst processes. Numerical model (Delina et al. 2012) was applied and calculations yielded groundwater flow velocity rate at 0.3 - 1 m/day in area between the rivers. Investigation of CFC data resulted in possible groundwater flow rate of at a minimum of 0.2 m/day although it's not applicable to all sampled wells due to specific hydrogeological conditions. Tracer test was made between the rivers in order to distinguish main water flow paths and flow velocity. Results showed that very high permeable conduits connect rivers and karst lakes with velocity rates of 800 - 1300 m/day. Complex investigation leads to conclude that

  13. Effects of mesoscale eddies on global ocean distributions of CFC-11, CO2, and Δ14C

    Directory of Open Access Journals (Sweden)

    P. Delecluse

    2007-10-01

    Full Text Available Global-scale tracer simulations are typically made at coarse resolution without explicitly modelling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of transient tracers. We made global anthropogenic transient-tracer simulations in coarse-resolution (2°cosφ×2°, ORCA2 and eddy-permitting (½°cosφ×½°, ORCA05 versions of the ocean general circulation model OPA9. Our focus is on surface-to-intermediate waters of the southern extratropics where air-sea tracer fluxes, tracer storage, and meridional tracer transport are largest. Eddies have little effect on global and regional bomb Δ14C uptake and storage. Yet for anthropogenic CO2 and CFC-11, refining the horizontal resolution reduced southern extratropical uptake by 25% and 28%, respectively. There is a similar decrease in corresponding inventories, which yields better agreement with observations. With higher resolution, eddies strengthen upper ocean vertical stratification and reduce excessive ventilation of intermediate waters by 20% between 60° S and 40° S. By weakening the residual circulation, i.e., the sum of Eulerian mean flow and the opposed eddy-induced flow, eddies reduce the supply of tracer-impoverished deep waters to the surface near the Antarctic divergence, thus reducing the air-sea tracer flux. Thus in the eddy permitting model, surface waters in that region have more time to equilibrate with the atmosphere before they are transported northward and subducted. As a result, the eddy permitting model's inventories of CFC-11 and anthropogenic CO2 are lower in that region because mixed-layer concentrations of both tracers equilibrate with the atmosphere on relatively short time scales (15 days and 6 months, respectively; conversely, bomb Δ14C's air-sea equilibration time of 6 years is so slow that, even in the eddy permitting model, there is little time for surface concentrations to equilibrate with the atmosphere, i.e., before

  14. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    OpenAIRE

    I MADE RASTA; I.W. Kasa; I Gede Mahardika

    2015-01-01

    CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 co...

  15. Heat flux distribution and gyro-radius smoothing effect on misaligned CFC tile in the Tore Supra tokamak

    Energy Technology Data Exchange (ETDEWEB)

    Corre, Yann, E-mail: yann.corre@cea.fr [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Dejarnac, Renaud [Institute of Plasma Physics AS CR v.v.i., Za Slovankou 3, 18200 Prague (Czech Republic); Gardarein, Jean-Laurent; Gaspar, Jonathan [Aix-Marseille Université, CNRS, IUSTI UMR 7343, 13013 Marseille (France); Escourbiac, Frédéric [ITER Organization, CS 90 046, 13067 St Paul-lez-Durance Cedex (France); Gauthier, Eric; Gunn, James-Paul [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Komm, Mickael [Institute of Plasma Physics AS CR v.v.i., Za Slovankou 3, 18200 Prague (Czech Republic); Lipa, Manfred; Loarer, Thierry; Missirlian, Marc [CEA, IRFM, F-13108 Saint-Paul-lez-Durance (France); Rigollet, Fabrice [Aix-Marseille Université, CNRS, IUSTI UMR 7343, 13013 Marseille (France)

    2015-08-15

    Understanding heat flux deposition processes is essential for the design of the plasma facing component allowing reliable high power steady state plasma operations. Misalignments up to δ = 0.2 mm between two adjacent CFC tiles have been reported on the Toroidal Pump Limiter of Tore Supra. Heat flux impinging the top and leading edge of the protruding tile are characterized with both IR thermographic system and numerical modelling using 2D particle-in-cell simulations that accounts for the Larmor radius smoothing effect of incident ions. Numerical heat loads are coupled with a 2D thermal model of the tile and with a specific sensor correction to simulate spatial-resolution related effects (necessary here since the tile misalignment is smaller than the spatial resolution of the IR system). In the experiment depicted here, with a misalignment smaller than an ion gyro-radius, the Larmor radius smoothing effect is maximum and overheating of the leading edge is reduced by a factor of two.

  16. Microstructure and properties of SiC gradiently coated Cf/C composites prepared by a RCLD method

    Institute of Scientific and Technical Information of China (English)

    Jun-hua Chen; Cuang-li Chen; Hao-ran Geng; Yan Wang

    2009-01-01

    The SiC gradiently coated carbon fiber/carbon (Cf/C) composites were prepared by a two-step rapid chemical liquid depo-sition (RCLD) method. The microstructure and properties of the composites were investigated using X-ray diffraction, scanning elec-tron microscopy together with energy dispersive X-ray analysis, bending tests, and oxidation tests. The experimental results show that the surface layer of the composites is composed of SiC, pyrocarbon, and carbon fibers. Their inner area consists of pyrocarbon and carbon fibers. The SiC content gradiently decreases with increasing distance from the outer surface to the center of the compos-ites. Furthermore, the thickness of the SiC layer increases with increasing tetraethylorthosilicate content and deposition time. SiC coatings have no significant influence on the bending strength of the composites. However, the oxidation resistance of the compos-ites increases with increasing thickness of the SiC layer.

  17. Post-coring entrapment of modern air in some shallow ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-06-01

    Full Text Available In this study, we report measurements of CFC-12 (CCl2F2 in firn air and in air extracted from shallow ice cores from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, some of the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for the presence of modern air entrapped in the shallow ice core samples that likely contained open pores at the time of collection. We propose that this is due to closure of the open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our results reveal that open porosity can exist below the maximum depth at which firn air samples can be collected, particularly at sites with lower accumulation rates. CFC-12 measurements demonstrate that post-drilling closure of open pores can lead to a change in the composition of bubble air in shallow ice cores through purely physical processes. The results have implications for investigations involving trace gas composition of bubbles in shallow ice cores collected near the firn-ice transition.

  18. Post-coring entrapment of modern air in polar ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and shallow ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-01-01

    Full Text Available In this study, we report the first measurements of CFC-12 (CCl2F2 in air extracted from shallow ice cores along with firn air CFC-12 measurements from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for presence of modern air entrapped in shallow ice core samples. We propose that this is due to closure of open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our measurements reveal the presence of open porosity below the depth at which firn air samples can be collected and demonstrate how the composition of bubble air in shallow ice cores can be altered during the post-drilling period through purely physical processes. These results have implications for investigations involving trace gas composition of bubbles in shallow ice cores.

  19. Stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O from measurements made by the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS

    Directory of Open Access Journals (Sweden)

    P. F. Bernath

    2013-02-01

    Full Text Available Long lived halogen-containing compounds are important atmospheric constituents since they can act both as a source of chlorine radicals, which go on to catalyse ozone loss, and as powerful greenhouse gases. The long term impact of these species on the ozone layer is dependent on their stratospheric lifetimes. Using observations from the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS we present calculations of the stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O. The lifetimes were calculated using the slope of the tracer-tracer correlation of these species with CFC-11 at the tropopause. The correlation slopes were corrected for the changing atmospheric concentrations of each species based on age of air and CFC-11 measurements from samples taken aboard the Geophysica aircraft – along with the effective linear trend of the VMR from tropical ground-based AGAGE sites. Stratospheric lifetimes were calculated using a CFC-11 lifetime of 45 yr. These calculations produced values of 113 + (− 26 (18 yr (CFC-12, 35 + (− 11 (7 yr (CCl4, 195 + (− 75 (42 yr (CH4, 69 + (− 65 (23 yr (CH3Cl and 123 + (− 53 (28 yr (N2O. The errors on these values are the weighted 1-σ non-systematic errors. The stratospheric lifetime of CH3Cl represents the first calculations of the stratospheric lifetime of CH3Cl using data from a space based instrument.

  20. Vapor pressures of mixtures of CFC-114 with the potential replacement coolants C{sub 4}F{sub 10} and c-C{sub 4}F{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Trowbridge, L.D. [Oak Ridge K-25 Site, TN (United States); Otey, M.G. [Paducah Gaseous Diffusion Plant, KY (United States)

    1994-09-01

    The U.S. Enrichment Corporation`s production of isotopically enriched uranium depends solely on two plants which utilize the gaseous diffusion process. This process uses large quantities of CFC-114 as an evaporative coolant. CFC-114, however, will be phased out of production at the end of 1995 due to its potential to deplete stratospheric ozone. A search has been underway for substitutes for a number of years. The initial search (1988-89) for an ozone-friendly, commercially available, chemically compatible substitute yielded two candidates, FC-c318 (c-C{sub 4}F{sub 8}) and FC-3110 (C{sub 4}F{sub 10}). The intended mode of replacing coolant was to stage the new coolant into independent subsystems of the plants, so that some systems would continue to operate on CFC-114, and an increasing number would operate on the new coolant. During that changeover process, the possibility of coolant mixing arises in variety of scenarios. This work was intended to generate sufficient experimental information to be able to predict the vapor pressure of coolant mixtures over the range of operating conditions likely to be found in the diffusion plants. Specifically, vapor pressures were measured over the temperature range 322 to 355 K (120{degrees}F to 180{degrees}F) and over the full range of mole fractions for binary mixtures of CFC-114 with FC-3110, and of CFC-114 with FC-c318.

  1. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Quarterly MCLR program technical progress report, January 1, 1995--March 31, 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.

    1995-04-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  2. Stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O from measurements made by the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS

    Directory of Open Access Journals (Sweden)

    A. T. Brown

    2013-07-01

    Full Text Available Long lived halogen-containing compounds are important atmospheric constituents since they can act both as a source of chlorine radicals, which go on to catalyse ozone loss, and as powerful greenhouse gases. The long-term impact of these species on the ozone layer is dependent on their stratospheric lifetimes. Using observations from the Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS we present calculations of the stratospheric lifetimes of CFC-12, CCl4, CH4, CH3Cl and N2O. The lifetimes were calculated using the slope of the tracer–tracer correlation of these species with CFC-11 at the tropopause. The correlation slopes were corrected for the changing atmospheric concentrations of each species based on age of air and CFC-11 measurements from samples taken aboard the Geophysica aircraft – along with the effective linear trend of the volume mixing ratio (VMR from tropical ground based AGAGE (Advanced Global Atmospheric Gases Experiment sites. Stratospheric lifetimes were calculated using a CFC-11 lifetime of 45 yr. These calculations produced values of 113 + (− 26 (18 yr (CFC-12, 35 + (− 11 (7 yr (CCl4, 69 + (− 65 (23 yr (CH3Cl, 123 + (− 53 (28 yr (N2O and 195 + (− 75 (42 yr (CH4. The errors on these values are the weighted 1σ non-systematic errors. Systematic errors were estimated by recalculating lifetimes using VMRs which had been modified to reflect differences between ACE-FTS retrieved VMRs and those from other instruments. The results of these calculations, including systematic errors, were as follows: 113 + (− 32 (20 for CFC-12, 123 + (− 83 (35 for N2O, 195 + (− 139 (57 for CH4, 35 + (− 14 (8 for CCl4 and 69 + (− 2119 (34 yr for CH3Cl. For CH3Cl & CH4 this represents the first calculation of the stratospheric lifetime using data from a space based instrument.

  3. Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential

    Energy Technology Data Exchange (ETDEWEB)

    Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)

    1995-12-31

    Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)

  4. Coupling 3D groundwater modeling with CFC-based age dating to classify local groundwater circulation in an unconfined crystalline aquifer

    Science.gov (United States)

    Kolbe, Tamara; Marçais, Jean; Thomas, Zahra; Abbott, Benjamin W.; de Dreuzy, Jean-Raynald; Rousseau-Gueutin, Pauline; Aquilina, Luc; Labasque, Thierry; Pinay, Gilles

    2016-12-01

    Nitrogen pollution of freshwater and estuarine environments is one of the most urgent environmental crises. Shallow aquifers with predominantly local flow circulation are particularly vulnerable to agricultural contaminants. Water transit time and flow path are key controls on catchment nitrogen retention and removal capacity, but the relative importance of hydrogeological and topographical factors in determining these parameters is still uncertain. We used groundwater dating and numerical modeling techniques to assess transit time and flow path in an unconfined aquifer in Brittany, France. The 35.5 km2 study catchment has a crystalline basement underneath a ∼60 m thick weathered and fractured layer, and is separated into a distinct upland and lowland area by an 80 m-high butte. We used groundwater discharge and groundwater ages derived from chlorofluorocarbon (CFC) concentration to calibrate a free-surface flow model simulating groundwater flow circulation. We found that groundwater flow was highly local (mean travel distance = 350 m), substantially smaller than the typical distance between neighboring streams (∼1 km), while CFC-based ages were quite old (mean = 40 years). Sensitivity analysis revealed that groundwater travel distances were not sensitive to geological parameters (i.e. arrangement of geological layers and permeability profile) within the constraints of the CFC age data. However, circulation was sensitive to topography in the lowland area where the water table was near the land surface, and to recharge rate in the upland area where water input modulated the free surface of the aquifer. We quantified these differences with a local groundwater ratio (rGW-LOCAL), defined as the mean groundwater travel distance divided by the mean of the reference surface distances (the distance water would have to travel across the surface of the digital elevation model). Lowland, rGW-LOCAL was near 1, indicating primarily topographical controls. Upland, r

  5. Materials Compatibility and Lubricants Research of CFC-refrigerant substitutes. Quarterly technical progress report, 1 April 1993--30 June 1993

    Energy Technology Data Exchange (ETDEWEB)

    Godwin, D.S.; Hourahan, G.C.; Szymurski, S.R.

    1993-07-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The DCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. Under the current MCLR program the Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) is contracting and managing multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each researcher.

  6. A combined morphostructural/fluid migration model of Pisciarelli area (Campi Flegrei caldera - CFc) through structural and integrated Terrestrial Laser Scanner (TLS) and Electrical Resistivity Tomography (ERT) analysis.

    Science.gov (United States)

    Caputo, Teresa; Di Giuseppe, Maria Guilia; Troiano, Antonio; Somma, Renato; Isaia, Roberto; Vitale, Stefano; Troise, Claudia; De Natale, Giuseppe

    2014-05-01

    The Solfatara-Pisciarelli (S-P) area was characterized by an intense eruptive activity during the last 5 ka and is presently the highly distributed degassing zones inside the CFC, worldwide well-known for its bradyseismic phenomenon. The last two main crises occurred during the 1970-72 and 1982-84, associated with an overall 3.5 m of ground uplift and an elevate rate of low magnitude seismicity. A strong direct relationship has always been observed between the increase of hydrothermal activity in the S-P area and ground uplift of the CFc. More recently starting from the 2005 a new gradual increase of the hydrothermal activity and ground uplift has been observed, with a steep growth of these effects from 2012, accompanied by seismic events with highest magnitude of 1.8. The Pisciarelli area has been the site of a significant morphological changes of its hydrothermal field including new fumarolic vents and a wide enlargement of a mud pool. Monitoring either landscape deformation than fluids migration of the S-P activity can be considered a good indicator of the volcanic dynamics taking place in the whole CFc caldera. This study shows a first attempt to integrate multidisciplinary approach including volcanological and structural field surveys and studies such us TLS and ERT signals applied to this highly dynamic areas. A detailed geo-structural survey allow us to characterize the complex pattern of fractures and faults recorded in the volcanic rocks in different times of the polyphasic CFc volcanic history. In order to statistically record data about fault and fracture (i) attitudes and (ii) spacing, the scan line method was applied. The whole planar structure is the locus of the well-known fumaroles and mud pools of Pisciarelli. A first time detailed Digital Terrestrial Model DTM of the area with an accuracy of 5cm obtained through TLS has been integrated combining the ERT of the lower part of the area, characterized by a widespread fumarolic activity and soil

  7. The impact of thermal fatigue and carbidization on the W coatings deposited on CFC tiles for the ITER-like Wall project at JET

    Energy Technology Data Exchange (ETDEWEB)

    Ruset, C., E-mail: ruset@infim.ro [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association Romania (Romania); Grigore, E.; Falie, D.; Gherendi, M. [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association Romania (Romania); Maier, H. [Max-Plank Institut für Plasma Physik, Euratom Association, 85748 Garching (Germany); Rasinski, M. [Faculty of Materials Science and Engineering, Warsaw University of Technology, Warsaw (Poland); Matthews, G.F. [Culham Centre for Fusion Energy, Euratom Association, Abingdon (United Kingdom); Zoita, V. [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association Romania (Romania); EFDA Close Support Unit, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom)

    2013-10-15

    Highlights: ► Degradation curves of the W coatings depend on temperature and number of pulses. ► Thermo-mechanical properties of the W coatings are associated with degradation curves. ► Thermal fatigue and carbidization affect the interface between CFC and W. ► A pore structure was detected at the interface by SEM examination. -- Abstract: Since August 2011 JET operates with the ITER-like wall comprising bulk Be tiles, bulk W tiles and W coated CFC tiles with a thickness of 10–15 μm and 20–25 μm. In order to evaluate behavior of the W coatings to a cyclic thermal loading relevant to JET operation, high heat flux (HHF) tests have been carried out up to 5100 pulses with an electron beam facility at peak temperatures of 1000 °C, 1250 °C and 1450 °C. The pulse duration was 24 s. Optical inspections of the W layer performed periodically by interrupting the test revealed small delaminations with the size of 50–500 μm. The dependence of the delamination percentage on the number of pulses can be seen as a degradation curve for each particular W coating. In this way the thermo-mechanical properties of the W coatings can be characterized quantitatively. Thermal fatigue and carbidization of the tungsten due to the diffusion of the carbon from the substrate have been recognized as mechanisms for degradation of the coatings. Tungsten carbides have been identified by using TEM (transmission electron microscopy) diffraction analysis on FIB (focused ion beam) prepared cross-section samples subjected to HHF tests. Nano-pores developed at the CFC–Mo and Mo–W interfaces during the tests might be also responsible for the degradation of the coating.

  8. Multi-tracer approach (18O, 3H/3He, CFC, SF6, 35S) to find the best emergency drinking water supply, Vorarlberg, Austria

    Science.gov (United States)

    Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley

    2016-04-01

    To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (tracers, otherwise would have supported the suitability of

  9. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems.

  10. International Tax Havens, CFC Rules and the Chinese Economy%国际避税地、CFC法规与中国经济

    Institute of Scientific and Technical Information of China (English)

    张巍; 黄莹

    2012-01-01

    The relationship between international tax havens and China's economic development is getting closer. China has begun to establish anti- tax framework for the economic model of international tax havens. This paper estimates the scale of FDI connected with the international tax havens in China, summarizing the tax legislation for international tax havens, and discusses the CFC rules in the balance of the two rival policies.%国际避税地与中国经济发展关系越来越紧密。针对国际避税地经济模式的税收法制框架在我国已经初具模型。本文估测了国际避税地对中国FDI的影响规模,总结了针对国际避税地的中国税收立法情况,探讨了中国受控外国公司(Controlted Foreign Corporation。以下简称CFC)法规在两大竞争性政策中的平衡问题。

  11. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2007-05-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 years, and CFC-11 measurements, give a mean residence time of 8 years for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 years and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water, with mean age 1.2 years and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusive below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs

  12. O perfil do contador e os níveis de habilidades cognitivas nos exames Enade e suficiência do CFC: uma análise sob a perspectiva da taxonomia de Bloom

    Directory of Open Access Journals (Sweden)

    Francisco Marton Gleuson Pinheiro

    2013-11-01

    Full Text Available This research identifies if the levels of cognitive skills demanded by ENADE and sufficiency exam of the CFC are adherent to the accountant profile required by the National Education Council (CNE from the perspective of Bloom’s Taxonomy. We analyzed two editions of ENADE and the last two editions of the sufficiency exams as well as the Accountants professional profile required of by Resolution CNE/CES 10/2004. The exam questions and professional profile required by the CNE were classified into two levels of cognitive skills in Bloom’s Taxonomy: the first, considering a lower cognitive level; and the second, considering a higher level. The significance test for proportions indicated that levels of cognitive skills required by ENADE and the proficiency exams are not adherent to the accountant profile provided by the CNE. Regarding the frequency of issues, it was not charged higher cognitive level, although in 2009 the ENADE has not presented significant difference between issues.

  13. Design of optical-mechanical structure made of CFC in space remote sensing camera%空间遥感相机碳纤维机身结构设计

    Institute of Scientific and Technical Information of China (English)

    郭疆; 邵明东; 王国良; 孙继明

    2012-01-01

    For demands of optical systems in a off-axis three-mirror camera on the optical-mechanical structure, an appropriate optical-mechanical structure was designed by taking Carbon Fiber Composite (CFC) as the key components of the camera. The weight of CFC in designed camera makes up 32% that of the total system. Furthermore, this optical-mechanical structure is asymmetric, the system spacing in the primary, secondary mirror is 850 mm, and the mirror positioning accuracy demands its interval, eccentric and tilt to be 0. 005 mm, 0. 005 mm, and 5", respectively. The Finite Element method was used to analyze and optimize the design, results show that the optical-mechanical structure has better stiffness, lighter weight, and can meet the requirements of optical system for intervals, eccentrics and tilts. A mechanics environmental test and a thermal vacuum test were performed, and results demonstrate that the optical-mechanical structure in the camera has excellent stability in mechanics, thermal and other environmental conditions, its first order harmonic frequencies are above 120 Hz, and the modulation transfer function is more than 0. 2. These results prove that the proposed structure can provide reasonable spatial location and stability for the reflective mirrors in off-axis three-mirror cameras.%针对离轴三反相机光学系统对机身结构的要求,采用碳纤维复合材料制备关键部件,设计了合适的相机机身结构.设计的离轴三反相机采用的复合材料占整机重量的32%.机身结构为非对称形,光学系统中主、次镜间距为850 mm,反射镜接口定位精度要求间隔为0.005 mm、偏心为0.005 mm、倾斜为5″.通过有限元软件对设计结果进行分析、优化和检验,完成了机身结构的优化设计.计算结果表明,该机身结构具有较好的刚度、较轻的重量,能够满足光学设计对间隔,偏心和倾斜的要求.对总装完成的相机进行了力学环境试验和热真空试验,结

  14. 76 FR 72452 - CFC-50 Commission

    Science.gov (United States)

    2011-11-23

    ...'' groups. The Commission is co-chaired by Thomas Davis and Beverly Byron. The meeting is open to the public... INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign, U.S. Office of...

  15. 77 FR 10004 - CFC-50 Commission

    Science.gov (United States)

    2012-02-21

    ...'' groups. The Commission is co- chaired by Thomas Davis and Beverly Byron. The meeting is open to the..., 78205. FOR FURTHER INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign,...

  16. 76 FR 53159 - CFC-50 Commission Meeting

    Science.gov (United States)

    2011-08-25

    ... ``watchdog'' groups. The Commission is co- chaired by Thomas Davis and Beverly Byron. The meeting is open to... 20415. FOR FURTHER INFORMATION CONTACT: Keith Willingham, Director, Combined Federal Campaign,...

  17. Dicty_cDB: CFC550 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rkiella histriomuscorum turgor ... 221 1e-56 AY847462_1( AY847462 |pid:none) Acan...6_1( AF323586 |pid:none) Oryza sativa aldehyde dehydrogenas... 222 5e-57 AY883858_1( AY883858 |pid:none) Ste

  18. Dicty_cDB: CFC458 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BQ867133.1 QGC9O01.yg.ab1 QG_ABCDI lettuce salinas Lactuca sativa cDNA clone QGC...9O01, mRNA sequence. 36 6e-04 3 BQ858872 |BQ858872.1 QGC11H15.yg.ab1 QG_ABCDI lettuce salinas Lactuca sativa

  19. Dicty_cDB: CFC309 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available shock pr... 239 1e-61 AF006542_1( AF006542 |pid:none) Drosophila pseudoobscura bogotana ... 238 3e-61 AF0065...osophila pseudoobscura bogotana ... 238 3e-61 ( O16087 ) RecName: Full=Heat shock

  20. Dicty_cDB: CFC647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available boxylase isozyme 3 mRNA, complete cds. 58 2e-07 2 CK273593 |CK273593.1 EST719671 potato abiotic stress cDNA ...', mRNA sequence. 64 2e-07 2 CD008053 |CD008053.1 VVB082D05_335234 An expressed sequence tag database for abiotic... VVB082D05 5, mRNA sequence. 64 4e-07 2 CD006712 |CD006712.1 VVB066D06_332552 An expressed sequence tag database for abiotic...NA sequence. 64 4e-07 2 CD719214 |CD719214.1 VVB158G03_410335 An expressed sequence tag database for abiotic

  1. Dicty_cDB: CFC343 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for suppressing growth of plasmodium. 58 1e-18 6 BD183625 |BD183625.1 Material for diagnosing malaria and im...mune antigen for suppressing growth of plasmodium. 58 1e-18 6 U00152 |U00152.1 Plasmodium falciparum enolase

  2. Dicty_cDB: CFC544 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yellr*rsmyinrmr*wrmyi*vdlwirrfi iwccrfiiwccrfii*cy*ffryyy*ffirypntntitfpstitfpn*ytn*ytnatnps snsn*rskdl*rsrr...*vay*lvk Frame B: ---lpykel**w*ylfn*wl*ywfwmy*ftykl**wklly*rll*sniwmftyrncklh* mfrnrlyncspmfpsnm*qfk**plcc*c

  3. Dicty_cDB: CFC523 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stssss* sks*snsncnntn*yw*nkyskq*q*q*ykfxksctw**fx*fik*fnixs*ry*fnrtn itwymwwls*tnlw*nyssng*ilssrtfclrxlyes...iswwflxr**w*til*rls**ii clk*nkikknkkkinnkw*fpqk*iyi*in*myqiklinkk Frame C: llaywxyf

  4. Dicty_cDB: CFC248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 576997 |BQ576997.1 PfESToab12e02.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' sim...ce. 54 2e-07 3 BU497494 |BU497494.1 PfESToab64b06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falci...:Q19130 Q19130 F07A11.2 PROTEIN. [1] ;, mRNA sequence. 36 7e-04 3 BU496736 |BU496736.1 PfESToab58b09.y1 Plasmodium falciparum 3D7 ase...xual cDNA Plasmodium falciparum cDNA 5' similar to SW:GLMS_SYNY3 P72720 GLUCOSAMINE

  5. Dicty_cDB: CFC256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions... for synthesis of longfatty acids in plants. 1306 0.0 1 BD082645 |BD082645.1 Methods and compositions for sy...nthesis of long chain polyunsaturated fatty acids. 1306 0.0 1 BD082630 |BD082630.1 Methods and compositions

  6. Dicty_cDB: CFC796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 58 9e-07 2 CF806266 |CF806266.1 psHB007xC07f USDA-IFAFS:Expression of Phytophthora sojae genes during infection and propaga...tion Phytophthora sojae cDNA clone sHB007C07 5, mRNA seq

  7. Dicty_cDB: CFC760 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' sim...12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744 O65744 ...9d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744 O6574...cima018l21, 5'end, single read. 46 7e-08 4 BI315670 |BI315670.1 saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS...quence. 62 1e-07 2 AI437629 |AI437629.1 sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS

  8. Dicty_cDB: CFC791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YFTNKTLFGNVNNEKRKSKQPKYKYLSHHLLTSNTKLSSNKSENWFGIDNGSD YKRFFARTVAEKDMWVQHIQPCIDKATEIKTLKDNKK*virifirn...YLSHHLLTSNTKLSSNKSENWFGIDNGSD YKRFFARTVAEKDMWVQHIQPCIDKATEIKTLKDNKK*virifirnityylxi* Homology vs CSM-cDNA Sc

  9. Dicty_cDB: CFC203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a ... 40 0.17 EF084406_1( EF084406 |pid:none) Picea sitchensis clone WS02712_K12... 39 0.38 ( P56873 ) RecName: Full=Sjoe... days embryo whole ... 37 1.4 ( O60232 ) RecName: Full=Sjoegren syndrome/scleroderma autoantigen... 36 1.9 B

  10. Dicty_cDB: CFC368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FSLNFFFFFFKKKP--- ---GSXALTXDFXQLERXIHSXXNXXLEXWXXXXRDKECXAXXKXGIVSX*kxckxxxrx xxekisx*xxdqvxxgvxgyvgxqvxiki...kravgvvklxfxknlxxnxxxxxxlkmxxxk kvxglxhexldxpnxnxffxxlndrnlxxpfhgxqyh*ixqhcipyl*mkxnmslildli hfeyff*xx*nllgm...rtfgtsdays*stltlvstyyqslriesklimtksrs rlateqtergtsmgseesrlkvvqrk*qckleqtlfyfffseffffff*kktp--- ---mgxkh*xxixsswkxifivnxxxn*sxgxvx...xeirnaxlxxkxxlylxkxvvxxxxx xxxkklvxsxxikxfxx*xxtlvxrwxlr*reqlg*lnyxfxktfxsixkxxxxxkwxxx...artrallgplgqathtvdph*rwcrhtisl*glkvs***PSQGP GWQQSRQSEAHRWVARKVDLKSSKGNNNVNSNKPYF

  11. Dicty_cDB: CFC186 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 67470-3108875 strain AX4, complete sequence. 38 1.4 11 AJ537965 |AJ537965.1 Timarcha balearica EST, clone Timarcha...5F6. 44 2.1 1 AJ537906 |AJ537906.1 Timarcha balearica EST, clone Timarcha4H

  12. Dicty_cDB: CFC102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 4e-12 2 D88434 |D88434.1 Malus domestica mRNA for protein abundantly expressed during apple fruit develo...pment, complete cds. 72 1e-08 1 AY034889 |AY034889.1 Tortula ruralis aldehyde dehyd

  13. Dicty_cDB: CFC675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kikirn*t Frame B: sgissiagitnqassianaisggniagvttsqsstgiisgviaggsgsitspqsitgqss tgiisgvisggnsvaggsgsvgnsgsitg...lttnggisggnaiagvttsnsiaqtgsvtgl tangiagsvgglttansltgvgsignianaistglvgqittskptvsst

  14. Dicty_cDB: CFC757 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qaqahhqaaqahqaahhhhhqaaqvhhlqalhqaqvaqalh qaqaaqalh--- ---*ssssssssssssxxxx*sssxxx**sssxxxx***xxxrxxx...rxxsxxxx*xxxxx ssssxrxxxsss*xssxxrxxxcssxxxxxxcxxxxxsxxxxxxxxxxxxxxxxsxxxxs xxxx*xxxxxxxxxxsxxxxxxxxxxxxxxxxxxxx...ssxxxxxsxxxsssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssssssss...SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSS--- ---iiiiiiiiiiiixkxkxiiixxxmmiiixxxxxmmxxxkxxxkxxixkxxxxxxxx...i iiixkxxxiiimxxixxkkxxlfixxxxxxxxxxxxxxmxxxxlxxxxxlxxxxlxxxlx xxxxxxqxxxxlxxxqxxxxlxxxlxxxxxxxxxllxxxxllxxxxx

  15. Dicty_cDB: CFC748 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AETNKKLERLLISLNLLGGLIGGTNGPPIAASINTQNEPDNRQNAPIAQNFQQYQQNQPI PNQNQISNQNQISNQNQNQNQNQNQ--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxixkxxxkxxxxx...xxiignxxixvxxxkkxv xxhwxfxxxwkxxxmkxikrnlmnlxqf*mrfqifqf...ikikfqikikfqikikikikiki--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxnxxxl*gxxxxxxnxxkxxf xcigxsxxigkxxx

  16. Dicty_cDB: CFC703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence (All Frames) Frame A: ---ssxsssssssx*xxxxssxrxxxsssxrx**xxss*xxxxxxxxxxxx*xxx*xsss sxrxx*xss*xxx...**xrxxxxxxxxxxxcxxxxxsxxxxxcxxxxxxxxxxxxxxxxxxs xxxxxxxxxxxxsxxxxxxxxsxxxxxxxsxxxxsxxxxx...HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHQAQAAHQVQAQAVLAQAV LVQGRKXI*xi* Frame C: ---ixiiiiiiixmxxxxiixkxxxiiixkxmmxxiimxxxxxxxxmxxxxxxxxx...iiii xkxxmxiimxxxmmxkxxxxxxxxxxxxxxmxxxxmxxxxxxxxxxlxxxqxxxxlxxxq xxxxxxxxlxxxqxxxxlxxxlxxxxxxxxxllxxxxlxxxx...xxiiiiiiiiiiiiiiii iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

  17. Dicty_cDB: CFC585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PKPITXXA TTTXAAAVQLLQQXGFDQLPVVSESKKVLGQLTLGNLLSHIASKKAVPTDAXSKVMXRFX KNEKYIPITQS...*lnqplvtlvlv*h *qqpskvtk*slhsqrkchkrklms*KHWEQRSFVHQLKQHFDAPESHIGVAKK--- ---ixrfhxklydqtfk**lvsrqwfr*srxqn*r...DQQEEEKYHGAXVKXLTLPKPITXXA TTTXAAAVQLLQQXGFDQLPVVSESKKVLGQLTLGNLLSHIASKKAVPTDAXSKVMXRFX KNEKYIPITQSTSLATLSKF

  18. Dicty_cDB: CFC385 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LAGHMPSDTDAQVPELNV--- ---VSYXPQKXDPKXPGSVRELINKRICNTFLHXQFQSDVVKPLNIENIIDNQVLNLSGG ELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIIVSKVIXRF...NMRFR KDALTFKFSETAENEEEIKKHCNYKYPNMTKTMGTFKLEIKAGQFTDSEIIVMLGQNGTG KTTFIRMLAGHMPSDTDAQVPELNV--- ---cqlqxtkxrskixrf...- ---VSYXPQKXDPKXPGSVRELINKRICNTFLHXQFQSDVVKPLNIENIIDNQVLNLSGG ELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIIVSKVIXRF

  19. Dicty_cDB: CFC823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PDVTRRFLKENNLSTIIRSHEVKEKGYQI DDDGSLITVFSAPNYCDQSGNLGSFINITEDKIKITTFEAVXHPNIPPMHYAKK Translated Amino Acid s...TLDDIRKIKRNAPDPK DNELVQCLLWSDPQSNPGIAPSSRGVGVYFGPDVTRRFLKENNLSTIIRSHEVKEKGYQI DDDGSLITVFSAPNYCDQSGNLGSFINI...TEDKIKITTFEAVXHPNIPPMHYAKK Frame C: cwptgisfffyxdx*kkk*KXXXVETXEFPRXKXESXENSXLSXPDA

  20. Dicty_cDB: CFC509 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dpm*ylnpscprktnphw*rrryss*inw*scqrsndptc*pnppq*rsc hhsrsplkcwwchciil*mvkesfsrsfrsfeqemgrilkeiiiric*isrqqeiir...ptryfh*fprch qhcrlcqslrdpm*ylnpscprktnphw*rrryss*inw*scqrsndptc*pnppq*rsc hhsrsplkcwwchciil*mvkesfsrsfrsfeqemgrilke

  1. Dicty_cDB: CFC680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available igsi*nw*wsn*kkirwscw*c*fgnvfpkw*gytkwfl***ikdlgcyr rhmrlyigrthrwynigiig*sw*kfsimf...KLDGHVGDVDLAMFFPSGRVILSGSSDSRLKIWDAIE GTCASTLVGHIGGITSASLVDRGRNLVSCSRDG--- ---simft*wyk*imgytniidhfkfnkiiktn

  2. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING CFC INCINERATION

    Science.gov (United States)

    The report gives results of experiments to assess: (1) the effect of residual copper retained in an incineration facility on polychlorinated dibenzo-p-dioxin and dibenzofuran (PCDD/PCDF) formation during incineration of non-copper-containing chlorofluorocarbons (CFCs); and (2) th...

  3. Dicty_cDB: CFC792 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ate 2001. 6. 1 Translated Amino Acid sequence iyftthsivcv*YKFCNSRMLKKHRVLIIVIVMTL...krgwygc**kylnaistkiihsk*wyrciy*rkkyflvhigcntlfnylc rvg*nlfkrfks*r*nlfs*rslvkrtnh*fqner*ny*insksrnxsficrfrflwhsk klp Frame B: iyftth

  4. Dicty_cDB: CFC754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NNNNINQNHQHQHQHHHHQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQXYGESTTSTXMIPPSITTSLTPLTPTLSSQPQN IQQQQQQXHHHQQQHHHH--- --...Frame A: TVGLLDINWGHYMIMTTNNNSNNNNNNNNNNNNNNNNNNNNNINQNHQHQHQHHHHQQQQ QQQQQQQQQQQQQQQQQQQQQQQQQQQXYGESTTSTXM

  5. Dicty_cDB: CFC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...nts: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  6. 77 FR 28639 - Meeting of the CFC-50 Commission

    Science.gov (United States)

    2012-05-15

    ...'' groups. The Commission is co-chaired by Thomas Davis and Beverly Byron. The meeting is open to the public... CONTACT: Keith Willingham, Director, Combined Federal Campaign, U.S. Office of Personnel Management,...

  7. Early work on the stratospheric ozone depletion-CFC issue

    Science.gov (United States)

    Molina, M.

    2012-12-01

    I became involved with the atmospheric chemistry of chlorofluorocarbons (CFCs) shortly after joining Sherry Rowland's research group at the University of California, Irvine, in 1973. CFCs had been detected in the troposphere by James Lovelock in 1971, and the question we set out to answer was the fate of these compounds of industrial origin in the environment, as well as possibly identifying any consequences of their accumulation in the atmosphere. After examining many potential sinks for these compounds we realized that because of their unusual stability the most likely destruction process was photolysis in the stratosphere. I carried out measurements of the absorption spectra of these compounds in the near ultraviolet; previous work involved only spectra in the far ultraviolet, not relevant for atmospheric chemistry. The results indicated that photolysis would take place in the upper stratosphere. I subsequently carried out calculations using one-dimensional atmospheric models to estimate their atmospheric residence times, which turned out to be many decades. We realized that the chlorine atoms generated by photolysis of the CFCs would participate in a catalytic chain reaction that would efficiently destroy ozone. Furthermore, we estimated that the amount of CFCs produced industrially was comparable to the amount of nitric oxide produced naturally in the stratosphere by the decomposition of nitrous oxide; work by Paul Crutzen and Harold Johnston had indicated that the abundance of ozone in the stratosphere was controlled by nitric oxide. We then formulated the hypothesis that the continued release of CFCs to the environment posed a threat to the stability of the ozone layer, and published our results in the journal Nature in 1974. The publication was noticed almost exclusively by the community of experts in stratospheric chemistry, and hence Sherry Rowland and I decided at that time that it was our responsibility to communicate this finding to society at large, and particularly to decision makers in government, while at the same time promoting additional scientific research to test the validity of our hypothesis.

  8. Percepção dos contadores sobre o Exame de Suficiência do CFC = Accountant's perceptions about the Exam of Sufficiency of CFC

    Directory of Open Access Journals (Sweden)

    Nadielli Galvão

    2016-07-01

    Full Text Available O objetivo deste estudo é verificar a percepção dos contadores quanto à realização do Exame de Suficiência. Os dados foram coletados por meio de um survey com contadores cadastrados em grupos de discussão contábil em uma rede social. O instrumento de coleta de dados foi composto de perguntas acerca do perfil dos respondentes, da sua percepção quanto à realização e à abordagem da prova aplicada, e trouxe a oportunidade dos contadores destacarem sugestões para a melhoria da avaliação. Como principais resultados são destacados o fato de 81,82% dos respondentes acreditarem que o exame proporciona valorização profissional e 82,73% perceberem que o exame ajuda a selecionar os profissionais mais capacitados. 89,55% dos respondentes são a favor da continuidade da avaliação, 53,61% acreditam que esta avaliação necessita de algumas melhorias. A principal recomendação apontada pelos participantes foi a necessidade de uma melhor adequação da prova à realidade empresarial. The purpose of this study was to verify the accountant's perceptions about the realization of exam of sufficiency. The data was collected by a survey with accountants cadastrated in a group of accounting discussion in a social network. The instrument of collect data was compost with questions about the profile of respondents, their perceptions about the realization and test approach, as well as brought the opportunity of accountants stand out suggestions for improving evaluation. How main results are outstanding the fact that 81,82% of respondents believe that the exam bring professional valorization and 82,73% realize the exam help to select the professionals more qualified. 89,55% of answerer are in favor that the continuity of exam, but 53,61% believe that is necessary some improvements. The main recommendation indicated by respondents was the necessity a better adequation of the test to reality of organizations.

  9. Replacement of CFCs in thermodynamical systems; Remplacement des CFC dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Some chlorofluorocarbons (CFCs) are well-adapted to coldness production by vapour compression and thus are widely used in the storage of agriculture-food products from the production to the domestic consumer but also in air-conditioning systems and heat pumps. Atmospheric impacts of the use of CFCs (`ozone hole`) led the international community to adopt remedial measures which aim to prohibit the production of CFCs. These constraints led the users of refrigerating fluids to use substitution fluids and to develop new techniques of energy recovery and heat/coldness production. This workshop takes stock of this situation and of the problems encountered by the various actors involved in the replacement of CFCs in thermodynamical systems: evolutions of regulation, point of view of refrigerating fluid producers and of compressors and heat exchangers manufacturers, research studies on substitution fluids, recovery of CFCs and other refrigerating fluids, revival in the use of natural fluids (like ammonia), and use of new thermodynamical systems like compression/absorption (water/ammonia) cycles. (J.S.)

  10. Thermo-mechanical tests of a CFC divertor mock-up

    Science.gov (United States)

    Cardella, A.; Akiba, M.; Duwe, R.; Di Pietro, E.; Suzuki, S.; Satoh, K.; Reheis, N.

    1994-04-01

    Thermo-mechanical tests have been performed on a divertor mock-up consisting of a metallic tube armoured with five carbon fibre composite tiles. The tube is inserted inside the tiles and brazed with TiCuSil braze (monoblock concept). The tube material is TZM, a molybdenum alloy, and the armour material is SEP CARB N112, a high conductivity carbon-carbon composite. Using special surface preparation consisting of laser drilling, small (˜- 500 μm) holes in the composite have been made to increase the surface wetted by the braze and the resistance. The mock-up has been tested at the JAERI 400 kW electron beam test facility JEBIS. The aim of the test was to assess the performance of the mock-up in screening and thermal fatigue tests with particular attention to the behaviour of the armour to heat sink joint.

  11. Heat Transfer Evaluation of HFC-236EA and CFC-114 in Condensation and Evaporation

    Science.gov (United States)

    1996-06-01

    41 7.2 Sieder -Tate coefficient data for the four tubes of interest...5.13 STC -- Sieder -Tate coefficient t -- fin thickness (in) T - temperature (C) AT - excess temperature (C) (= Tsat - Tw for condensation and = Tw - Tst...straight line, where X Ak& and (7.9) ii Re°S Pr- 33 °4 r= o- AR . (7.10) Therefore, the slope of the line (m) is the inverse of the required Sieder -Tate

  12. Moving Advanced Desiccant Materials into Mainstream Non-CFC Cooling Products

    Energy Technology Data Exchange (ETDEWEB)

    Sand, J. R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Grossman, T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rice, C. K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Fairchild, P. D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gross, I. L. [Engelhard/ICC, Hatboro, PA (United States). Fresh Air Solutions

    2004-12-30

    Desiccant dehumidification technology is emerging as a technically viable alternative for comfort conditioning in many commercial and institutional buildings. Attempts to improve the indoor air quality of buildings has resulted in increasingly stringent guidelines for occupant outdoor air ventilation rates. Additionally, revised building heating, ventilating, and air-conditioning (HVAC) design criteria based on regional peak dew point data highlight the important of the latent (moisture removal) building load relative to the sensible (temperature) building load.

  13. Cf/C composites: correlation between CVI process parameters and Pyrolytic Carbon microstructure

    Directory of Open Access Journals (Sweden)

    F. Burgio

    2014-10-01

    Full Text Available Chemical Vapour Infiltration (CVI technique has been long used to produce carbon/carbon composites. The Pyrolytic Carbon (Py-C matrix infiltrated by CVI could have different microstructures, i.e. Rough Laminar (RL, Smooth Laminar (SL or Isotropic (ISO. These matrix microstructures, characterized by different properties, influence the mechanical behaviour of the obtained composites. Tailoring the process parameters, it is possible to direct the infiltration towards a specific Py-C type. However, the factors, influencing the production of a specific matrix microstructure, are numerous and interconnected, e.g. temperature, pressure, flow rates etc. Due to the complexity of the physical and chemical phenomena involved in CVI process, up to now it has not been possible to obtain a general correlation between CVI process parameters and Py–C microstructure. This study is aimed at investigating the relationship between infiltration temperature and the microstructure of obtained Py-C, for a pilot - sized CVI/CVD reactor. Fixing the other process parameters and varying only the temperature, from 1100°C to 1300°C, the Py-C infiltration was performed on fibrous preforms. Polarized light microscopy, with quantitative measurements of average extinction angle (Ae, and Raman spectroscopy were used to characterize the obtained Py-C microstructures

  14. Cf/C composites: correlation between CVI process parameters and Pyrolytic Carbon microstructure

    Directory of Open Access Journals (Sweden)

    F. Burgio

    2014-10-01

    Full Text Available Chemical Vapour Infiltration (CVI technique has been long used to produce carbon/carbon composites. The Pyrolytic Carbon (Py-C matrix infiltrated by CVI could have different microstructures, i.e. Rough Laminar (RL, Smooth Laminar (SL or Isotropic (ISO. These matrix microstructures, characterized by different properties, influence the mechanical behaviour of the obtained composites. Tailoring the process parameters, it is possible to direct the infiltration towards a specific Py-C type. However, the factors, influencing the production of a specific matrix microstructure, are numerous and interconnected, e.g. temperature, pressure, flow rates etc. Due to the complexity of the physical and chemical phenomena involved in CVI process, up to now it has not been possible to obtain a general correlation between CVI process parameters and Py–C microstructure. This study is aimed at investigating the relationship between infiltration temperature and the microstructure of obtained Py-C, for a pilot - sized CVI/CVD reactor. Fixing the other process parameters and varying only the temperature, from 1100°C to 1300°C, the Py-C infiltration was performed on fibrous preforms. Polarized light microscopy, with quantitative measurements of average extinction angle (Ae, and Raman spectroscopy were used to characterize the obtained Py-C microstructures.

  15. Infrared measurements of increased CF(2)Cl(2) (CFC- 12) absorption above the South Pole.

    Science.gov (United States)

    Rinsland, C P; Goldman, A; Murcray, F J; Murcray, F H; Murcray, D G; Levine, J S

    1988-02-01

    High-resolution ground-based solar spectra recorded at the Amundsen-Scott South Pole station in Dec. 1980 and Nov. 1986 have been analyzed in the region of the CF(2)Cl(2) (chlorofluorocarbon 12) nu(8) band Q branches at 1161 cm(-1). An increase in the CF(2)Cl(2) total vertical column above the South Pole of 1.24 +/- 0.15 over the 6-yr period, corresponding to an average rate of increase of 3.6 +/- 2.1%, is derived. This rate of increase is lower than indicated by in situ measurements at the South Pole over the same time period, but there is agreement when the rather error bars of the spectral measurement results are considered. Spectroscopic parameters that can successfully model CF(2)C1(2) absorption at low temperatures are needed to improve retrieval accuracies and could be applied to a number of pre-1980 atmospheric spectral data sets in the literature to obtain an improved record of early CF(2)Cl(2) concentration trends for comparison with estimates of historical release rates.

  16. Decomposition of CFC and Halon waste gases in normal-pressure plasma reactors

    Institute of Scientific and Technical Information of China (English)

    1999-01-01

    The normal-pressure decomposition of CF2Cl2 and CF2ClBr in air by non-equilibrium plasma was studied. The pressure of CF2Cl2 and CF2ClBr was 2.67x103Pa, added the dry air to 1.01 x 105 Pa, discharged by corona or DBD, 11.5% of CF2ClBr was decomposed by corona after 120s discharge, more than 85% of CF2Cl2 and 95% of CF2ClBr was decomposed by DBD after 10s discharge respectively. The main products were CF2O, Cl2 and Br2.

  17. IDENTIFICATION OF CFC AND HCFC SUBSTITUTES FOR BLOWING POLYURETHANE FOAM INSULATION PRODUCTS

    Science.gov (United States)

    The report gives results of a cooperative effort to identiry chlorofluorocarbons and hydrochlorofluorocarbon substitutes for blowing polyurethane foam insulation products. The substantial ongoing effort is identifying third-generation blowing agets for polyurethane foams to repla...

  18. Catalytic Decomposition of CFC-12 over Heteropolyacids%杂多酸催化分解氟里昂-12

    Institute of Scientific and Technical Information of China (English)

    马臻; 华伟明; 唐颐; 高滋

    2000-01-01

    @@ Chlorine atoms from chlorofluorocarbons (CFCs) deplete stratospheric ozone and CFCs are green-house gases too. Owing to these environmental problems, many kinds of CFCs have been banned since the Montreal Protocol and two kinds of cleaning techniques have been developed. One is the synthesis of CFCs alternatives[1,2] and the other is the decomposition of banned CFCs in existing equipments[3,4].

  19. The lifetime of CFC substitutes studied by a network trained with chaotic mapping modified genetic algorithm and DFT calculations.

    Science.gov (United States)

    Lü, Q; Wu, H; Yu, R; Shen, G

    2004-08-01

    The hydrohaloalkanes have attracted much attention as potential substitutes of chlorofluorocarbons (CFCs) that deplete the ozone layer and lead to great high global warming. Having a short atmospheric lifetime is very important for the potential substitutes that may also induce ozone depletion and yield high global warming gases to be put in use. Quantitative structure-activity relationship (QSAR) studies were presented for their lifetimes aided by the quantum chemistry parameters including net charges, Mulliken overlaps, E(HOMO) and E(LUMO) based on the density functional theory (DFT) at B3PW91 level, and the C-H bond dissociation energy based on AM1 calculations. Outstanding features of the logistic mapping, a simple chaotic system, especially the inherent ability to search the space of interest exhaustively have been utilized. The chaotic mapping aided genetic algorithm artificial neural network training scheme (CGANN) showed better performance than the conventional genetic algorithm ANN training when the structure of the data set was not favorable. The lifetimes of HFCs and HCs appeared to be greatly dependent on their energies of the highest occupied molecular orbitals. The perference of the RMSRE comparing to RMSE as objective function of ANN training was better for the samples of interest with relatively short lifetimes. C(2)H(6) and C(3)H(8) as potential green substitutes of CFCs present relatively short lifetimes.

  20. Infrared measurements of increased CF/sub 2/Cl/sub 2/ (CFC-12) absorption above the South Pole

    Energy Technology Data Exchange (ETDEWEB)

    Rinsland, C.P.; Goldman, A.; Murcray, F.J.; Murcray, F.H.; Murcray, D.G.; Levine, J.S.

    1988-02-01

    High-resolution ground-based solar spectra recorded at the Amundsen-Scott South Pole station in Dec. 1980 and Nov. 1986 have been analyzed in the region of the CF/sub 2/Cl/sub 2/ (chlorofluorocarbon 12) atgn/sub 8/ band Q branches at 1161 cm/sup arrow-right-left//sup 1/. An increase in the CF/sub 2/Cl/sub 2/ total vertical column above the South Pole of 1.24 atmapprox. = 0.15 over the 6-yr period, corresponding to an average rate of increase of 3.6 atmapprox. = 2.1%, is derived. This rate of increase is lower than indicated by in situ measurements at the South Pole over the same time period, but there is agreement when the rather error bars of the spectral measurement results are considered. Spectroscopic parameters that can successfully model CF/sub 2/Cl/sub 2/ absorption at low temperatures are needed to improve retrieval accuracies and could be applied to a number of pre-1980 atmospheric spectral data sets in the literature to obtain an improved record of early CF/sub 2/Cl/sub 2/ concentration trends for comparison with estimates of historical release rates.

  1. ANÁLISE EXPERIMENTAL DO HIDROCARBONETO R290 PARA A SUBSTITUIÇÃO DO CFC12 EM REFRIGERADOR DOMÉSTICO

    Directory of Open Access Journals (Sweden)

    Jucelino Gomes da Silva

    2011-03-01

    Full Text Available Recentemente, muita atenção tem sido dada aos chamados fluidos naturais, que são menos agressivos ao meio ambiente e também apresentam grande importância na necessidade latente do aumento da eficiência energética dos equipamentos em comparação aos fluidos sintéticos. O presente trabalho trata de uma análise experimental do hidrocarboneto propano (R290 como fluido refrigerante em um bebedouro de água potável projetado para operar com R12 numa estratégia de drop-in. O bebedouro foi preparado através da instalação de um manômetro na linha de alta pressão e um na linha de baixa pressão, termopares em cinco pontos estratégicos do ciclo termodinâmico: sucção do compressor, descarga do compressor, saída do condensador, entrada do evaporador e saída do evaporador, além da medição da temperatura da água e do ambiente. O ensaio de abaixamento de temperatura foi realizado durante 90 minutos sem atuação do termostato. A carga do hidrocarboneto propano (R290 aplicado ao equipamento foi reduzida em 61,5% com relação ao R12. Foram monitorados os dados de pressões de sucção e descarga do compressor, corrente elétrica consumida pelo compressor e temperaturas nos pontos do ciclo de refrigeração. Os parâmetros obtidos do ensaio foram comparados através do uso do software Coolpack, onde os diagramas pressão-entalpia (P-h para os fluidos foram obtidos e as características operacionais de trabalho de compressão, efeito refrigerante, efeito de condensação e coeficiente de performance (COP foram estudadas. Os resultados obtidos demonstraram um consumo de corrente elétrica 30% inferior em relação à operação com R12, porém, com muitas oscilações durante o tempo. As pressões para o R290 se apresentaram maiores em comparação com o R12. A razão de pressões do R290 foi 28% menor que para o R12. Após 16 minutos de funcionamento ocorreu a formação de gelo na serpentina do evaporador. O COP obtido para o R290 foi de 2,60, enquanto que para o R12 foi de 2,43. A utilização do hidrocarboneto se mostrou eficiente para o equipamento de pequeno porte. Sendo compatível com o óleo do compressor e não necessitando de substituição de nenhum componente do sistema além de permitir a redução da quantidade de fluido refrigerante do sistema. PALAVRAS-CHAVE: eficiência energética, propano, refrigerador doméstico; drop-in.

  2. Greater repertoire and temporal variability of cross-frequency coupling (CFC modes in resting-state neuromagnetic recordings among children with reading difficulties

    Directory of Open Access Journals (Sweden)

    Stavros I Dimitriadis

    2016-04-01

    Full Text Available AbstractCross-frequency, phase-to-amplitude coupling (PAC between neuronal oscillations at rest may serve as the substrate that supports information exchange between functionally specialized neuronal populations both within and between cortical regions. The study utilizes novel algorithms to identify prominent instantaneous modes of cross-frequency coupling and their temporal stability in resting state magnetoencephalography (MEG data from 23 students experiencing severe reading difficulties (RD and 27 age-matched non-impaired readers (NI.Phase coherence estimates were computed in order to identify the prominent mode of PAC interaction for each sensor, sensor pair, and pair of frequency bands (from δ to γ at successive temporal segments of the continuous MEG record. The degree of variability in the characteristic frequency-pair PACf1-f2 modes over time was also estimated. Results revealed a wider repertoire of prominent PAC interactions in RD as compared to NI students, suggesting an altered functional substrate for information exchange between neuronal assemblies in the former group. Moreover, RD students showed significant variability in PAC modes over time. This temporal instability of PAC values was particularly prominent: (a within and between right hemisphere temporal and occipitotemporal sensors and, (b between left hemisphere frontal, temporal, and occipitotemporal sensors and corresponding right hemisphere sites. Altered modes of neuronal population coupling may help account for extant data revealing reduced, task-related neurophysiological and hemodynamic activation in left hemisphere regions involved in the reading network in RD. Moreover, the spatial distribution of pronounced instability of cross-frequency coupling modes in this group may provide an explanation for previous reports suggesting the presence of inefficient compensatory mechanisms to support reading.

  3. 基于CFC软件的SIMADYND传动控制系统%SIMADYN D Drive Control System Based on CFC Software

    Institute of Scientific and Technical Information of China (English)

    蒋金明; 刘华; 谢邦立

    2004-01-01

    介绍了CFC软件在梅山热轧厂主传动控制系统SIMADYN D中的应用,并通过与STRUC G的对比,阐述了CFC在硬件配置和软件编程上的特点,最后介绍了传动系统的主要功能.

  4. Toxicology evaluation and hazard review for non-CFC containing rigid foams BKC 44317 and last-a-foam MSL-02A

    Energy Technology Data Exchange (ETDEWEB)

    Greulich, K.A.; Archuleta, M.M.

    1996-06-01

    New pour-in-place, low density, rigid polyurethane foam kits have been developed to mechanically stabilize damaged explosive ordnance. Although earlier foam systems used chlorofluorocarbons as blowing agents, the current versions rely on carbon dioxide generated by the reaction of isocynates with water. In addition, these kits were developed to manually generate small quantifies of rigid foam in the field with minimal or no protective equipment. The purpose of this study was to evaluate and summarize available hazard information for the components of these rigid foam kits and to provide recommendations for personal protective equipment to be used while performing the manual combination of the components. As with most rigid foam systems, these kits consist of two parts, one a mixture of isocyanates; the other, a combination of polyols, surfactants, and amine catalysts. Once completely deployed, the rigid foam is non-toxic. The components, however, have some important health effects which must be considered when establishing handling procedures.

  5. DISLOCATIONS MOBILITY UNDER THE IMAGE FORCE EFFECT IN BICRYSTALS OF CFC MATERIALS: CU-X, X = PB, AL, AU, AG AND NI

    Directory of Open Access Journals (Sweden)

    A OUCHTATI

    2015-06-01

    Full Text Available The image force undergone by a matrix dislocations close and parallel to an interphase boundary is studied in Cu-X bicrystals (with X = Pb, Al, Au, Ag, Ni for disorientations ranging between 0° and 90°.  Dislocations have a Burgers vector  = a/2 [110]. The elastic energy of dislocation-boundary interaction is calculated within the framework of anisotropic linear elasticity. The elastic energy is related to the difference of the two metals shear moduli. It is about a few hundred pico Joule per meter. The image force can be repulsive or attractive according to the sign and the intensity of shear moduli difference. The isoenergy maps have various symmetries according to the disorientation.

  6. Experimental SF6/-//SF6 and Cl/-//CFC13 electron-attachment cross sections in the energy range 0-200 meV

    Science.gov (United States)

    Chutjian, A.

    1981-01-01

    Experimental cross sections for the electron-attachment processes for SF6(-)/SF6 and Cl(-)/CFl3 are reported in the energy range 0-200 meV by normalizing each attachment line shape to measurement of a thermal rate coefficient. When the same ion states are detected, good agreement is found between present values, for which a monoenergetic electron source is used, and swarm-unfolded results. The present data constitute a new limit for cross sections reported at high resolution at the lowest electron energy.

  7. 40 CFR Appendix F to Subpart B of... - Standard for Recover-Only Equipment That Extracts a Single, Specific Refrigerant Other Than CFC...

    Science.gov (United States)

    2010-07-01

    ... Part 82 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED..., EPA under its Significant New Alternatives Policy program, with the exception that any flammable... lubricant is returned to the mobile air conditioning system for compressor lubrication....

  8. Diffusion of interstitial Dumbell in FCC concentrated alloys: connection with the percolation; Diffusion du defaut interstitiel dans un alliage concentre de structure CFC: lien avec la percolation

    Energy Technology Data Exchange (ETDEWEB)

    Bocquet, J.L.

    1993-12-31

    The migration mechanism of the interstitial dumbbell in a FCC (face centered cubic) lattice constrains its path on a sublattice with a coordination number of 8. In a random binary alloy AB, in which only species B has a noticeable mobility, the long range migration of the dumbbell defect is possible only if the concentration of B is larger than the percolation threshold {rho}{sub c} on the sublattice. Standard techniques have been employed to get a first evaluation of this threshold: the cluster density n(s) is obtained after an automatic counting of the clusters up to a size of 15 and a d-Log Pade approximants analysis of the various moments of this density function is performed. The use of a recent conjecture concerning the critical behaviour of the moments of n(s) in the neighbourhood of {rho}{sub c} helps us to extract simultaneously from our data reasonable values of the critical exponents {beta} and {alpha}, together with a value of {rho}{sub c} = 0.2780 + 0.0005. (Author). 16 refs., 15 figs., 7 tabs.

  9. Chlorofluorocarbon-113 in the northeast Atlantic

    Science.gov (United States)

    Haine, Thomas W. N.; Watson, Andrew J.; Liddicoat, Malcolm I.

    1995-06-01

    An automated gas Chromatographic technique to measure the concentrations of chlorofluorocarbon 113 (CFC-113:CCl2FCClF2) dissolved in seawater has been developed. The method also quantifies chlorofluorocarbons 11 and 12 (CFC-11:CCl3F and CFC-12:CCl2F2). Seawater collected from Niskin bottles in ground-glass syringes is stripped by a gas stream and concentrated on a cryogenic trap in the manner of Bullister and Weiss (1988) and Gammon et al. (1982). By isolating and heating the trap, the chlorofluorocarbon compounds are reliberated and injected onto a high-resolution capillary gas Chromatographie column, followed by electron-capture detection. The analysis time for each sample is less than 15 min. Surface seawater precisions are 2.9%, 2.4%, and 1.2% for CFC-113, CFC-11, and CFC-12, with detection limits of 0.003-0.004, 0.02, and 0.03-0.05 pmol L-1, respectively. Although these statistics do not compare favorably with other CFC-11 and CFC-12 techniques (precision ˜1%, detection limit ˜0.005 pmol L-1 (Bullister and Weiss, 1988)), the dynamic ranges of the CFC-113:CFC-11 and CFC-113:CFC-12 "ventilation ages" are 20:1, better than that of the best CFC-11:CFC-12 age, albeit with inferior precisions. Estimates of the solubility ratios of CFC-113:CFC-11 and CFC-113:CFC-12 are 0.303 and 1.22, disagreeing with the work of Wisegarver and Gammon (1988), whose CFC-113 results are believed to be boosted by coelution with methyl bromide. The optimum tracer ventilation age resolution is ±0.9 years for both CFC-113:CFC-11 and CFC-113:CFC-12 from a cast considered in the northeastern Atlantic. A plot of CFC-113:CFC-12 ventilation age is presented on an outcropping isopycnal. A strong correlation with pressure and dissolved oxygen concentration is noted and an oxygen utilization rate between 4.2 and 5.5±0.4 μmol L-1 yr-1 is implied, depending on the choice of CFC-113 atmospheric history.

  10. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  11. 次氧化锌中的氟氯对锌电解直流电单耗的影响%The Impact of Secondary Zinc Oxide to Zinc Electrolysis DC CFC Consumption

    Institute of Scientific and Technical Information of China (English)

    张前孝

    2014-01-01

    Secondary zinc oxide zinc smelting zinc metal recycled raw materials, non-ferrous metals for the re-use of our resources to make a huge contribution, while secondary zinc oxide as supplementary material zinc smelting enterprises, but also for the growth of enterprise development has achieved an indelible contribution. However, due to the production of sec-ondary raw materials from zinc oxide in various sectors of industrial waste, which determines the complexity of elements in the finished material, some of the elements of the zinc smelting enterprises, the harm is enormous, which should number of fluorine, chlorine harm brunt of this paper some relevant data production practice, focusing on the analysis of the second zinc oxide fluorine, chlorine impact on the consumption of cathode zinc DC.%次氧化锌作为锌金属的再生锌冶料原料,为我国有色金属资源的再次利用做出了巨大的贡献,同时次氧化锌作为锌冶炼企业的补充原料,也为企业的壮大发展立下了不可磨灭的贡献。但是由于生产次氧化锌的原料来自各行业的各种工业下脚料,这就决定了其成品原料中元素的复杂性,其中一些元素对锌冶炼企业来说其危害是巨大的,这其中要数氟、氯的危害最大,本文通过生产实践中的一些相关数据,着重分析了次氧化锌中的氟、氯对阴极锌直流电单耗的影响。

  12. MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR

    Science.gov (United States)

    The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...

  13. 5 CFR 950.602 - Solicitation methods.

    Science.gov (United States)

    2010-01-01

    ...) Special CFC fundraising events, such as raffles, lotteries, auctions, bake sales, carnivals, athletic... ethics regulations. CFC special fundraising events should be undertaken in the spirit of generating... financial value. Any special CFC fundraising event and prize or gift should be approved in advance by...

  14. Vademecum of chlorofluorocarbons (C. F. C. ) removal

    Energy Technology Data Exchange (ETDEWEB)

    1993-01-01

    Greenhouse gases such chlorofluorocarbons (C.F.C.) are responsible of ozone layer impoverishment. Montreal international agreement has proposed to stop production and C.F.C. using and realize C.F.C. removal. This guide book gives informations on recovery recycling and removal methods.

  15. Gastrointestinal and renal abnormalities in cardio-facio-cutaneous syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Herman, Thomas E.; McAlister, William H. [Washington University School of Medicine, St. Louis Children' s Hospital, Mallinckrodt Institute of Radiology, St. Louis, MO (United States)

    2005-02-01

    Cardio-facio-cutaneous syndrome (CFC) is an uncommon autosomal recessive condition recently distinguished from Noonan syndrome but with more marked growth failure and ectodermal dysplasia. Abdominal symptoms are frequently described but anatomic lesions in CFC have rarely been described. We have found significant anatomic abnormalities in CFC patients including antral foveolar hyperplasia, severe constipation with fecal impaction, nephrocalcinosis and renal cysts. (orig.)

  16. Study of Dissolved Chlorofluorocarbons in Lake Washington

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Measurements of three chlorofluorocarbons (CFCs): trichlorofluoromethane (CFC-11), dichlorodifluoromethane (CFC-12) and trichlorotrifluoroethane (CFC 113), along with methyl chloroform (CH3CCl3) and carbon tetrachloride (CCl4) were made in water samples from Lake Washington, using Electron Capture Gas Chromatography (EC GC). The samples were collected in mid autumn, a period when the lake's upper layer undergoes rapid cooling. At the time of sampling, a strong vertical temperature gradient was present in the lake, with surface temperatures of ~14℃, and near bottom (50 meters) temperatures of ~8℃. The concentrations of dissolved CFC 12 and CFC 11 increased with depth, as expected from the higher solubilities of these gases at lower temperatures. Atmospheric measurements made at the sampling site at the time of the cruise, showed that CFC 11 and CFC 12 saturations in the near surface samples were 100 % and 106%, respectively. For the deepest sample (52 meters) CFC 11 and CFC 12 saturations were 102 % and 126 %. Because the surface layer of the lake responds to changes in atmospheric CFCs on a time scale of several weeks, the higher than equilibrium concentrations of CFC 12 observed at the time of sampling may reflect earlier episodes of elevated levels of atmospheric CFC 12 in this urban area. High concentrations of dissolved CFCs in runoff or industrial effluent might also lead to elevated CFC levels in the lake. The cold, deep water of Lake Washington is relatively isolated from the effects of surface gas exchange except during winter, and the supersaturations observe in the deep layer may reflect periods of elevated atmospheric CFC 12 levels from the previous winter season. These results were compared to summertime profiles of CFC 11 and CFC 12 made in 1994.

  17. Groundwater recharge and flow on Montserrat, West Indies: Insights from groundwater dating

    Directory of Open Access Journals (Sweden)

    Brioch Hemmings

    2015-09-01

    New hydrological insights: δ2H and δ18O analysis indicates uniform recharge elevations for groundwaters on Montserrat. CFC-11 and CFC-12 analysis reveals age differences between isotopically similar, high elevation springs and low elevation aquifer waters. Low CFC concentrations within a confined low elevation aquifer suggest water ages of ∼45 years. High CFC concentrations in the northern and western springs are explained by rapid infiltration of cool (high CFC concentration rainfall into saturated compartments, with flow through the vadose zone to the phreatic zone dominated by compartment flow. Lower CFC concentrations in a number of aligned warmer springs suggest a contribution from older, warmer waters from depth. Temperatures and CFC concentrations indicate older component supply rates of up to 8 L/s to the highest yielding spring on Centre Hills, with contributions of up to 75% in the warmest spring waters.

  18. Temporal framing and consideration of future consequences: effects on smokers' and at-risk nonsmokers' responses to cigarette health warnings.

    Science.gov (United States)

    Zhao, Xiaoquan; Nan, Xiaoli; Iles, Irina Alexandra; Yang, Bo

    2015-01-01

    This research examines the influence of temporal framing (long-term vs. short-term) and individual difference in consideration of future consequences (CFC) on the effectiveness of cigarette health warnings among smokers and at-risk nonsmokers in a college population. An online experiment (N = 395) revealed a three-way interaction among temporal framing, CFC, and smoking status. The results among at-risk nonsmokers supported the temporal fit hypothesis--those high in CFC responded more favorably to long-term framing, whereas those low in CFC responded more positively to short-term framing. The findings among smokers revealed a different pattern in which short-term framing was more effective among high-CFC smokers, whereas among low-CFC smokers the framing effect was not distinct. Theoretical and practical implications of the findings are discussed.

  19. Long-lived halocarbon trends and budgets from atmospheric chemistry modelling constrained with measurements in polar firn

    Directory of Open Access Journals (Sweden)

    P. Martinerie

    2009-01-01

    Full Text Available The budgets of seven halogenated gases (CFC-11, CFC-12, CFC-113, CFC-114, CFC-115, CCl4 and SF6 are studied by comparing measurements in polar firn air from two Arctic and three Antarctic sites, and simulation results of two numerical models: a 2-D atmospheric chemistry model and a 1-D firn diffusion model. The first one is used to calculate atmospheric concentrations from emission trends based on industrial inventories; the calculated concentration trends are used by the second one to produce depth concentration profiles in the firn. The 2-D atmospheric model is validated in the boundary layer by comparison with atmospheric station measurements, and vertically for CFC-12 by comparison with balloon and FTIR measurements. Firn air measurements provide constraints on historical atmospheric concentrations over the last century. Age distributions in the firn are discussed using a Green function approach. Finally, our results are used as input to a radiative model in order to evaluate the radiative forcing of our target gases. Multi-species and multi-site firn air studies allow to better constrain atmospheric trends. The low concentrations of all studied gases at the bottom of the firn, and their consistency with our model results confirm that their natural sources are insignificant. Our results indicate that the emissions, sinks and trends of CFC-11, CFC-12, CFC-113, CFC-115 and SF6 are well constrained, whereas it is not the case for CFC-114 and CCl4. Significant emission-dependent changes in the lifetimes of halocarbons destroyed in the stratosphere were obtained. Those result from the time needed for their transport from the surface where they are emitted to the stratosphere where they are destroyed. Efforts should be made to update and reduce the large uncertainties on CFC lifetimes.

  20. Long-lived halocarbon trends and budgets from atmospheric chemistry modelling constrained with measurements in polar firn

    Directory of Open Access Journals (Sweden)

    P. Martinerie

    2009-06-01

    Full Text Available The budgets of seven halogenated gases (CFC-11, CFC-12, CFC-113, CFC-114, CFC-115, CCl4 and SF6 are studied by comparing measurements in polar firn air from two Arctic and three Antarctic sites, and simulation results of two numerical models: a 2-D atmospheric chemistry model and a 1-D firn diffusion model. The first one is used to calculate atmospheric concentrations from emission trends based on industrial inventories; the calculated concentration trends are used by the second one to produce depth concentration profiles in the firn. The 2-D atmospheric model is validated in the boundary layer by comparison with atmospheric station measurements, and vertically for CFC-12 by comparison with balloon and FTIR measurements. Firn air measurements provide constraints on historical atmospheric concentrations over the last century. Age distributions in the firn are discussed using a Green function approach. Finally, our results are used as input to a radiative model in order to evaluate the radiative forcing of our target gases. Multi-species and multi-site firn air studies allow to better constrain atmospheric trends. The low concentrations of all studied gases at the bottom of the firn, and their consistency with our model results confirm that their natural sources are small. Our results indicate that the emissions, sinks and trends of CFC-11, CFC-12, CFC-113, CFC-115 and SF6 are well constrained, whereas it is not the case for CFC-114 and CCl4. Significant emission-dependent changes in the lifetimes of halocarbons destroyed in the stratosphere were obtained. Those result from the time needed for their transport from the surface where they are emitted to the stratosphere where they are destroyed. Efforts should be made to update and reduce the large uncertainties on CFC lifetimes.

  1. Transport and degradation of chlorofluorocarbons (CFCs) in the pyritic Rabis Creek aquifer, Denmark

    Science.gov (United States)

    Hinsby, K.; Hojberg, A.L.; Engesgaard, P.; Jensen, K.H.; Larsen, F.; Plummer, L.N.; Busenberg, E.

    2007-01-01

    Vertical profiles of the chlorofluorocarbons CFC-11, CFC-12, and CFC-113 penetrating aerobic and anaerobic parts of a shallow sandy aquifer show that the CFC gases are degraded in the groundwater in a pyritic sand aquifer at Rabis Creek, Denmark. Two-dimensional solute transport simulations with either zero-order or first-order degradation in the anaerobic zone corroborate this interpretation. The transport model was previously calibrated against detailed tritium profiles in the same wells. First-order degradation is found to best match the observed CFC profiles yielding an approximate half-life of a few months for CFC-11. Degradation is not as clearly recognized for CFC-12 and CFC-113, but it may occur with rates corresponding to a half-life of a few years or more. Data indicate a geochemical control of the CFC concentration gradient at the redox front and that denitrification and denitrifiers are not of major importance for the observed CFC degradation. The responsible mechanism behind the observed degradation is not known but we suggest that reductive dehalogenation by surface-bound Fe(II) on pyrite possibly enhanced by the presence of Fe(III)-bearing weathering products (green rust) may be a plausible mechanism. The observed data and the performed simulations confirm the potential application of the CFC gases as age-dating tools in the aerobic part of the investigated aquifer, but also that CFC data must be analyzed carefully before it is used as a dating tool in reducing aquifers because degradation may have occurred. The use of multiple or alternative tracers should be considered in anaerobic environments. Copyright 2007 by the American Geophysical Union.

  2. Carbon fiber cloth supported interwoven WS2 nanosplates with highly enhanced performances for supercapacitors

    Science.gov (United States)

    Shang, Xiao; Chi, Jing-Qi; Lu, Shan-Shan; Gou, Jian-Xia; Dong, Bin; Li, Xiao; Liu, Yan-Ru; Yan, Kai-Li; Chai, Yong-Ming; Liu, Chen-Guang

    2017-01-01

    The interwoven WS2 nanoplates supported on carbon fiber cloth (WS2/CFC) have been successfully synthesized by a facile solvothermal process. XRD and XPS confirm the formation of WS2/CFC. SEM images show the good dispersion of WS2 nanoplates with interwoven structures on the surface of CFC. Thanks to the 3D framework of CFC, WS2 nanoplates realize overall excellent-dispersion interwoven on the surface of CFC compared with pristine bulk WS2 with severe aggregation. Moreover, CFC not only serves as excellent conductive substrate to accelerate electron transport rate, but also contributes to the close combination between WS2 and CFC for long-term stability. The electrochemical measurements show that WS2/CFC exhibit a high specific capacitance of 399 F g-1 at 1.0 A g-1, demonstrating the obviously enhanced capability compared with pristine bulk WS2. Furthermore, WS2/CFC realizes ultra-stable cycling stability with 99% of retention of capacitance after 500 charge-discharge cycles. It may provide novel access of designing carbon-based transition metal disulfides composites for excellent super capacitive properties.

  3. Flow boiling test of GDP replacement coolants

    Energy Technology Data Exchange (ETDEWEB)

    Park, S.H. [comp.

    1995-08-01

    The tests were part of the CFC replacement program to identify and test alternate coolants to replace CFC-114 being used in the uranium enrichment plants at Paducah and Portsmouth. The coolants tested, C{sub 4}F{sub 10} and C{sub 4}F{sub 8}, were selected based on their compatibility with the uranium hexafluoride process gas and how well the boiling temperature and vapor pressure matched that of CFC-114. However, the heat of vaporization of both coolants is lower than that of CFC-114 requiring larger coolant mass flow than CFC-114 to remove the same amount of heat. The vapor pressure of these coolants is higher than CFC-114 within the cascade operational range, and each coolant can be used as a replacement coolant with some limitation at 3,300 hp operation. The results of the CFC-114/C{sub 4}F{sub 10} mixture tests show boiling heat transfer coefficient degraded to a minimum value with about 25% C{sub 4}F{sub 10} weight mixture in CFC-114 and the degree of degradation is about 20% from that of CFC-114 boiling heat transfer coefficient. This report consists of the final reports from Cudo Technologies, Ltd.

  4. Data of evolutionary structure change: 1CLMA-1CFCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CLMA-1CFCA 1CLM 1CFC A A ---LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSL...GQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDDEVDEMIREADIDGDGHIN-YEEFVRMMV...bID>1CLM A 1CLMA DGHIN-YEEFV

  5. Creating a charter of collaboration for international university partnerships: the Elmina Declaration for Human Resources for Health.

    Science.gov (United States)

    Anderson, Frank; Donkor, Peter; de Vries, Raymond; Appiah-Denkyira, Ebenezer; Dakpallah, George Fidelis; Rominski, Sarah; Hassinger, Jane; Lou, Airong; Kwansah, Janet; Moyer, Cheryl; Rana, Gurpreet K; Lawson, Aaron; Ayettey, Seth

    2014-08-01

    The potential of international academic partnerships to build global capacity is critical in efforts to improve health in poorer countries. Academic collaborations, however, are challenged by distance, communication issues, cultural differences, and historical context. The Collaborative Health Alliance for Reshaping Training, Education, and Research project (funded by the Bill and Melinda Gates Foundation and implemented through academic medicine and public health and governmental institutions in Michigan and Ghana) took a prospective approach to address these issues. The project had four objectives: to create a "charter for collaboration" (CFC), to improve data-driven policy making, to enhance health care provider education, and to increase research capacity. The goal of the CFC was to establish principles to guide the course of the technical work. All participants participated at an initial conference in Elmina, Ghana. Nine months later, the CFC had been revised and adopted. A qualitative investigation of the CFC's effects identified three themes: the CFC's unique value, the influence of the process of creating the CFC on patterns of communication, and the creation of a context for research and collaboration. Creating the CFC established a context in which implementing technical interventions became an opportunity for dialogue and developing a mutually beneficial partnership. To increase the likelihood that research results would be translated into policy reforms, the CFC made explicit the opportunities, potential problems, and institutional barriers to be overcome. The process of creating a CFC and the resulting document define a new standard in academic and governmental partnerships.

  6. Multivariate cross-frequency coupling via generalized eigendecomposition

    Science.gov (United States)

    Cohen, Michael X

    2017-01-01

    This paper presents a new framework for analyzing cross-frequency coupling in multichannel electrophysiological recordings. The generalized eigendecomposition-based cross-frequency coupling framework (gedCFC) is inspired by source-separation algorithms combined with dynamics of mesoscopic neurophysiological processes. It is unaffected by factors that confound traditional CFC methods—such as non-stationarities, non-sinusoidality, and non-uniform phase angle distributions—attractive properties considering that brain activity is neither stationary nor perfectly sinusoidal. The gedCFC framework opens new opportunities for conceptualizing CFC as network interactions with diverse spatial/topographical distributions. Five specific methods within the gedCFC framework are detailed, these are validated in simulated data and applied in several empirical datasets. gedCFC accurately recovers physiologically plausible CFC patterns embedded in noise that causes traditional CFC methods to perform poorly. The paper also demonstrates that spike-field coherence in multichannel local field potential data can be analyzed using the gedCFC framework, which provides significant advantages over traditional spike-field coherence analyses. Null-hypothesis testing is also discussed. DOI: http://dx.doi.org/10.7554/eLife.21792.001 PMID:28117662

  7. Cardiofaciocutaneous syndrome: A rare entity

    Directory of Open Access Journals (Sweden)

    S Pavithra

    2012-01-01

    Full Text Available The cardiofaciocutaneous (CFC syndrome is a condition of sporadic occurrence, with patients showing multiple congenital anomalies and mental retardation and characteristic dysmorphic features. We, thus, report a rare case of this syndrome in a 1-year-old child who presented with typical features of CFC syndrome.

  8. 49 CFR 572.200 - Instrumentation and test conditions.

    Science.gov (United States)

    2010-10-01

    ... mass moment of inertia of 3646 kg-cm2. (b) The test probe for the lateral abdomen impact test is the... moments—digitally filtered at CFC 600; (5) Pelvis, shoulder, thorax and abdomen impactor accelerations...) Shoulder, thorax, and abdomen deflection—digitally filtered CFC 600. (h) Mountings for the head,...

  9. Transport and degradation of chlorofluorocarbons (CFCs) in the pyritic Rabis Creek aquifer, Denmark

    DEFF Research Database (Denmark)

    Hinsby, K.; Hojberg, A.L.; Engesgaard, P.;

    2007-01-01

    of Fe(III)-bearing weathering products (green rust) may be a plausible mechanism. The observed data and the performed simulations confirm the potential application of the CFC gases as age-dating tools in the aerobic part of the investigated aquifer, but also that CFC data must be analyzed carefully...

  10. Emission quantification of refrigerant CFCs, HCFCs and HFCs in megacity Lahore (Pakistan) and contributed ODPs and GWPs

    Science.gov (United States)

    Ul-Haq, Zia; Ali, Muhammad; Batool, Syeda Adila; Tariq, Salman; Qayyum, Zarmina

    2016-08-01

    An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the period from 2005 to 2013. During the production of 6.488 million refrigerator units, the cumulative estimated emissions of CFC-11, CFC-12, HCFC-141b and HFC-134a were 129.7, 6.8, 1257 and 104 mega grams (1 Mg = 106 grams). The estimated GWP (CO2-eq) and ODP (CFC 11-eq) associated with production phase emissions of these four gases were 616.07, 73.52, 910.96, and 87.36 kilotonnes, and 129.7, 6.8, 139.4, and 0 tonnes, respectively. ODP of HFC-134a is considered to be zero. In addition, the repair and maintenance of 81.2 thousand units resulted in 10.8 Mg emissions of CFC-12 with 10.8 tonnes ODP(CFC 11-eq) and 117,802 tonnes GWP (CO2-eq) that were higher than the HFC-134a emissions recorded at 4.3 Mg causing 4563 tonnes GWP(CO2-eq). A decrease in ODP (CFC 11-eq) and GWP (CO2-eq) at the rate of -8.3% and -8.2% per year is observed to be contributed by all the selected ODSs during the study period.

  11. Perspectives on Adolescent Alcohol Use and Consideration of Future Consequences: Results from a Qualitative Study

    Science.gov (United States)

    Harvey, Séamus A.; McKay, Michael T.

    2017-01-01

    Consideration of future consequences (CFC) is described as the attention that individuals pay to the potential outcomes of their behaviour, and how their behaviour is affected as a result of attention to these outcomes. Greater CFC has been associated with less alcohol use, thus indicating its potential utility in health-promotion initiatives. A…

  12. Determination of the infrared cross sections and global warming potentials of 1,1,2-trifluorethane (HFC-143)

    Energy Technology Data Exchange (ETDEWEB)

    Clerbaux, C.; Colin, R. [Univ. Libre de Bruxelles, Brussels (Belgium)

    1994-11-01

    The Global Warming Potentials (GWPs) of CH2F-CHF2 (HFC-143) have been estimated for different time horizons. Radiative forcings associated with this CFC alternative have been derived relative to CFC-11 and CO2 by introducing laboratory measured absorption cross sections into a coupled chemical-radiative model.

  13. 40 CFR Appendix D to Subpart G of... - Substitutes Subject to Use Restrictions and Unacceptable Substitutes

    Science.gov (United States)

    2010-07-01

    .... iii. The trade name, charge amount, and, when applicable, the ASHRAE refrigerant numerical designation... Comments Electronics Cleaning w/CFC-113 and MCF HFC-4310mee Acceptable Subject to a 200 ppm time-weighted... Electronics Cleaning w/CFC-113 and MCF Perfluoropolyethers Perfluoropolyethers are acceptable substitutes...

  14. Subsidizing "Stayers"? Effects of a Norwegian Child Care Reform on Marital Stability

    Science.gov (United States)

    Hardoy, Ines; Schone, Pal

    2008-01-01

    Since January 1999, all parents in Norway with children aged 1 to 3 years who do not attend publicly subsidized day care are eligible for "cash-for-care" (CFC). One important purpose of the reform is to enable parents to spend more time with their children. We analyze whether the CFC reform has affected marital stability, using individual register…

  15. 40 CFR 82.66 - Nonessential Class I products and exceptions.

    Science.gov (United States)

    2010-07-01

    ..., industrial, automotive and pesticide uses, (2) Except— (i) Medical devices listed in 21 CFR 2.125(e); (ii... cleaning fluids used for aircraft maintenance, which contain CFC-11 or CFC-113 as a solvent, but which..., books with coated or dense paper and tightly bound documents; and (e) Any air-conditioning...

  16. Emission quantification of refrigerant CFCs, HCFCs and HFCs in megacity Lahore (Pakistan) and contributed ODPs and GWPs

    Indian Academy of Sciences (India)

    Zia Ul-Haq; Muhammad Ali; Syeda Adila Batool; Salman Tariq; Zarmina Qayyum

    2016-08-01

    An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the periodfrom 2005 to 2013. During the production of 6.488 million refrigerator units, the cumulative estimated emissions of CFC-11, CFC-12, HCFC-141b and HFC-134a were 129.7, 6.8, 1257 and 104 mega grams (1 Mg = 106 grams). The estimated GWP (CO2-eq) and ODP (CFC 11-eq) associated with productionphase emissions of these four gases were 616.07, 73.52, 910.96, and 87.36 kilotonnes, and 129.7, 6.8, 139.4, and 0 tonnes, respectively. ODP of HFC-134a is considered to be zero. In addition, the repair and maintenance of 81.2 thousand units resulted in 10.8 Mg emissions of CFC-12 with 10.8 tonnes ODP(CFC11-eq) and 117,802 tonnes GWP (CO2-eq) that were higher than the HFC-134a emissions recorded at 4.3 Mg causing 4563 tonnes GWP(CO2-eq). A decrease in ODP (CFC 11-eq) and GWP (CO2-eq) at the rate of −8.3% and −8.2% per year is observed to be contributed by all the selected ODSs during the study period.

  17. DKV joint project: reduction of CFC-emissions in air conditioning and refrigeration. Subproject 6. Pool boiling of new refrigerants and their mixtures at single plain and finned tubes. Final report; DKV-Verbundvorhaben: Minderung von FCKW-Emissionen in der Klima- und Kaeltetechnik. Teilvorhaben 6; Waermeuebergang bei der Verdampfung neuer Kaeltemittel an einzelnen Glatt- und Rippenrohren. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Gorenflo, D.; Rott, W.; Sokol, P.; Caplanis, S; Kuenstler, W.

    1993-03-01

    Heat transfer at pool boiling from three novel finned tubes with different fin geometry to the new refrigerants R134a (CH{sub 2}F.CF{sub 3}), R152a (CH{sub 3}.CHF{sub 2}), R227 (CF{sub 3}.CHF.CF{sub 3}) and to a nearly equimolar mixture of R134a and R152a has been investigated within extended ranges of heat flux and saturation pressure. The main new features of the tubes are: K-shaped fins with very narrow fin distances/T-shaped fins with additional grooves between the fins/Y-shaped fins with additional grooves between the fins. The results show that especially the tubes with T-shaped and Y-shaped fins are significantly superior to plain tubes at pool boiling of the new refrigerants at saturation pressures up to approximately 10 bar. The biggest enhancement has been achieved using the tube with Y-shaped fins, thus energy consumption can be reduced by smaller temperature differences on the pool side, if these tubes will be applied, and the amount of refrigerants as well as construction material for the evaporators can be reduced by more compact design, being possible, because the heat flow rate transferred per unit of tube length may be chosen higher. (orig.). 11 refs., 1 tab., 12 figs. [Deutsch] Durch Waermeuebergangsmessungen bei der Verdampfung von neuen, teilfluorierten Kaeltemitteln an neuentwickelten Hochleistungs-Verdampferrohren sollten verlaessliche Auslegungsgrundlagen fuer optimierte Rohrbuendelverdampfer bereitgestellt werden, die mit geringerem Energiebedarf und durch kompakte Bauweise mit reduziertem Material- und Kaeltemittelaufwand auskommen und dadurch einerseits kein Ozongefaehrdungspotential und andererseits einen geringeren Beitrag zum Treibhauseffket liefern als die z.Zt. noch verwendete Technik. Zu Beginn des Vorhabens existierten entsprechende Unterlagen in der Literatur nicht. Als Versuchsstoffe dienten die neuen Kaeltemittel R134a(CH{sub 2}F.CF{sub 3}), R152a(CH{sub 3}.CHF{sub 2}), R227(CF{sub 3}.CHF.CF{sub 3}) sowie ein etwa aequimolares Gemisch aus R134a und R152a. Die Waermestromdichte und der Siededruck wurden in weiten Bereichen variiert. Eines der Rohre besass K-foermige Rippen mit sehr engem Rippenabstand, die beiden anderen waren sog. Hochleistungsrohre mt Veraenderungen an Rippenspitze (T-Form bzw. Y-Form) und Rippengrund (``X``-Kerben). Die Versuchsergebnisse zeigen, dass besonders die beiden Hochleistungsrohre bei Siededruecken bis etwa 10 bar erhebliche Vorteile im Vergleich zu Glattrohren versprechen. Die groesste Verbesserung lieferte das YX-rohr, so dass bei Verwendung dieses Rohres der Energiebedarf und zugleich die notwendige Kaeltemittelmenge und der Materialaufwand fuer die Verdampfer reduziert werden kann. (orig.)

  18. The development of recrystallization textures in F.C.C. metals with a low stacking fault energy = Developpement de textures de recristallisation dans les metaux C.F.C. a basse energie de defaut d'empilement = Die entwicklung einer Rekristallisationstextur in F.C.C. metallen mit niedriger stapelfehlerenergie

    NARCIS (Netherlands)

    Slakhorst, J.W.H.G.

    1975-01-01

    The texture development of silver single crystals and polycrystalline high purity silver and a series of Ni-Co alloys was examined, immediately after rolling and after various annealing treatments. X-ray diffraction and electron-microscopical observations showed that the development of the {841}447

  19. Postmating Female Control: 20 Years of Cryptic Female Choice.

    Science.gov (United States)

    Firman, Renée C; Gasparini, Clelia; Manier, Mollie K; Pizzari, Tommaso

    2017-03-16

    Cryptic female choice (CFC) represents postmating intersexual selection arising from female-driven mechanisms at or after mating that bias sperm use and impact male paternity share. Although biologists began to study CFC relatively late, largely spurred by Eberhard's book published 20 years ago, the field has grown rapidly since then. Here, we review empirical progress to show that numerous female processes offer potential for CFC, from mating through to fertilization, although seldom has CFC been clearly demonstrated. We then evaluate functional implications, and argue that, under some conditions, CFC might have repercussions for female fitness, sexual conflict, and intersexual coevolution, with ramifications for related evolutionary phenomena, such as speciation. We conclude by identifying directions for future research in this rapidly growing field.

  20. Activation of human natural killer cells by the soluble form of cellular prion protein

    Energy Technology Data Exchange (ETDEWEB)

    Seong, Yeon-Jae [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Hafis Clinic, Seoul (Korea, Republic of); Sung, Pil Soo; Jang, Young-Soon; Choi, Young Joon [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Bum-Chan [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Park, Su-Hyung [Laboratory of Translational Immunology and Vaccinology, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Young Woo [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Shin, Eui-Cheol, E-mail: ecshin@kaist.ac.kr [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of)

    2015-08-21

    Cellular prion protein (PrP{sup C}) is widely expressed in various cell types, including cells of the immune system. However, the specific roles of PrP{sup C} in the immune system have not been clearly elucidated. In the present study, we investigated the effects of a soluble form of recombinant PrP{sup C} protein on human natural killer (NK) cells. Recombinant soluble PrP{sup C} protein was generated by fusion of human PrP{sup C} with the Fc portion of human IgG{sub 1} (PrP{sup C}-Fc). PrP{sup C}-Fc binds to the surface of human NK cells, particularly to CD56{sup dim} NK cells. PrP{sup C}-Fc induced the production of cytokines and chemokines and the degranulation of granzyme B from NK cells. In addition, PrP{sup C}-Fc facilitated the IL-15-induced proliferation of NK cells. PrP{sup C}-Fc induced phosphorylation of ERK-1/2 and JNK in NK cells, and inhibitors of the ERK or the JNK pathways abrogated PrP{sup C}-Fc-induced cytokine production in NK cells. In conclusion, the soluble form of recombinant PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways. - Highlights: • Recombinant soluble PrP{sup C} (PrP{sup C}-Fc) was generated by fusion of human PrP{sup C} with IgG1 Fc portion. • PrP{sup C}-Fc protein induces the production of cytokines and degranulation from human NK cells. • PrP{sup C}-Fc protein enhances the IL-15-induced proliferation of human NK cells. • PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways.

  1. Damage prediction of carbon fibre composite armoured actively cooled plasma-facing components under cycling heat loads

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G; Schlosser, J; Courtois, X; Escourbiac, F; Missirlian, M [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Herb, V; Martin, E; Camus, G [LCTS, CNRS UMR 5801, Universite Bordeaux 1, Pessac (France); Braccini, M [SIMaP, CNRS UMR 5266, Grenoble (France)], E-mail: gaelle.chevet@cea.fr

    2009-12-15

    In order to predict the lifetime of carbon fibre composite (CFC) armoured plasma-facing components in magnetic fusion devices, it is necessary to analyse the damage mechanisms and to model the damage propagation under cycling heat loads. At Tore Supra studies have been launched to better understand the damage process of the armoured flat tile elements of the actively cooled toroidal pump limiter, leading to the characterization of the damageable mechanical behaviour of the used N11 CFC material and of the CFC/Cu bond. Up until now the calculations have shown damage developing in the CFC (within the zone submitted to high shear stress) and in the bond (from the free edge of the CFC/Cu interface). Damage is due to manufacturing shear stresses and does not evolve under heat due to stress relaxation. For the ITER divertor, NB31 material has been characterized and the characterization of NB41 is in progress. Finite element calculations show again the development of CFC damage in the high shear stress zones after manufacturing. Stresses also decrease under heat flux so the damage does not evolve. The characterization of the CFC/Cu bond is more complex due to the monoblock geometry, which leads to more scattered stresses. These calculations allow the fabrication difficulties to be better understood and will help to analyse future high heat flux tests on various mock-ups.

  2. Risks in the physical recovery system of waste refrigerator cabinets and the controlling measure.

    Science.gov (United States)

    Ruan, Jujun; Xue, Mianqiang; Xu, Zhenming

    2012-12-18

    Environmental information in physical recovery system of waste refrigerator cabinets was provided in this paper. The system included closed shearing, activated carbon adsorption (ACA), air current separation, magnetic separation, and eddy current separation. Exposures of CFC-11, heavy metals, and noise emitted from the system were assessed. Abundant CFC-11 (>510 mg/m³) was detected in crusher cavity. However, due to the employment of ACA, little CFC-11 (refrigerator cabinets on environmental protection. Meanwhile, it contributed to the knowledge of environmental information of physical technology for recovering e-waste.

  3. LUMPED Unsteady: a Visual Basic ® code of unsteady-state lumped-parameter models for mean residence time analyses of groundwater systems

    Science.gov (United States)

    Ozyurt, N. Nur; Bayari, C. Serdar

    2005-04-01

    A Microsoft ® Visual Basic 6.0 (Microsoft Corporation, 1987-1998) code of 9 lumped-parameter models of unsteady flow is presented for the analysis of mean residence time in aquifers. Groundwater flow systems obeying plug and well-mixed flow models and their combinations in parallel or serial connection can be simulated by the code. Models can use tritium, tritiugenic He-3, oxygen-18, deuterium, krypton-85, chlorofluorocarbons (CFC-11, CFC-12 and CFC-113) and sulfur hexafluoride (SF 6) as the environmental tracers. The executable code runs under all 32-bit Windows operating systems. Details of the code are explained and its limitations are indicated.

  4. COMPOSITION CHANGES IN REFRIGERANT BLENDS FOR AUTOMOTIVE AIR CONDITIONING

    Science.gov (United States)

    Three refrigerant blends used to replace CFC-12 in automotive air conditioners were evaluated for composition changes due to typical servicing and leakage. When recommended service procedures were followed, changes in blend compositions were relatively small. Small changes in b...

  5. Reduction of Eosinophils in Small Airways by Inhaled Steroids is Insufficient in Patients with Adult Asthma

    Directory of Open Access Journals (Sweden)

    Hiroshi Tanaka

    2006-01-01

    Conclusions: It was speculated that inhaled CFC-BDP and DP-FP might deposit mainly in large airways and fail to fully reach small airways, consequently allowing eosinophilic inflammation to continue in small airways.

  6. Central Flyway Duck Banding project : Annual progress report 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Central Flyway Council (CFC) initiated a six year duck banding program in 1996 with emphasis on mallard banding in North Dakota, South Dakota, Montana, and...

  7. 26 CFR 1.952-1 - Subpart F income defined.

    Science.gov (United States)

    2010-04-01

    ...: Example. CFC, a controlled foreign corporation, is an 80-percent partner in PRS, a foreign partnership. PRS earns $100 of interest income that is not export financing interest as defined in section...

  8. 76 FR 62096 - Revision of Information Collection: OPM Online Form 1417

    Science.gov (United States)

    2011-10-06

    ... MANAGEMENT Revision of Information Collection: OPM Online Form 1417 AGENCY: Office of Personnel Management... an information collection. OPM Online Form 1417, the Combined Federal Campaign (CFC) Information... contact information. The proposed revisions remove data that is collected from other sources...

  9. Consumerism triggers AC explosion

    Energy Technology Data Exchange (ETDEWEB)

    Lafferty, Richard

    1997-05-01

    The growth in air conditioning in the United Kingdom in recent years is examined in this article, and split systems, the phasing out of CFC and HCFC refrigerants, global warming, and comfort levels are considered. (UK)

  10. 40 CFR Appendix C to Subpart G of... - Substitutes Subject to Use Restrictions and Unacceptable Substitutes Listed in the May 22, 1996...

    Science.gov (United States)

    2010-07-01

    ... performing the retrofit. ii. The date of the retrofit. iii. The trade name, charge amount, and, when... recent toxicology study. Electronics Cleaning w/ CFC-113, MCF and HCFC-141b Monochlorotoluenes...

  11. Effects of Consideration of Future Consequences and Temporal Framing on Acceptance of the HPV Vaccine Among Young Adults.

    Science.gov (United States)

    Kim, Jarim; Nan, Xiaoli

    2016-09-01

    This study examines how individual difference in consideration of future consequences (CFC) and temporal framing (i.e., present- vs. future-oriented message) interact to influence the persuasive outcomes of a health message promoting human papillomavirus (HPV) vaccination among young adults. Results of an experiment (N = 416) showed a significant interaction effect of CFC and temporal framing on persuasion. The nature of the interaction suggested that individuals with high CFC generally were more persuaded by the present-oriented messages, compared to the future-oriented messages. On the other hand, those with low CFC responded similarly to the present- and future-oriented messages. Implications of the findings for HPV vaccination messaging are discussed.

  12. Reduction in LFP cross-frequency coupling between theta and gamma rhythms associated with impaired STP and LTP in a rat model of brain ischemia.

    Science.gov (United States)

    Xu, Xiaxia; Zheng, Chenguang; Zhang, Tao

    2013-01-01

    The theta-gamma cross-frequency coupling (CFC) in hippocampus was reported to reflect memory process. In this study, we measured the CFC of hippocampal local field potentials (LFPs) in a two-vessel occlusion (2VO) rat model, combined with both amplitude and phase properties and associated with short and long-term plasticity indicating the memory function. Male Wistar rats were used and a 2VO model was established. STP and LTP were recorded in hippocampal CA3-CA1 pathway after LFPs were collected in both CA3 and CA1. Based on the data of relative power spectra and phase synchronization, it suggested that both the amplitude and phase coupling of either theta or gamma rhythm were involved in modulating the neural network in 2VO rats. In order to determine whether the CFC was also implicated in neural impairment in 2VO rats, the coupling of CA3 theta-CA1 gamma was measured by both phase-phase coupling (n:m phase synchronization) and phase-amplitude coupling. The attenuated CFC strength in 2VO rats implied the impaired neural communication in the coordination of theta-gamma entraining process. Moreover, compared with modulation index (MI) a novel algorithm named cross frequency conditional mutual information (CF-CMI), was developed to focus on the coupling between theta phase and the phase of gamma amplitude. The results suggest that the reduced CFC strength probably attributed to the disruption of the phase of CA1 gamma envelop. In conclusion, it implied that the phase coupling and CFC of hippocampal theta and gamma played an important role in supporting functions of neural network. Furthermore, synaptic plasticity on CA3-CA1 pathway was reduced in line with the decreased CFC strength from CA3 to CA1. It partly supported our hypothesis that directional CFC indicator might probably be used as a measure of synaptic plasticity.

  13. Reduction in LFP cross-frequency coupling between theta and gamma rhythms associated with impaired STP and LTP in a rat model of brain ischemia

    Directory of Open Access Journals (Sweden)

    Tao eZhang

    2013-04-01

    Full Text Available The theta-gamma cross-frequency coupling (CFC in hippocampus was reported to reflect memory process. In this study, we measured the CFC of hippocampal local field potentials (LFPs in a two-vessel occlusion (2VO rat model, combined with both amplitude and phase properties and associated with short and long-term plasticity indicating the memory function. Male Wistar rats were used and a 2VO model was established. STP and LTP were recorded in hippocampal CA3-CA1 pathway after LFPs were collected in both CA3 and CA1. Based on the data of relative power spectra and phase synchronization, it suggested that both the amplitude and phase coupling of either theta or gamma rhythm were involved in modulating the neural network in 2VO rats. In order to determine whether the CFC was also implicated in neural impairment in 2VO rats, the coupling of CA3 theta–CA1 gamma was measured by both phase-phase coupling (n:m phase synchronization and phase-amplitude coupling. The attenuated CFC strength in 2VO rats implied the impaired neural communication in the coordination of theta-gamma entraining process. Moreover, compared with modulation index (MI a novel algorithm named cross frequency conditional mutual information (CF-CMI, was developed to focus on the coupling between theta phase and the phase of gamma amplitude. The results suggest that the reduced CFC strength probably attributed to the disruption of the phase of CA1 gamma envelop. In conclusion, it implied that the phase coupling and CFC of hippocampal theta and gamma played an important role in supporting functions of neural network. Furthermore, synaptic plasticity on CA3-CA1 pathway was reduced in line with the decreased CFC strength from CA3 to CA1. It partly supported our hypothesis that directional CFC indicator might probably be used as a measure of synaptic plasticity.

  14. Solar production of catalytic filamentous carbon by thermal decomposition of hydrocarbons and carbon monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Kirillov, V.A.; Kuvshinov, G.G.; Mogilnykh, Yu.I. [Boreskov Institute of Catalysis, Novosibirsk (Russian Federation); Reller, A. [University of Hamburg (Germany); Steinfeld, A.; Weidenkaff, A.; Meier, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1999-08-01

    Concentrated solar radiation was used as the clean source of process heat for the production of Catalytic Filamentous Carbon (CFC) by thermal decomposition of gaseous hydrocarbons and by CO disproportionation in the presence of small metal catalyst particles. Depending on the catalyst, two different types of CFC, namely nano tubes and nano fibers, were obtained in solar experiments at the PSI solar furnace. (author) 2 figs., 1 tab., 7 refs.

  15. [Complex febrile crises: should we change the way we act?].

    Science.gov (United States)

    Martinez-Cayuelas, E; Herraiz-Martinez, M; Villacieros-Hernandez, L; Cean-Cabrera, L; Martinez-Salcedo, E; Alarcon-Martinez, H; Domingo-Jimenez, R; Perez-Fernandez, V

    2014-11-16

    Introduccion. Las convulsiones febriles son una de las causas mas frecuentes de consulta. Hasta ahora, los pacientes con convulsiones febriles complejas (CFC) deben ingresar, dado el mayor porcentaje de epilepsia y complicaciones agudas descrito clasicamente. En la actualidad hay estudios que apoyan ser menos invasivos en el abordaje de estos pacientes. Objetivo. Describir las caracteristicas de los pacientes ingresados por CFC y proponer un nuevo protocolo de actuacion. Pacientes y metodos. Analisis retrospectivo de historias clinicas de ingresados por CFC (enero de 2010-diciembre de 2013). Se ofrecen datos epidemiologicos, clinicos, pruebas complementarias y evolucion. Resultados. Las CFC suponian un 4,2% de los ingresos de neuropediatria (n = 67). Edad media al evento: 25 meses. El 47% tenia antecedentes familiares patologicos, y el 31%, antecedentes personales de convulsion febril previa. En el 54% de los pacientes, la CFC duro menos de cinco minutos; hubo recurrencia, la mayoria con un total de dos crisis y durante el primer dia (las CFC por recurrencia son las mas frecuentes). De las pruebas complementarias realizadas, ninguna de ellas sirvio como apoyo diagnostico en el momento agudo. Durante su seguimiento, cinco pacientes presentaron complicaciones. Los pacientes con antecedentes familiares de convulsiones febriles presentan mayor riesgo de epilepsia o recurrencia (p = 0,02), sin diferencias significativas respecto a la edad, numero de crisis, intervalo de fiebre, estado epileptico o tipo de CFC. Conclusiones. Las CFC no asocian mayores complicaciones agudas; las exploraciones complementarias no permiten discriminar precozmente a los pacientes de riesgo. Su ingreso podria evitarse en ausencia de otros signos clinicos y limitarse a casos seleccionados.

  16. Damage of actively cooled plasma facing components of magnetic confinement controlled fusion machines

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France)], E-mail: gaelle.chevet@cea.fr; Schlosser, J. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France); Martin, E.; Herb, V.; Camus, G. [Universite Bordeaux 1, UMR 5801 (CNRS-SAFRAN-CEA-UB1), Laboratoire des Composites Thermostructuraux, F-33600 Pessac (France)

    2009-03-31

    Plasma facing components (PFCs) of magnetic fusion machines have high manufactured residual stresses and have to withstand important stress ranges during operation. These actively cooled PFCs have a carbon fibre composite (CFC) armour and a copper alloy heat sink. Cracks mainly appear in the CFC near the composite/copper interface. In order to analyse damage mechanisms, it is important to well simulate the damage mechanisms both of the CFC and the CFC/Cu interface. This study focuses on the mechanical behaviour of the N11 material for which the scalar ONERA damage model was used. The damage parameters of this model were identified by similarity to a neighbour material, which was extensively analysed, according to the few characterization test results available for the N11. The finite elements calculations predict a high level of damage of the CFC at the interface zone explaining the encountered difficulties in the PFCs fabrication. These results suggest that the damage state of the CFC cells is correlated with a conductivity decrease to explain the temperature increase of the armour surface under fatigue heat load.

  17. Transparent-cap-fitted colonoscopy shows higher performance with cecal intubation time in difficult cases

    Institute of Scientific and Technical Information of China (English)

    Hyung Hun Kim; Seun Ja Park; Moo In Park; Won Moor; Sung Eun Kim

    2012-01-01

    AIM:To investigate the efficacy of cap-fitted colonoscopy (CFC) with regard to cecal intubation time.METHODS:Two hundred and ninety-five patients undergoing screening colonoscopy at Gospel Hospital,Kosin University College of Medicine were enrolled in this randomized controlled trial between January and December 2010.Colonoscopies were conducted by a single endoscopist.Patient characteristics including age,sex,body mass index,history of abdominal surgery,quality of preparation,and the presence of diverticulosis were recorded.RESULTS:One hundred and fifty patients were allocated into a CFC group and 145 into a non-CFC (NCF)group.Cecal intubations were achieved in all patients.Cecal intubation time in the CFC group was significantly shorter than in the NCF group for specific conditions:age ≥ 60 years,prior abdominal surgery,and poor bowel preparation.The number of detected adenomas was higher in the CFC group than in the NCF group (P =0.040).CONCLUSION:CFC facilitated shortening of the cecal intubation time in difficult cases,and was more sensitive for detecting adenomas than was NCF.

  18. Radioprotective effects of combination broncho-vaxom, a macrophage activator, and indomethacin, an inhibitor of prostaglandin production. Relationship to myelopoiesis

    Energy Technology Data Exchange (ETDEWEB)

    Fedorocko, P.; Mackova, N.O. [Safarik Univ., Faculty ofSciences, Dept. of Cellular and Molecular Biology, Kosice (Slovakia)

    1996-01-01

    The effects of the bacterial extract broncho-vaxom (BV; radioprotective immunomodulator; 500 {mu}g/mouse i.p., -24 h) and indomethacin (INDO; inhibitor of prostaglandin production; 2x40 {mu}g/mouse i.m., - 24 h and - 3 h) on the post-irradiation recovery of hemopoietic functions in mice were investigated. Both agents were administered either alone or in combination. Endogenous spleen colony formation was increased in all treatment groups, with combination-treated mice exhibiting the greatest effects. Similarly, 24 h after combined administration of BV and INDO (i.e. at the time of presumed irradiation) to the non-irradiated mice granulocyte-macrophage colony-forming cell (GM-CFC) numbers were greater in the bone marrow and spleen. Also, as determined by hydroxyurea injection, there was an increase in the number of GM-CFC in the S-phase of the cell cycle in the bone marrow. However, GM-CFC in the spleen of combination pretreated mice was not stimulated to significant proliferation as compared to GM-CFC in the spleen of mice injected with BV alone. Combined modality treatment was also more effective than single agent treatments in accelerating bone marrow cellularity and GM-CFC regeneration, but not in accelerating GM-CFC regeneration in the spleen. Combined administration of BV and INDO to mice prior to lethal irradiation exerted and additional radioprotective effect and protected 95% of the C57B1/6 mice. (au) 42 refs.

  19. Contribution of some ozone depleting substances (ODS) and greenhouse gases (GHGs) on total column zone growth at Srinagar (34°N, 74.8°), India

    Indian Academy of Sciences (India)

    P K Jana; D K Saha; D Sarkar

    2013-02-01

    A critical analysis has been made on the contribution of CFC-11, CFC-12, CFC-113, CH2Cl, CH3Br, CCl4, CH3CCl3, HCFCs, halons, WMO (World Meteorological Organization) minor constituents, CH4, N2O and water vapour to the variation of total column ozone (TCO) concentration at the station in Srinagar (34°N, 74.8°E), India from 1992 to 2003. With the implementation of Montreal Protocol, though the concentrations of CFC-11, CFC-113, CH3Cl, CH3Br, CCl4 and CH3CCl3 had decreased, the concentrations of CFC-12, HCFCs, halons, WMO minor constituents, CH4, N2O and water vapour had increased, as a result of which TCO had risen from 1992 to 2003 at the above station. The nature of yearly variations of concentrations of the above ozone depleting substances and greenhouse gases as well as ozone has been presented. Possible explanations for build-up of TCO have also been offered.

  20. Portuguese Validation of the Consideration of Future Consequences Scale.

    Science.gov (United States)

    Echeverría, Alejandro Vásquez; Esteves, Cristina; Gomes, Catarina Vilares; Ortuño, Victor E C

    2015-03-11

    The Consideration of Future Consequences Scale (CFC-S) is a measure of the extent to which individuals reflect and are influenced by the immediate as well as by the distant outcomes of current behavior. It's composed by 12 items, grouped into two subscales (future and immediate). This study aims to explore the factor structure, psychometric properties and construct validity of the Portuguese version of the CFC-S in 5 samples, composed by 527 participants with ages between 13 and 71. A 2 factor structure has been found through Confirmatory Factor Analysis among several tested models. Item 5 has been eliminated in order to achieve better fit indices (χ2 df = 3.88, CFI = .90, GFI = .95, RMSEA = .07) and improve internal consistency. Both CFC subscales presented strong correlations with several psychological phenomena (Sensation Seeking, Self-Esteem, Temporal Extension and Time Perspective) and main effects among groups of age and criminal record (for CFC-I, p < .001, for CFC-F, p < .001). These results allow us to support CFC as an efficient psychological evaluation instrument and as an important metric for individual differences in the study of temporal orientation.

  1. An assessment of alternatives for replacing Freon 113 in bench type electrical circuit board cleaning at Fermi National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Isakson, K.; Vessell, A.L.

    1994-07-01

    Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ``best alternatives``: Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases.

  2. Neonatal isoflurane exposure induces neurocognitive impairment and abnormal hippocampal histone acetylation in mice.

    Directory of Open Access Journals (Sweden)

    Tao Zhong

    Full Text Available Neonatal exposure to isoflurane may induce long-term memory impairment in mice. Histone acetylation is an important form of chromatin modification that regulates the transcription of genes required for memory formation. This study investigated whether neonatal isoflurane exposure-induced neurocognitive impairment is related to dysregulated histone acetylation in the hippocampus and whether it can be attenuated by the histone deacetylase (HDAC inhibitor trichostatin A (TSA.C57BL/6 mice were exposed to 0.75% isoflurane three times (each for 4 h at postnatal days 7, 8, and 9. Contextual fear conditioning (CFC was tested at 3 months after anesthesia administration. TSA was intraperitoneally injected 2 h before CFC training. Hippocampal histone acetylation levels were analyzed following CFC training. Levels of the neuronal activation and synaptic plasticity marker c-Fos were investigated at the same time point.Mice that were neonatally exposed to isoflurane showed significant memory impairment on CFC testing. These mice also exhibited dysregulated hippocampal H4K12 acetylation and decreased c-Fos expression following CFC training. TSA attenuated isoflurane-induced memory impairment and simultaneously increased histone acetylation and c-Fos levels in the hippocampal cornu ammonis (CA1 area 1 h after CFC training.Memory impairment induced by repeated neonatal exposure to isoflurane is associated with dysregulated histone H4K12 acetylation in the hippocampus, which probably affects downstream c-Fos gene expression following CFC training. The HDAC inhibitor TSA successfully rescued impaired contextual fear memory, presumably by promoting histone acetylation and histone acetylation-mediated gene expression.

  3. Timescales for nitrate contamination of spring waters, northern Florida, USA

    Science.gov (United States)

    Katz, B.G.; Böhlke, J.K.; Hornsby, H.D.

    2001-01-01

    Residence times of groundwater, discharging from springs in the middle Suwannee River Basin, were estimated using chlorofluorocarbons (CFCs), tritium (3H), and tritium/helium-3 (3H/3He) age-dating methods to assess the chronology of nitrate contamination of spring waters in northern Florida. During base-flow conditions for the Suwannee River in 1997-1999, 17 water samples were collected from 12 first, second, and third magnitude springs discharging groundwater from the Upper Floridan aquifer. Extending age-dating techniques, using transient tracers to spring waters in complex karst systems, required an assessment of several models [piston-flow (PFM), exponential mixing (EMM), and binary-mixing (BMM)] to account for different distributions of groundwater age. Multi-tracer analyses of four springs yielded generally concordant PFM ages of around 20 ?? 2 years from CFC-12, CFC-113, 3H, and 3He, with evidence of partial CFC-11 degradation. The EMM gave a reasonable fit to CFC-113, CFC-12, and 3H data, but did not reproduce the observed 3He concentrations or 3H/3He ratios, nor did a combination PFM-EMM. The BMM could reproduce most of the multi-tracer data set only if both endmembers had 3H concentrations not much different from modern values. CFC analyses of 14 additional springs yielded apparent PFM ages from about 10 to 20 years from CFC-113, with evidence of partial CFC-11 degradation and variable CFC-12 contamination. While it is not conclusive, with respect to the age distribution within each spring, the data indicate that the average residence times were in the order of 10-20 years and were roughly proportional to spring magnitude. Applying similar models to recharge and discharge of nitrate based on historical nitrogen loading data yielded contrasting trends for Suwanee County and Lafayette County. In Suwanee County, spring nitrate trends and nitrogen isotope data were consistent with a peak in fertilizer input in the 1970s and a relatively high overall ratio of

  4. A 17-year record of environmental tracers in spring discharge, Shenandoah National Park, Virginia, USA: use of climatic data and environmental conditions to interpret discharge, dissolved solutes, and tracer concentrations

    Science.gov (United States)

    Busenberg, Eurybiades; Plummer, L. Niel

    2014-01-01

    A 17-year record (1995–2012) of a suite of environmental tracer concentrations in discharge from 34 springs located along the crest of the Blue Ridge Mountains in Shenandoah National Park (SNP), Virginia, USA, reveals patterns and trends that can be related to climatic and environmental conditions. These data include a 12-year time series of monthly sampling at five springs, with measurements of temperature, specific conductance, pH, and discharge recorded at 30-min intervals. The monthly measurements include age tracers (CFC-11, CFC-12, CFC-113, CFC-13, SF6, and SF5CF3), dissolved gases (N2, O2, Ar, CO2, and CH4), stable isotopes of water, and major and trace inorganic constituents. The chlorofluorocarbon (CFC) and sulfur hexafluoride (SF6) concentrations (in pptv) in spring discharge closely follow the concurrent monthly measurements of their atmospheric mixing ratios measured at the Air Monitoring Station at Big Meadows, SNP, indicating waters 0–3 years in age. A 2-year (2001–2003) record of unsaturated zone air displayed seasonal deviations from North American Air of ±10 % for CFC-11 and CFC-113, with excess CFC-11 and CFC-113 in peak summer and depletion in peak winter. The pattern in unsaturated zone soil CFCs is a function of gas solubility in soil water and seasonal unsaturated zone temperatures. Using the increase in the SF6 atmospheric mixing ratio, the apparent (piston flow) SF6 age of the water varied seasonally between about 0 (modern) in January and up to 3 years in July–August. The SF6 concentration and concentrations of dissolved solutes (SiO2, Ca2+, Mg2+, Na+, Cl−, and HCO3−) in spring discharge demonstrate a fraction of recent recharge following large precipitation events. The output of solutes in the discharge of springs minus the input from atmospheric deposition per hectare of watershed area (mol ha−1 a−1) were approximately twofold greater in watersheds draining the regolith of Catoctin metabasalts than that of granitic

  5. A time for dogma, a time for the Bible, a time for condoms: building a Catholic theology of prevention in the face of public health policies at Casa Fonte Colombo in Porto Alegre, Brazil.

    Science.gov (United States)

    Seffner, Fernando; Garcia, Jonathan; Muñoz-Laboy, Miguel; Parker, Richard

    2011-01-01

    The Casa Fonte Colombo (CFC) is a religious organisation that assists people living with HIV/AIDS (PLWHA). The funding for its activities comes from public sources such as the Brazilian National STD/AIDS Program as well as the Catholic Church. Capuchin (Franciscan) priests run the CFC and it has an extensive group of volunteers made up mostly of women. Between 2006 and 2009, we observed daily life at the CFC and interviewed priests, volunteers, employees, service providers, and clients. We also attended meetings, group sessions, and celebrations. Everyday actions carried out by the CFC reveal the efforts to resolve the tension between the position of the Catholic Church and the Brazilian state in the politics of AIDS. These efforts affirm that the CFC presents itself as a space where the position of the Catholic Church, as much as the politics of public health, are re-worked, giving way to a progressive act of Catholic prevention and assistance for AIDS that we call 'theology of prevention'.

  6. Continual low-level MEK inhibition ameliorates cardio-facio-cutaneous phenotypes in zebrafish.

    Science.gov (United States)

    Anastasaki, Corina; Rauen, Katherine A; Patton, E Elizabeth

    2012-07-01

    Cardio-facio-cutaneous (CFC) syndrome is caused by germline mutations in KRAS, BRAF and MEK1/2. The highly selective and potent MEK inhibitors that have been developed as anti-cancer agents hold potential as therapeutics for CFC syndrome. We have previously shown that the effects of CFC mutations on zebrafish gastrulation can be prevented by a 1-hour treatment with MEK inhibitors within a specific developmental time-window. However, MEK activity is essential for normal development and PD0325901 treatment outside this treatment window leads to additional developmental defects in MEK-dependent tissues. We now test ten different doses of PD0325901 at six developmental time points and assess the effects on body axis length, heart development and craniofacial structures in zebrafish embryos. Notably, we find that a continuous low-level dose of PD0325901 that has only minor inhibition of MEK activity can prevent the action of both the common CFC BRAF(Q257R) kinase-active allele and the BRAF(G596V) kinase-impaired mutant allele through the first 5 days of development. These results provide a detailed study of the effects of PD0325901 in development and show that, unlike in cancer, which requires robust inhibition of MAPK signalling, a partial reduction in phospho-ERK1/2 activity is sufficient to moderate the developmental effects of BRAF(CFC) mutations.

  7. Impact of cryptic female choice on insemination success: Larger sized and longer copulating male squid ejaculate more, but females influence insemination success by removing spermatangia.

    Science.gov (United States)

    Sato, Noriyosi; Yoshida, Masa-Aki; Kasugai, Takashi

    2017-01-01

    In polyandrous mating systems, sperm competition and cryptic female choice (CFC) are well recognized as postcopulatory evolutionary forces. However, it remains challenging to separate CFC from sperm competition and to estimate how much CFC influences insemination success because those processes usually occur inside the female's body. The Japanese pygmy squid, Idiosepius paradoxus, is an ideal species in which to separate CFC from sperm competition because sperm transfer by the male and sperm displacement by the female can be observed directly at an external location on the female's body. Here, we counted the number of spermatangia transferred to, removed from, and remaining on the female body during single copulation episodes. We measured behavioral and morphological characteristics of the male, such as duration of copulation and body size. Although males with larger body size and longer copulation time were capable of transferring larger amounts of sperm, females preferentially eliminated sperm from males with larger body size and shorter copulation time by spermatangia removal; thus, CFC could attenuate sperm precedence by larger males, whereas it reinforces sperm precedence by males with longer copulation time. Genetic paternity analysis revealed that fertilisation success for each male was correlated with remaining sperm volume that is adjusted by females after copulation.

  8. Age-distribution estimation for karst groundwater: Issues of parameterization and complexity in inverse modeling by convolution

    Science.gov (United States)

    Long, A.J.; Putnam, L.D.

    2009-01-01

    Convolution modeling is useful for investigating the temporal distribution of groundwater age based on environmental tracers. The framework of a quasi-transient convolution model that is applicable to two-domain flow in karst aquifers is presented. The model was designed to provide an acceptable level of statistical confidence in parameter estimates when only chlorofluorocarbon (CFC) and tritium (3H) data are available. We show how inverse modeling and uncertainty assessment can be used to constrain model parameterization to a level warranted by available data while allowing major aspects of the flow system to be examined. As an example, the model was applied to water from a pumped well open to the Madison aquifer in central USA with input functions of CFC-11, CFC-12, CFC-113, and 3H, and was calibrated to several samples collected during a 16-year period. A bimodal age distribution was modeled to represent quick and slow flow less than 50 years old. The effects of pumping and hydraulic head on the relative volumetric fractions of these domains were found to be influential factors for transient flow. Quick flow and slow flow were estimated to be distributed mainly within the age ranges of 0-2 and 26-41 years, respectively. The fraction of long-term flow (>50 years) was estimated but was not dateable. The different tracers had different degrees of influence on parameter estimation and uncertainty assessments, where 3H was the most critical, and CFC-113 was least influential.

  9. PACAP modulates the consolidation and extinction of the contextual fear conditioning through NMDA receptors.

    Science.gov (United States)

    Schmidt, S D; Myskiw, J C; Furini, C R G; Schmidt, B E; Cavalcante, L E; Izquierdo, I

    2015-02-01

    Pituitary adenylate cyclase-activating polypeptide (PACAP) has a broad spectrum of biological functions including neurotransmitter, neurotrophic and neuroprotective. Moreover, it has been suggested that PACAP plays a role in the modulation of learning and memory as well as on the modulation of glutamate signaling. Thus, in the current study we investigated in the CA1 region of hippocampus and in the basolateral amygdala (BLA) the role of PACAP in the consolidation and extinction of contextual fear conditioning (CFC) and the interaction between PACAP and NMDA receptors. Male rats with cannulae implanted in the CA1 region of the hippocampus or in the BLA received immediately after the training or extinction training of the CFC infusions of the Vehicle, PACAP-38 (40 pg/side), PACAP 6-38 (40 pg/side) or PACAP 6-38 plus D-serine (50 μg/side). After 24h, the animals were subjected to a 3-min retention test. The results indicated that in the CA1 region of hippocampus, PACAP participates in the consolidation and extinction of the CFC, and in the BLA, PACAP participates only in the consolidation of the CFC. Additionally, the results suggest that the action of PACAP on the consolidation and extinction of the CFC is mediated by the glutamate NMDA receptors.

  10. Beryllium Concentrations at European Workplaces: Comparison of 'Total' and Inhalable Particulate Measurements.

    Science.gov (United States)

    Kock, Heiko; Civic, Terence; Koch, Wolfgang

    2015-07-01

    A field study was carried out in order to derive a factor for the conversion of historic worker exposure data on airborne beryllium (Be) obtained by sampling according to the 37-mm closed faced filter cassette (CFC) 'total' particulate method into exposure concentration values to be expected when sampling using the 'Gesamtstaubprobenahmesystem' (GSP) inhalable sampling convention. Workplaces selected to represent the different copper Be work processing operations that typically occur in Germany and the EU were monitored revealing a broad spectrum of prevailing Be size distributions. In total, 39 personal samples were taken using a 37-mm CFC and a GSP worn side by side for simultaneous collection of the 'total' dust and the inhalable particulates, respectively. In addition, 20 static general area measurements were carried out using GSP, CFC, and Respicon samplers in parallel, the latter one providing information on the extra-thoracic fraction of the workplace aerosol. The study showed that there is a linear relationship between the concentrations measured with the CFC and those measured with the GSP sampler. The geometric mean value of the ratios of time-weighted average concentrations determined from GSP and CFC samples of all personal samples was 2.88. The individual values covered a range between 1 and 17 related to differences in size distributions of the Be-containing particulates. This was supported by the area measurements showing that the conversion factor increases with increasing values of the extra-thoracic fraction covering a range between 0 and 79%.

  11. Adsorption of dissolved Reactive red dye from aqueous phase onto activated carbon prepared from agricultural waste.

    Science.gov (United States)

    Senthilkumaar, S; Kalaamani, P; Porkodi, K; Varadarajan, P R; Subburaam, C V

    2006-09-01

    The adsorption of Reactive red dye (RR) onto Coconut tree flower carbon (CFC) and Jute fibre carbon (JFC) from aqueous solution was investigated. Adsorption studies were carried out at different initial dye concentrations, initial solution pH and adsorbent doses. The kinetic studies were also conducted; the adsorption of Reactive red onto CFC and JFC followed pseudosecond-order rate equation. The effective diffusion coefficient was evaluated to establish the film diffusion mechanism. Quantitative removal of Reactive red dye was achieved at strongly acidic conditions for both the carbons studied. The adsorption isotherm data were fitted well to Langmuir isotherm and the adsorption capacity were found to be 181.9 and 200 mg/g for CFC and JFC, respectively. The overall rate of dye adsorption appeared to be controlled by chemisorption, in this case in accordance with poor desorption studies.

  12. Taxation of Controlled Foreign Companies in Context of the OECD/G20 Project on Base Erosion and Profit Shifting as well as the EU Proposal for the Anti-Tax Avoidance Directive – An Interim Nordic Assessment

    Directory of Open Access Journals (Sweden)

    Schmidt Peter Koerver

    2016-11-01

    Full Text Available Recently, the controlled foreign company (CFC rules have gained increased attention; as such, rules play an important role in the ongoing efforts of the OECD/G20 and the European Commission with respect to addressing base erosion and profit shifting (BEPS. In this context, the article revisits the CFC regimes of the Nordic countries in order to assess whether these regimes are in line with the recommendations from the OECD/G20 and to determine whether Sweden, Finland, and Denmark, as EU member states, will have to make amendments if the commission’s proposal for an Anti-Tax Avoidance Directive is adopted in its current form. It is concluded that the Nordic CFC regimes in many ways already are in line with the recommendations as well as the directive, but also that certain amendments have to be made.

  13. An improved DS acoustic-seismic modality fusion algorithm based on a new cascaded fuzzy classifier for ground-moving targets classification in wireless sensor networks

    Science.gov (United States)

    Pan, Qiang; Wei, Jianming; Cao, Hongbing; Li, Na; Liu, Haitao

    2007-04-01

    A new cascaded fuzzy classifier (CFC) is proposed to implement ground-moving targets classification tasks locally at sensor nodes in wireless sensor networks (WSN). The CFC is composed of three and two binary fuzzy classifiers (BFC) respectively in seismic and acoustic signal channel in order to classify person, Light-wheeled (LW) Vehicle, and Heavywheeled (HW) Vehicle in presence of environmental background noise. Base on the CFC, a new basic belief assignment (bba) function is defined for each component BFC to give out a piece of evidence instead of a hard decision label. An evidence generator is used to synthesize available evidences from BFCs into channel evidences and channel evidences are further temporal-fused. Finally, acoustic-seismic modality fusion using Dempster-Shafer method is performed. Our implementation gives significantly better performance than the implementation with majority-voting fusion method through leave-one-out experiments.

  14. LUMPED: a Visual Basic code of lumped-parameter models for mean residence time analyses of groundwater systems

    Science.gov (United States)

    Ozyurt, N. N.; Bayari, C. S.

    2003-02-01

    A Microsoft ® Visual Basic 6.0 (Microsoft Corporation, 1987-1998) code of 15 lumped-parameter models is presented for the analysis of mean residence time in aquifers. Groundwater flow systems obeying plug and exponential flow models and their combinations of parallel or serial connection can be simulated by these steady-state models which may include complications such as bypass flow and dead volume. Each model accepts tritium, krypton-85, chlorofluorocarbons (CFC-11, CFC-12 and CFC-113) and sulfur hexafluoride (SF 6) as environmental tracer. Retardation of gas tracers in the unsaturated zone and their degradation in the flow system may also be accounted for. The executable code has been tested to run under Windows 95 or higher operating systems. The results of comparisons between other comparable codes are discussed and the limitations are indicated.

  15. An improved constrained scheme for the Einstein equations: an approach to the uniqueness issue

    CERN Document Server

    Cordero-Carrión, Isabel; Dimmelmeier, Harald; Jaramillo, José Luis; Novak, Jérôme; Gourgoulhon, Eric

    2008-01-01

    Uniqueness problems in the elliptic sector of constrained formulations of Einstein equations have a dramatic effect on the physical validity of some numerical solutions, for instance when calculating the spacetime of very compact stars or nascent black holes. The fully constrained formulation (FCF) proposed by Bonazzola, Gourgoulhon, Grandcl\\'ement, and Novak is one of these formulations. It contains, as a particular case, the approximation of the conformal flatness condition (CFC) which, in the last ten years, has been used in many astrophysical applications. The elliptic part of the FCF basically shares the same differential operators as the elliptic equations in CFC scheme. We present here a reformulation of the elliptic sector of CFC that has the fundamental property of overcoming the local uniqueness problems. The correct behavior of our new formulation is confirmed by means of a battery of numerical simulations. Finally, we extend these ideas to FCF, complementing the mathematical analysis carried out i...

  16. Extinction learning, which consists of the inhibition of retrieval, can be learned without retrieval.

    Science.gov (United States)

    de Carvalho Myskiw, Jociane; Furini, Cristiane Regina Guerino; Schmidt, Bianca; Ferreira, Flávia; Izquierdo, Ivan

    2015-01-13

    In the present study we test the hypothesis that extinction is not a consequence of retrieval in unreinforced conditioned stimulus (CS) presentation but the mere perception of the CS in the absence of a conditioned response. Animals with cannulae implanted in the CA1 region of hippocampus were subjected to extinction of contextual fear conditioning. Muscimol infused intra-CA1 before an extinction training session of contextual fear conditioning (CFC) blocks retrieval but not consolidation of extinction measured 24 h later. Additionally, this inhibition of retrieval does not affect early persistence of extinction when tested 7 d later or its spontaneous recovery after 2 wk. Furthermore, both anisomycin, an inhibitor of ribosomal protein synthesis, and rapamycin, an inhibitor of extraribosomal protein synthesis, given into the CA1, impair extinction of CFC regardless of whether its retrieval was blocked by muscimol. Therefore, retrieval performance in the first unreinforced session is not necessary for the installation, maintenance, or spontaneous recovery of extinction of CFC.

  17. Comparison of salivary and calculated free cortisol levels during low and standard dose of ACTH stimulation tests in healthy volunteers.

    Science.gov (United States)

    Elbuken, Gulsah; Tanriverdi, Fatih; Karaca, Zuleyha; Kula, Mustafa; Gokahmetoglu, Selma; Unluhizarci, Kursad; Kelestimur, Fahrettin

    2015-03-01

    Salivary cortisol (SC) has been increasingly used as a surrogate biomarker of free cortisol (FC) for the assessment of hypothalamo-pituitary-adrenal (HPA) axis, but there are not enough data regarding its use during ACTH stimulation tests. Therefore, we aimed to determine the responses of SC, calculated free cortisol (cFC) and free cortisol index (FCI) to ACTH stimulation tests in healthy adults. Forty-four healthy volunteers (24 men and 20 women) were included in the study. Low-dose (1 µg) and standard-dose (250 µg) ACTH stimulation tests were performed on two consecutive days. Basal and stimulated total cortisol (TC) and cortisol-binding globulin (CBG) levels and SC levels were measured during both doses of ACTH stimulation tests. cFC (by Coolens' equation) and FCI levels were calculated from simultaneously measured TC and CBG levels. The minimum SC, cFC, FCI levels after low-dose ACTH stimulation test were 0.21, 0.33, 16.06 µg/dL, and after standard-dose ACTH were 0.85, 0.46, 26.11 µg/dL, respectively, in healthy individuals who all had TC responses higher than 20 µg/dL. Peak CBG levels after both doses of ACTH stimulation tests were found to be higher in women than in men. So, by its effect, peak cFC and FCI levels were found to be lower in female than in male group. Neither TC nor SC levels were affected by gender. cFC and FCI levels depend on CBG levels and they are affected by gender. Cut-off levels for SC, cFC, FCI levels after both low- and standard-dose ACTH stimulation are presented. Studies including patients with adrenal insufficiency would be helpful to see the diagnostic value of these suggested cut-off levels.

  18. Outgassing of plasma facing antenna front for lower hybrid wave launcher

    Energy Technology Data Exchange (ETDEWEB)

    Maebara, Sunao E-mail: maebara@felsunl.tokai.jaeri.go.jp; Goniche, Marc; Kazarian, Fabienne; Seki, Masami; Ikeda, Yoshitaka; Imai, Tsuyoshi; Bibet, Philippe; Froissard, Philippe; Rey, Guy

    2000-11-01

    A 3.7 GHz mock-up antenna module using carbon fiber composite (CFC) was fabricated and tested for the development of a heat-resistive front of the lower hybrid current drive (LHCD) antenna. This module has four waveguides and a water cooling channel, the length is 206 mm. The CFC surface was coated with a thin titanium layer and was plated with copper in order to reduce RF losses, to bond rods and septum plates and to assemble them with cooling channel. The RF losses and the outgassing rates of this CFC module at high RF power were measured during long pulses. When the injected power varies between 30 and 100 kW, the RF losses measured by calorimetery, were found to be in the range of 1.0-1.2%. It is found that this experimental value is 2.5-3.0 times higher than the theoretical value of pure copper. Stationary operation of the CFC module with water cooling is performed at the RF power density of 45 MW m{sup -2} during 1000 s. The outgassing rates from the CFC module are in the range of 0.93{approx}1.3x10{sup -6} Pam{sup -3} s{sup -1} m{sup -2} at the module temperature of 120 deg. C, it is low enough for an antenna material. No significant bonding defects occurred during the steady-state operation. It is assessed that a CFC module is an attractive candidate for a heat-resistive front of LHCD antenna.

  19. Practical dc SQUID system: Devices and electronics

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Guofeng [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology (SIMIT), Chinese Academy of Sciences (CAS), Shanghai 200050 (China); Joint Research Laboratory on Superconductivity and Bioelectronics, Collaboration between CAS-Shanghai and FZJ (Germany); Zhang, Yi, E-mail: y.zhang@fz-juelich.de [Peter Grünberg Institute (PGI-8), Forschungszentrum Jülich (FZJ), D-52425 Jülich (Germany); Joint Research Laboratory on Superconductivity and Bioelectronics, Collaboration between CAS-Shanghai and FZJ (Germany); Hong, Tao; Wang, Hai [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology (SIMIT), Chinese Academy of Sciences (CAS), Shanghai 200050 (China); Joint Research Laboratory on Superconductivity and Bioelectronics, Collaboration between CAS-Shanghai and FZJ (Germany); University of Chinese Academy of Sciences, Beijing 100049 (China); Krause, Hans-Joachim [Peter Grünberg Institute (PGI-8), Forschungszentrum Jülich (FZJ), D-52425 Jülich (Germany); Joint Research Laboratory on Superconductivity and Bioelectronics, Collaboration between CAS-Shanghai and FZJ (Germany); Xie, Xiaoming [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology (SIMIT), Chinese Academy of Sciences (CAS), Shanghai 200050 (China); Joint Research Laboratory on Superconductivity and Bioelectronics, Collaboration between CAS-Shanghai and FZJ (Germany)

    2015-11-15

    Highlights: • The current noise contribution in direct readout scheme for dc SQUID was analyzed. • A current feedback circuit for suppressing the current noise was introduced. • Two criteria to measure the suppression factor were introduced. • A practical SQUID system with acceptable noise performance was suggested. - Abstract: In order to set up a liquid helium-cooled practical dc SQUID system with acceptable noise figure, we employ a weakly damped dc SQUID with a large flux-to-voltage transfer coefficient ∂V/∂Φ in a direct readout scheme (DRS) without flux modulation. Two preamplifiers are utilized: (1) AD 797 for a so-called “single chip readout electronics” (SCRE); (2) 6 parallel-connected bipolar transistors (PCBT). The latter reduces the preamplifier voltage noise V{sub n} but increases its current noise I{sub n}, which plays a leading role in the system low-frequency noise. We introduce a current feedback circuit (CFC) consisting of an inductor L{sub i} coupled to the SQUID with mutual inductance M{sub i} to improve the noise performance. In this work, the preamplifier I{sub n} contribution and CFC are analyzed. To evaluate the I{sub n} suppression with CFC, two criteria are presented. Furthermore, we establish a dimensionless parameter ξ to describe CFC quantitatively. The system noise is compared with and without CFC using the two preamplifiers. For a dc SQUID with a loop inductance of 350 pH, an intrinsic noise of about 5 μΦ{sub 0}/√Hz and a corner frequency at 2 Hz are measured using PCBT with CFC.

  20. Stratospheric Ozone and Temperature Changes in the Past: The Impact of Increased Concentrations of CFCs in Simulations with a Chemistry-Climate Model

    Science.gov (United States)

    Meul, S.; Oberländer, S.; Abalichin, J.; Kubin, A.; Langematz, U.

    2012-04-01

    Changes in stratospheric ozone between 1960 and the end of the 20th century are investigated analysing simulations with the Chemistry-Climate-Model (CCM) EMAC in FUB configuration (i.e. 39 layers with FUBRad parameterisation). In order to analyse the impact of increasing emissions of chlorofluorocarbons (CFCs) from 1960 to 2000 two sensitivity studies have been performed: a reference simulation with boundary conditions for the year 2000 and one analogue simulation but with CFC emissions reduced to 1960 levels. By comparing to a transient simulation (1960 to 2100) using the CCMVal SCN-B2d scenario it is possible to isolate the ozone changes that are caused by the CFC-increase only and separate the CFC-effect from other processes affecting ozone, e.g. climate change. By applying the method of Garny et al. (2011) the relative ozone changes arising from the CFC-modification can be attributed to changes in transport, chemical production and loss. Furthermore, it is analysed how the processes related to the CFC-increase contribute to the stratospheric cooling of up to 4K that is simulated by the SCN-B2d run between the 1960s and the 2000s in the upper stratosphere. The temperature change due to increased CFCs is caused by a reduced absorption of solar radiation by decreased ozone concentrations combined with the greenhouse gas (GHG) effect of the CFCs. In the upper stratosphere a cooling of up to 2.5K can be explained by the CFC-increase.

  1. Chillers - entering the next century

    Energy Technology Data Exchange (ETDEWEB)

    Ertinger, R.; Brasz, J. [Carrier Corp., Syracuse, NY (United States)

    1999-07-01

    During the last twenty five years there have been major changes in the HVAC equipment offered in the marketplace. One of the product lines with the most significant changes is that of centrifugal chillers. It has been impacted by two strong forces: (1) the need for energy efficiency, and (2) regulations against the use of CFC refrigerants. Chiller manufacturers reacted in impressive fashion, furnishing non-CFC chillers with increased efficiency achieved through a variety of technology improvements. These gains continue, under the influence of ongoing market needs and changes. (orig.)

  2. GPi oscillatory activity differentiates tics from the resting state, voluntary movements, and the unmedicated parkinsonian state

    Directory of Open Access Journals (Sweden)

    Joohi Jimenez-Shahed

    2016-09-01

    Full Text Available Background: Deep brain stimulation (DBS is an emerging treatment strategy for severe, medication-refractory Tourette syndrome (TS. Thalamic (Cm-Pf and pallidal (including globus pallidus interna, GPi targets have been the most investigated. While the neurophysiological correlates of Parkinson’s disease (PD in the GPi and subthalamic nucleus (STN are increasingly recognized, these patterns are not well characterized in other disease states. Recent findings indicate that the cross-frequency coupling (CFC between beta band and high frequency oscillations (HFOs within the STN in PD patients is pathologic. Methods: We recorded intraoperative local field potentials (LFPs from the postero-ventrolateral GPi in three adult patients with TS at rest, during voluntary movements, and during tic activity and compared them to the intraoperative GPi-LFP activity recorded from four unmedicated PD patients at rest. Results: In all PD patients, we noted excessive beta band activity (13-30Hz at rest which consistently modulated the amplitude of the co-existent HFOs observed between 200-400Hz, indicating the presence of beta-HFO CFC. In all 3 TS patients at rest, we observed theta band activity (4-7Hz and HFOs. Two patients had beta band activity, though at lower power than theta oscillations. Tic activity was associated with increased high frequency (200-400Hz and gamma band (35-200Hz activity. There was no beta-HFO CFC in TS patients at rest. However, CFC between the phase of 5-10Hz band activity and the amplitude of HFOs was found in two TS patients. During tics, this shifted to CFC between the phase of beta band activity and the amplitude of HFOs in all subjects. Conclusions: To our knowledge this is the first study that shows that beta-HFO CFC exists in the GPi of TS patients during tics and at rest in PD patients, and suggests that this pattern might be specific to pathologic/involuntary movements. Furthermore, our findings suggest that during tics, resting

  3. Comparison of lead and tin concentrations in air at a solder manufacturer from the closed-face 37-mm cassette with and without a custom cellulose-acetate cassette insert.

    Science.gov (United States)

    Lee, Eun Gyung; Chisholm, William P; Burns, Dru A; Nelson, John H; Kashon, Michael L; Harper, Martin

    2014-01-01

    A polyvinyl chloride (PVC) cassette insert with PVC filter (ACCU-CAP) in a 37-mm closed-face cassette (CFC) was designed for gravimetric analysis. A customized version of the ACCU-CAP, also to be used in the CFC, was manufactured from an acid-digestible cellulose-acetate cassette insert joined to a mixed cellulose ester (MCE) filter for wet chemical analysis. The aim of this study was to compare metal particle concentrations as sampled by the customized insert (CI) in a CFC sampler with the traditional sampling method using only a MCE filter in the CFC. Thirty-nine personal and 13 area samples were taken using paired filter-based CFC and the CI in CFC samplers at a solder manufacturing plant. The CI was removed from its CFC, and digested and analyzed as a whole. The MCE filter from the typical CFC was removed for analysis and then the interior of the cassette was wiped with Ghost Wipe for a separate analysis. The MCE filter only, Ghost Wipe, and CI were separately dissolved in heated nitric acid for ICP-MS analysis. Overall, the geometric mean concentration of the filter-only (FO) samples was considerably lower than that of the CI samples, by 53% for lead and 32% for tin. However, if the FO analysis was added to the corresponding Ghost Wipe analysis, i.e., filter+interior wipe (FW), the geometric mean concentrations of the FW results were similar to those of the CI results (by 113% for lead and 98% for tin). For both lead and tin the comparison of (log-transformed) metal concentrations between the FW and CI results showed no statistically significant difference (p-value = 0.3009 for lead and 0.800 for tin), while the comparison between the FO and CI results shows statistically significant differences (all p-values < 0.05). In conclusion, incorporating the sampler internal non-filter deposits by wiping or use of an internal filter capsule gave higher results than analyzing only the filter. Close agreement between the two methods of including non-filter deposits is

  4. Air; Air

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2000-09-01

    The regulation (CE/2037/2000) of the Parliament and Council of Europe of the 29. of June 2000 amends and replaces the regulation (CE/3093/94) relative to substances impoverishing the ozone layer. It applies to the production, the import, the export, the marketing, the use, the recovery, the recycling, the regeneration and the destruction of chlorofluorocarbons (CFC), other CFC (entirely halogenated), halons, carbon tetrachloride, 1,1,1-tri-chloro-ethane, methyl bromide, hydro-bromo-fluorocarbons and hydro-chlorofluorocarbons (HCFC) and of all products which contain these substances. It applies too to data to be reported on these substances. (O.M.)

  5. DEVELOPMENT AND VALIDATION OF TWO FOOD FREQUENCY QUESTIONNAIRES TO ASSESS GLUTEN INTAKE IN CHILDREN UP TO 36 MONTHS OF AGE.

    Science.gov (United States)

    Crespo Escobar, Paula; Calvo Lerma, Joaquim; Hervas Marin, David; Donat Aliaga, Ester; Masip Simó, Etna; Polo Miquel, Begoña; Ribes Koninckx, Carmen

    2015-11-01

    Antecedentes y objetivos: una información precisa sobre el consumo de gluten es muy importante para estudiar el verdadero impacto de la introducción y la ingesta de gluten en el desarrollo de la enfermedad celiaca. El objetivo del estudio fue desarrollar y validar herramientas (cuestionarios de frecuencia de consumo, CFC) para evaluar el consumo de gluten en niños con edades comprendidas entre los 7 y 36 meses. Métodos: se incluyeron un total de 342 niños reclutados en el Hospital Universitario y Politécnico de La Fe, así como en guarderías y escuelas de primaria con problemas menores de salud. Se desarrollaron dos CFC diferentes (uno para niños de 7 a 12 meses y otro para niños de 13 a 36 meses). Para su validación, los resultados obtenidos con los CFC se compararon con un registro alimentario de dos días (2RA) y también con un registro alimentario de soete días (7RA), considerado el “estándar de oro”. La ingesta media de gluten obtenida de la comparación del 2RA vs. CFC y de 7RA vs. CFC fueron comparadas usando el método de Bland Altman plot y también el coeficiente de correlación de concordancia de Lin’s. Resultados: de acuerdo a los resultados de los dos métodos estadísticos usados para la validación, se encontró una buena correlación entre los CFC y los registros alimentarios de dos y siete días, lo que indica que los CFC son fiables para la evaluación de la ingesta de gluten. Conclusiones: estos dos nuevos CFC son los únicos validados y disponibles en España para la evaluación de la ingesta de gluten. Además, son herramientas útiles y fáciles de usar para el cálculo del consumo de gluten en niños de hasta tres años de edad.

  6. The Production and Release of CFCs from Coal Combustion

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The destruction of the ozone layer in the atmosphere caused by industrially synthesized CFCs has aroused greatest concerns from the international society, but the CFCs formed from burning of coal containing fluorine have not been recognized by the world yet. In the present study, we condensed the gas through cold traps and used the GC-MS to measure the gas composition, and found that the content of CFC-12 in the smog from coal combustion was significantly higher than the background value of the local atmosphere. This proves that CFC-12 is formed in the process of coal combustion. This paper discusses a new source of non-synthesized CFCs.

  7. 温室气体的“源”与“汇”及其防治对策%The "Source" and "Collection" of Greenhouse Gases and Its Control Measure

    Institute of Scientific and Technical Information of China (English)

    王晓峰

    2012-01-01

    From the theories of "source" and "collection", the paper analyses the "source" and "collection" of four kinds of greenhouse gases: CO2, CH4, N2O and CFC8, and provided some methods to control the greenhouse gas.%从“源”与“汇”理论入手,分析大气中四种主要温室气体CO2、CH4、N2O和CFC8的“源”与“汇”,并提出相应防治对策。

  8. GPi Oscillatory Activity Differentiates Tics from the Resting State, Voluntary Movements, and the Unmedicated Parkinsonian State

    Science.gov (United States)

    Jimenez-Shahed, Joohi; Telkes, Ilknur; Viswanathan, Ashwin; Ince, Nuri F.

    2016-01-01

    Background: Deep brain stimulation (DBS) is an emerging treatment strategy for severe, medication-refractory Tourette syndrome (TS). Thalamic (Cm-Pf) and pallidal (including globus pallidus interna, GPi) targets have been the most investigated. While the neurophysiological correlates of Parkinson's disease (PD) in the GPi and subthalamic nucleus (STN) are increasingly recognized, these patterns are not well characterized in other disease states. Recent findings indicate that the cross-frequency coupling (CFC) between beta band and high frequency oscillations (HFOs) within the STN in PD patients is pathologic. Methods: We recorded intraoperative local field potentials (LFPs) from the postero-ventrolateral GPi in three adult patients with TS at rest, during voluntary movements, and during tic activity and compared them to the intraoperative GPi-LFP activity recorded from four unmedicated PD patients at rest. Results: In all PD patients, we noted excessive beta band activity (13–30 Hz) at rest which consistently modulated the amplitude of the co-existent HFOs observed between 200 and 400 Hz, indicating the presence of beta-HFO CFC. In all 3TS patients at rest, we observed theta band activity (4–7 Hz) and HFOs. Two patients had beta band activity, though at lower power than theta oscillations. Tic activity was associated with increased high frequency (200–400 Hz) and gamma band (35–200 Hz) activity. There was no beta-HFO CFC in TS patients at rest. However, CFC between the phase of 5–10 Hz band activity and the amplitude of HFOs was found in two TS patients. During tics, this shifted to CFC between the phase of beta band activity and the amplitude of HFOs in all subjects. Conclusions: To our knowledge this is the first study that shows that beta-HFO CFC exists in the GPi of TS patients during tics and at rest in PD patients, and suggests that this pattern might be specific to pathologic/involuntary movements. Furthermore, our findings suggest that during tics

  9. Ultrasonic test of carbon composite/copper joints in the ITER divertor

    Energy Technology Data Exchange (ETDEWEB)

    Roccella, S., E-mail: selanna.roccella@enea.it [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy); Cacciotti, E. [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy); Candura, D. [Ansaldo Nucleare S.p.A., C. so F.M. Perrone 25, 16152 Genoa (Italy); Mancini, A.; Pizzuto, A.; Reale, A. [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy); Tatì, A. [Associazione Euratom-ENEA sulla Fusione, C.R. Casaccia, Via Anguillarese 301, 00123 Santa Maria di Galeria, RM (Italy); Visca, E. [Associazione ENEA-Euratom sulla Fusione, C.R. Frascati, 00044 Frascati, RM (Italy)

    2013-10-15

    Highlights: • ENEA developed and tested a specimen for the simulation of defects at the interface between CFC and copper. • The use of an ultrasonic technique properly set permitted to highlight and size with high accuracy the defects. • The technology developed could be employed successfully in the production of these components for high heat flux applications. -- Abstract: The vertical targets of the ITER divertor consist of high flux units (HFU) actively cooled: CuCrZr tubes armoured by tungsten and carbon/carbon fibre composite (CFC). The armour is obtained with holed parallelepiped blocks, called monoblocks, previously prepared and welded onto the tubes by means diffusion bonding. The monoblock preparation consists in the casting of a layer of copper oxygen free (Cu OFHC) inside the monoblock hole. Each HFU is covered with more than 100 monoblocks that have to be joined simultaneously to the tube. Therefore, it is very important to individuate any defects present in the casting of Cu OFHC or at the interface with the CFC before the monoblocks are installed on the units. This paper discusses the application of non-destructive testing by ultrasound (US) method for the control of the joining interfaces between CFC monoblocks and Cu OFHC, before the brazing on the CrCrZr tube. In ENEA laboratory an ultrasonic technique (UT) suitable for the control of these joints with size and geometry according to the ITER specifications has been developed and widely tested. Real defects in this type of joints are, however, still hardly detected by UT. The CFC surface has to be machined to improve the mechanical strength of the joint. This results in a surface not perpendicular to the ultrasonic wave. Moreover, CFC is characterized by high acoustic attenuation of the ultrasonic wave and then it is not easy to get information regarding the Cu/CFC bonding. Nevertheless, the UT sharpness and simplicity pushes to perform some further study. With this purpose, a sample with

  10. Improvement of the SCC resistance of FCC alloys: influence of pre-fatigue on the SCC resistance of the austenitic stainless steel-316L in a MgCl{sub 2} boiling solution at 117 deg C; Recherche d'une amelioration du comportement en CSC d'alliages de structure CFC: influence d'une pre-deformation en fatigue oligocyclique sur le comportement en CSC de l'acier inoxydable austenitique 316L dans une solution bouillante de MgCl{sub 2} a 117 deg C

    Energy Technology Data Exchange (ETDEWEB)

    Curiere, I. de

    2000-12-01

    The aim of this study is to analyse the effect of pre-fatigue of FCC materials on their mechanical and electrochemical response to better understand and delay the SCC damage. The material/environment couple tested is the 316L polycrystalline austenitic stainless steel in boiling MgCl{sub 2} at 30% mass. Samples are pre-strained in low cycle fatigue under plastic strain control, with a p/2 value of 0.4%, for various number of cycles (25%, 75% and at the number of cycles to reach saturation during pre-fatigue). It was found that only pre-fatigue at saturation improves the SCC resistance of the material, both on SSRT and constant load tests. A delayed crack initiation up to 10% of strain. which increases strain to failure by half. mostly accounts for this beneficial effect, during SSRT tests. Furthermore, other pre-straining only resulted in loss of strain to fracture and no delay in crack initiation. We related the crack initiation delay to the surface strain state due to pre-fatigue. It provides fine parallel slip bands. homogeneously located at the surface of the samples. This surface state induces an increasing anodic surface-cathodic surface ratio which lowers the kinetics of localised corrosion. thus that of crack initiation. We also show some experiments implying that pre-fatigue at saturation decreases the SCC crack growth velocity which can be understood through the CEP (Corrosion Enhanced Plasticity) Model. We also show that this beneficial effect is probably available on other fcc material/environment couples, such as OFHC Cu/ 1 M NaNO{sub 2} at pH 9. (author)

  11. Implementation of window shading models into dynamic whole-building simulation

    Science.gov (United States)

    Lomanowski, Bartosz Aleksander

    An important consideration in energy efficient building design is the management of solar gain, as it is the largest and most variable gain in a building. The design of buildings with highly glazed facades, as well as decreased energy transfer rates through better insulated and tighter envelopes are causing interior spaces to become highly sensitive to solar gain. Shading devices such as operable slat-type louver blinds are very effective in controlling solar gain, yet their impact on peak cooing loads and annual energy consumption is poorly understood. With the ever-increasing role of building energy simulation tools in the design of energy efficient buildings, there is a clear need to model windows with shading devices to assess their impact on building performance. Recent efforts at the University of Waterloo's Advanced Glazing Systems Laboratory (AGSL) in window shading research have produced a set of flexible shading models. These models were developed with emphasis on generality and computational efficiency, ideally suited for integration into building simulation. The objective of the current research is to develop a complex fenestration facility within a general purpose integrated building simulation software tool, ESP-r, using the AGSL shading models. The strategy for implementation of the AGSL shading models is the addition of a new multi-layer construction within ESP-r, the Complex Fenestration Construction (CFC). The CFC is based on the standard ESP-r multi-layer nodal structure and finite control volume numerical model, with additional measures for coping with the complexities that arise in the solar, convective and radiant exchanges between glazing/shading layers, the interior zone and exterior surroundings. The CFC algorithms process the solar, convective and radiant properties of the glazing/shading system at each time-step, making it possible to add control (e.g., changing the slat angle of a slat-type blind) at the time-step level. Thermal

  12. Situation and perspectives in refrigerating and air-conditioning. The point of view of Elf Atochem; Situation et perspectives en refrigeration et air conditionne. Point de vue d`Elf Atochem

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This paper is a series of transparencies which explains the engagements of Elf Atochem company in the replacement of chlorofluorocarbons (CFCs): development of HFCs, production of FORANE, safety and environmental criteria, main refrigerants and their application in new installations, perspectives in reconversion, replacement of R-22, CFC-12 and R-502 fluids with respect to their applications. (J.S.)

  13. Characterization, test and interpretative simulations of one-dimensional Carbon Fiber Composite prototype for SPIDER experiment

    Energy Technology Data Exchange (ETDEWEB)

    De Muri, M., E-mail: michela.demuri@igi.cnr.it [Consorzio RFX – Associazione Euratom-Enea sulla Fusione, corso Stati Uniti 4, I-35127 Padova (Italy); Dipartimento di Ingegneria Elettrica, Padova University, Padova (Italy); Cervaro, V.; Dal Bello, S.; Dalla Palma, M.; Fasolo, D.; Franchin, L.; Pasqualotto, R.; Pomaro, N.; Rizzolo, A.; Tollin, M.; Serianni, G. [Consorzio RFX – Associazione Euratom-Enea sulla Fusione, corso Stati Uniti 4, I-35127 Padova (Italy)

    2013-10-15

    Highlights: • Prototype ITER neutral beam injector to study the beam source behavior requires beam characterization. • Among several types of diagnostic, a calorimeter made of fiber carbon composite (CFC) tiles will be used. • The CFC thermal behaviour is study by laser beam and will be characterize in particel beam. • Experiments and simulations results are discussed. • Designs for tests in particle beams are presented. -- Abstract: For ITER operations, additional heating systems are required. One of these systems is the neutral beam injector (NBI). The SPIDER experiment, a small-scale NBI, is going to be built with the aim to optimize the beam source. For this reason it is provided with several diagnostics, among which the Short-Time Retractable Instrumented Kalorimeter Experiment (STRIKE). In this contribution, a characterization of the Carbon Fiber Composite (CFC) tiles, which are the main component of the diagnostic, is presented. Such analyses include tests with a power laser, exposure to particle beams and thermal stress tests. The results are discussed, which will drive the definition of the acceptance tests of the final supply of CFC tiles.

  14. Methods development for measuring and classifying flammability/combustibility of refrigerants. Interim report, task 2 - test plan

    Energy Technology Data Exchange (ETDEWEB)

    Heinonen, E.W.; Tapscott, R.E. [Univ. of New Mexico, Albuquerque, NM (United States)

    1994-07-01

    Regulations on alternative refrigerants and concerns for the environment are forcing the refrigeration industry to consider the use of potentially flammable fluids to replace CFC fluids currently in use. The objectives of this program are to establish the conditions under which refrigerants and refrigerant blends exhibit flammability and to develop appropriate methods to measure flammability.

  15. 78 FR 77495 - Hearings of the Review Panel on Prison Rape

    Science.gov (United States)

    2013-12-23

    ... Statistics (BJS) in identifying common characteristics of victims and perpetrators of sexual victimization in... Statistics; Robert W. Dumond, LCMHC, CCMHC, Diplomate CFC, Senior Program Director, Just Detention... Correctional Association; Brenda V. Smith, Professor of Law, American University Washington College of Law;...

  16. Question No. 5: What Role Can Satellites Take, as a Complement to Ground Based Measurement Systems, to Provide Sustained Observations to Monitor GHG Emissions?

    Science.gov (United States)

    Chahine, Moustafa; Olsen, Edward

    2011-01-01

    What role can satellites take, as a complement to ground based measurement systems, to provide sustained observations to monitor GHG emissions (e.g., CO2, CH4, O3, N2O, CFC s, NH3, and NF3) that contribute to global warming?

  17. 26 CFR 52.4682-1 - Ozone-depleting chemicals.

    Science.gov (United States)

    2010-04-01

    ... transformation of an ODC into one or more new compounds (such as the transformation of CFC-113 into...-values and advertising material reflecting R-value claims for a particular rigid foam may be used to show... chlorofluorocarbons are used to fill voids within the polymer. (B) Examples of rigid foam products. Rigid...

  18. Extreme 13C depletion of CCl2F2 in firn air samples from NEEM, Greenland

    NARCIS (Netherlands)

    Zuiderweg, A.T.; Holzinger, R.; Röckmann, T.

    2012-01-01

    A series of 12 high volume air samples collected from the S2 firn core during the North Greenland Eemian Ice Drilling (NEEM) 2009 campaign have been measured for mixing ratio and stable carbon isotope composition of the chlorofluorocarbon CFC- 12 (CCl2F2). While the mixing ratio measurements compare

  19. 铆钉联接

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    A new approach to hybrid front-end systems;A versatile riveting system for metal/CFC structures;Achieving low-porosity laser welds in aerospace aluminium alloy;Affordable reconfigurable tooling;;Design and evaluation of novel composite aircraft repairs;Enhancement of fatigue life of self-piercing riveted joints by coining……

  20. Groundwater age, mixing and flow rates in the vicinity of large open pit mines, Pilbara region, northwestern Australia

    Science.gov (United States)

    Cook, Peter; Dogramaci, Shawan; McCallum, James; Hedley, Joanne

    2016-09-01

    Determining groundwater ages from environmental tracer concentrations measured on samples obtained from open bores or long-screened intervals is fraught with difficulty because the sampled water represents a variety of ages. A multi-tracer technique (Cl, 14C, 3H, CFC-11, CFC-12, CFC-113 and SF6) was used to decipher the groundwater ages sampled from long-screened production bores in a regional aquifer around an open pit mine in the Pilbara region of northwest Australia. The changes in tracer concentrations due to continuous dewatering over 7 years (2008-2014) were examined, and the tracer methods were compared. Tracer concentrations suggest that groundwater samples are a mixture of young and old water; the former is inferred to represent localised recharge from an adjacent creek, and the latter to be diffuse recharge. An increase in 14C activity with time in wells closest to the creek suggests that dewatering of the open pit to achieve dry mining conditions has resulted in change in flow direction, so that localised recharge from the creek now forms a larger proportion of the pumped groundwater. The recharge rate prior to development, calculated from a steady-state Cl mass balance, is 6 mm/y, and is consistent with calculations based on the 14C activity. Changes in CFC-12 concentrations with time may be related to the change in water-table position relative to the depth of the well screen.

  1. Taxation of Controlled Foreign Companies in Context of the OECD/G20 Project on Base Erosion and Profit Shifting as well as the EU Proposal for the Anti-Tax Avoidance Directive

    DEFF Research Database (Denmark)

    Schmidt, Peter Koerver

    2016-01-01

    Recently, the controlled foreign company (CFC) rules have gained increased attention; as such, rules play an important role in the ongoing efforts of the OECD/G20 and the European Commission with respect to addressing base erosion and profit shifting (BEPS). In this context, the article revisits...

  2. 40 CFR Appendix I to Subpart A of... - Global Warming Potentials (Mass Basis), Referenced to the Absolute GWP for the Adopted Carbon...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Global Warming Potentials (Mass Basis..., App. I Appendix I to Subpart A of Part 82—Global Warming Potentials (Mass Basis), Referenced to the... formula Global warming potential (time horizon) 20 years 100 years 500 years CFC-11 CFCl3 5000 4000...

  3. 5 CFR 950.105 - Principal Combined Fund Organization (PCFO) responsibilities.

    Science.gov (United States)

    2010-01-01

    ..., such as banking, auditing, reporting and distribution separate from the applicant's non-CFC operations... other types of charitable campaign drives. Additionally, keyworkers should be trained to check to ensure... Charity Lists that are consistent with these regulations and instructions by the Director. (6)...

  4. 49 CFR 572.189 - Instrumentation and test conditions.

    Science.gov (United States)

    2010-10-01

    .... (a) The test probe for lateral shoulder, thorax without arm, abdomen, and pelvis impact tests is the... conforms to SA572-S69. (e) Load sensors for the abdomen conform to specifications of SA572-S75. (f) Load..., and abdomen impactor accelerations—Digitally filtered CFC 180; (5) Abdominal and pubic symphysis...

  5. 77 FR 2225 - Allocation and Apportionment of Interest Expense

    Science.gov (United States)

    2012-01-17

    ... determined in Step 1 to arrive at total intangible asset value (Step 3). The intangible assets owned by the... process for determining total intangible asset value, means that such debt also is not treated as an asset... plant and equipment held by CFC 2 valued at $200 (80% of $250)). (D) Computation of intangible...

  6. Effects of drugs inhibiting prostaglandin or leukotriene biosynthesis on postirradiation haematopoiesis in mouse

    Energy Technology Data Exchange (ETDEWEB)

    Kozubik, A.; Hofmanova, J.; Pospisil, M.; Netikova, J.; Hola, J.; Lojek, A. (Ceskoslovenska Akademie Ved, Brno (Czech Republic). Biofysikalni Ustav)

    1994-03-01

    Two non-steroidal anti-inflammatory drugs, i.e. indomethacin (INDO), an inhibitor of prostaglandin production, and esculetin (ESCUL), an inhibitor of leukotriene production, were tested for their ability to modify haematopoiesis in three experimental systems: (a) in vitro clonal proliferation of marrow GM-CFC from the irradiated mouse was found to be augmented by addition of INDO at a low concentration, and inhibited by ESCUL in a dose-dependent manner; (b) in the lethally irradiated and bone marrow-transplanted mice treated with the drugs in the postirradiation period, stimulatory effects of INDO on CFU-S and GM-CFC populations and an inhibitory effect of ESCUL on GM-CFC were observed; and (c) when the drugs were administered i.p. to mice 1 h before 5-Gy irradiation, INDO enhanced the postirradiation recovery of haematopoietic indices such the numbers of CFU-S, GM-CFC, peripheral blood granuloctyes, and nucleated bone marrow cells, while ESCUL had no effect or even inhibited the recovery of these indices. (author).

  7. 26 CFR 1.954-2 - Foreign personal holding company income.

    Science.gov (United States)

    2010-04-01

    ... beginning of taxable year 3, CFC changes the use of the building by terminating all leases and using it in... as a hedging transaction does not itself operate to exclude gain from the appropriate category of... regular conduct of a lending or finance business, within the meaning of section 954(h)(4),...

  8. 5 CFR 950.102 - Scope of the Combined Federal Campaign.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Scope of the Combined Federal Campaign... Campaign. (a) The CFC is the only authorized solicitation of employees in the Federal workplace on behalf of charitable organizations. A campaign may be conducted during a period, as determined by the...

  9. Continual low-level MEK inhibition ameliorates cardio-facio-cutaneous phenotypes in zebrafish

    Directory of Open Access Journals (Sweden)

    Corina Anastasaki

    2012-07-01

    Cardio-facio-cutaneous (CFC syndrome is caused by germline mutations in KRAS, BRAF and MEK1/2. The highly selective and potent MEK inhibitors that have been developed as anti-cancer agents hold potential as therapeutics for CFC syndrome. We have previously shown that the effects of CFC mutations on zebrafish gastrulation can be prevented by a 1-hour treatment with MEK inhibitors within a specific developmental time-window. However, MEK activity is essential for normal development and PD0325901 treatment outside this treatment window leads to additional developmental defects in MEK-dependent tissues. We now test ten different doses of PD0325901 at six developmental time points and assess the effects on body axis length, heart development and craniofacial structures in zebrafish embryos. Notably, we find that a continuous low-level dose of PD0325901 that has only minor inhibition of MEK activity can prevent the action of both the common CFC BRAFQ257R kinase-active allele and the BRAFG596V kinase-impaired mutant allele through the first 5 days of development. These results provide a detailed study of the effects of PD0325901 in development and show that, unlike in cancer, which requires robust inhibition of MAPK signalling, a partial reduction in phospho-ERK1/2 activity is sufficient to moderate the developmental effects of BRAFCFC mutations.

  10. COP improvement of refrigerator/freezers, air-conditioners, and heat pumps using nonazeotropic refrigerant mixtures

    Science.gov (United States)

    Westra, Douglas G.

    1993-01-01

    With the February, 1992 announcement by President Bush to move the deadline for outlawing CFC (chloro-fluoro-carbon) refrigerants from the year 2000 to the year 1996, the refrigeration and air-conditioning industries have been accelerating their efforts to find alternative refrigerants. Many of the alternative refrigerants being evaluated require synthetic lubricants, are less efficient, and have toxicity problems. One option to developing new, alternative refrigerants is to combine existing non-CFC refrigerants to form a nonazeotropic mixture, with the concentration optimized for the given application so that system COP (Coefficient Of Performance) may be maintained or even improved. This paper will discuss the dilemma that industry is facing regarding CFC phase-out and the problems associated with CFC alternatives presently under development. A definition of nonazeotropic mixtures will be provided, and the characteristics and COP benefits of nonazeotropic refrigerant mixtures will be explained using thermodynamic principles. Limitations and disadvantages of nonazeotropic mixtures will be discussed, and example systems using such mixtures will be reviewed.

  11. Command Styles in the Canadian Navy: Preliminary Investigation

    Science.gov (United States)

    2016-06-07

    because he didn’t understand how the CDA worked. Most agreed with the idea that a CDA should present a shopping list of some sort, with easily...Nature of organisation as a factor in command *Commanders not trained to be experts in ROEs Subject #2 Contact CFC for online resources

  12. Milieurapportage 1993. II. Integratierapport, 'Aantasting ozonlaag en blootstelling UV'

    NARCIS (Netherlands)

    Aben JMM; Aldenkamp FJ; Bordewijk JA; Eggink GJ; Garssen J; Heij GJ; van Liere L; van Loveren H; Matthijsen AJCM; Olivier JGJ; Pruppers MJM; Reinen H; Slaper H; Thomas R; Veen A; Verweij W; van der Woerd H; LLO; LSO; PAT; LWD; LAE

    1994-01-01

    The report deals with compounds which are known or supposed to deplete the stratospheric ozone layer (such as CFC's). The entire chain is discussed, starting with production and emission of these compounds. Emissions are followed by dispersion in the atmosphere which results in depletion of t

  13. Ozone depletion and skin cancer incidence: an integrated modelling approach

    NARCIS (Netherlands)

    Slaper H; den Elzen MGJ; de Woerd HJ; de Greef J

    1992-01-01

    A decrease in stratospheric ozone, probably caused by chlorofluorocarbon (CFC) emissions, has been observed over large parts of the globe. The incidence of skin cancer is expected to increase due to ozone depletion. An integrated source-risk model is developed and applied to evaluate the increased

  14. 5 CFR 4501.103 - Prior approval for certain outside activities.

    Science.gov (United States)

    2010-01-01

    ..., director, trustee, general partner, employee, agent, attorney, consultant, contractor, or active... fundraising support through the Combined Federal Campaign (CFC) under 5 CFR part 950 and the employee's... representative of the OPM employees in the unit it represents to provide services as an agent or attorney for,...

  15. Validation of sub-grid-scale mixing schemes using CFCs in a global ocean model

    Science.gov (United States)

    Robitaille, Daniel Y.; Weaver, Andrew J.

    Three sub-grid-scale mixing parameterizations (lateral/vertical; isopycnal; Gent and McWilliams, 1990) are used in a global ocean model in an attempt to determine which yields the best ocean climate. Observed CFC-11 distributions, in both the North and South Atlantic, are used in evaluating the model results. While the isopycnal mixing scheme does improve the deep ocean potential temperature and salinity distributions, when compared to results from the traditional lateral/vertical mixing scheme, the CFC-11 distribution is worse in the upper ocean due to too much mixing. The Gent and McWilliams (1990) parameterization significantly improves the CFC-11 distributions when compared to both of the other schemes. The main improvement comes from a reduction of CFC uptake in the southern ocean where the ‘bolus’ transport cancels the mean advection of tracers and hence causes the Deacon Cell to disappear. These results suggest that the asymmetric response found in CO2-increase experiments, whereby the climate over the southern ocean does not warm as much as in the northern hemisphere, may be due to the particular mixing schemes used.

  16. Global Warming: How Much and Why?

    Science.gov (United States)

    Lanouette, William

    1990-01-01

    Summarizes the history of the study of global warming and includes a discussion of the role of gases, like carbon dioxide, methane, and chlorofluorocarbon (CFC). Discusses modern research on the global warming, including computer modelling and the super-greenhouse effect. (YP)

  17. Development of lifetime test procedure for powder evacuated panel insulation. CRADA final report

    Energy Technology Data Exchange (ETDEWEB)

    Wilkes, K E; Graves, R S; Childs, K W

    1996-03-01

    This CRADA is between Appliance Research Consortium (ARC) of the Association of Home Appliance Manufacturers (AHAM) and the Lockheed Martin Energy Research Corp. A Powder Evacuated Panel (PEP) is a "super" thermal insulation, having a thermal resistivity (R) substantially above that of existing insulation without the environmental problems of some insulations such as Chlorofluorocarbon (CFC) blown foam.

  18. JPRS Reports, Environmental Issues

    Science.gov (United States)

    2007-11-02

    Chemical Sector Agree on Emission Levels manufacturer Recticel Nederland began to use a new BR3103132793 Rijswijk POLYTECHNISCH process which produces... Nederland is also one of the participants in the ment was always breathing down the industry’s neck. It "CFC-less" campaign which was initiated this

  19. The 2015 Transition of Wartime Operational Control: A Threat or Opportunity for the ROK /US Alliance

    Science.gov (United States)

    2014-06-13

    Multilateral component : MCM/ SCM ....................................................................... 27 Korean War OPCON Arrangements... component : MCM/ SCM The Security Consultative Meeting ( SCM ) and Military Committee Meeting (MCM) compose the primary ROK and U.S. venues to establish...SWOT) Analysis, Combined Forces Command (CFC), United Nations Command (UNC), ROK Joint Chief of Staff (JCS), Security Consultative Meeting ( SCM

  20. AcEST: DK955155 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .5 sp|Q8CFC7|SFR16_MOUSE Splicing factor, arginine/serine-rich 16 O... 32 2.6 sp|O08999|LTBP2_MOUSE Latent-t...SHSPSPPREKLTR 522 >sp|O08999|LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus mus

  1. HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...

  2. Data of evolutionary structure change: 1CFCA-2CTNA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CFCA-2CTNA 1CFC 2CTN A A -------ADQLTEEQIAEFKEAFSLFDK-DGDGTITTKE...A SLFDK-DGDGT ure>GGG - EEure> THR CA 546 2CTN A 2CTNA DIFVLGAEDGS ure>HHHH ...>1CFCA GQNPT-EAELQ ure> -HHHHHure>

  3. Application of environmental tracers to mixing, evolution, and nitrate contamination of ground water in Jeju Island, Korea

    Science.gov (United States)

    Koh, D.-C.; Niel, Plummer L.; Kip, Solomon D.; Busenberg, E.; Kim, Y.-J.; Chang, H.-W.

    2006-01-01

    Tritium/helium-3 (3H/3He) and chlorofluorocarbons (CFCs) were investigated as environmental tracers in ground water from Jeju Island (Republic of Korea), a basaltic volcanic island. Ground-water mixing was evaluated by comparing 3H and CFC-12 concentrations with lumped-parameter dispersion models, which distinguished old water recharged before the 1950s with negligible 3H and CFC-12 from younger water. Low 3H levels in a considerable number of samples cannot be explained by the mixing models, and were interpreted as binary mixing of old and younger water; a process also identified in alkalinity and pH of ground water. The ground-water CFC-12 age is much older in water from wells completed in confined zones of the hydro-volcanic Seogwipo Formation in coastal areas than in water from the basaltic aquifer. Major cation concentrations are much higher in young water with high nitrate than those in uncontaminated old water. Chemical evolution of ground water resulting from silicate weathering in basaltic rocks reaches the zeolite-smectite phase boundary. The calcite saturation state of ground water increases with the CFC-12 apparent (piston flow) age. In agricultural areas, the temporal trend of nitrate concentration in ground water is consistent with the known history of chemical fertilizer use on the island, but increase of nitrate concentration in ground water is more abrupt after the late 1970s compared with the exponential growth of nitrogen inputs. ?? 2005 Elsevier B.V. All rights reserved.

  4. Lightning protection design and testing of an all composite wet wing for the Egrett

    Science.gov (United States)

    Burrows, B. J. C.; Haigh, S. J.; Chessum, C.; Dunkley, V. P.

    1991-01-01

    The Egrett aircraft has an all composite wing comprising CFC(carbon fiber composite)/Nomex sandwich skins, full length CFC main spar caps, and GFRP (glass fiber reinforced plastics) main and auxiliary spar webs. It also has short inboard CFC auxiliary spar caps. It has fine aluminum wires woven into the surface for protection. It has an integral fuel tank using the CFC/Nomex skins as the upper and lower tank walls, and lies between the forward auxiliary spar and the forward of the two main spar webs. The fuel tank is not bagged, i.e., it is in effect a wet wing tank. It has conventional capacitive type fuel gauging. The aircraft was cleared to IFR standards and so required full lightning protection and demonstration that it would survive the lightning environment. The lightning protection was designed for the wing (and also for the remainder of the aircraft). An inner wing test samples (which included a part of the fuel tank) were tested as part of the proving program. The protection design and the testing process are described. The intrinsic structural features are indicated that improve lightning protection design and which therefore minimize the weight and cost of any added lightning protection components.

  5. Potent Attenuation of Context Fear by Extinction Training Contiguous with Acquisition

    Science.gov (United States)

    Bernier, Brian E.; Lacagnina, Anthony F.; Drew, Michael R.

    2015-01-01

    Studies on the behavioral mechanisms underlying contextual fear conditioning (CFC) have demonstrated the importance of preshock context exposure in the formation of aversive context memories. However, there has been comparatively little investigation of the effects of context exposure immediately after the shock. Some models predict that…

  6. 75 FR 40039 - Medicare Program; Payment Policies Under the Physician Fee Schedule and Other Revisions to Part B...

    Science.gov (United States)

    2010-07-13

    ... CF Conversion factor CfC Conditions for Coverage CFR Code of Federal Regulations CKD Chronic kidney... provides that adjustments in RVUs for a year may not cause total PFS payments to differ by more than $20...)(2)(B)(ii)(II) of the Act, if revisions to the RVUs cause expenditures to change by more than...

  7. TRENDS 1991: A compendium of data on global change

    Energy Technology Data Exchange (ETDEWEB)

    Boden, T.A.; Sepanski, R.J.; Stoss, F.W. (eds.)

    1991-12-01

    This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO{sub 2}) and methane (CH{sub 4}), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N{sub 2}) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N{sub 2}O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO{sub 2} emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO{sub 2} emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center.

  8. 3F: A Leading Fluorine Chemical Company

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Shanghai 3F New Materials Co., Ltd.(3F, SH: 600636) is a company mainlyengaged in the research, development,production and operation of fluorine-containing materials. It owns a complete fluorine chemical industrial chain.Products include CFCs, CFC substitutes,fluorine-containing polymers and fluo-rine-containing fine chemicals.

  9. Are New Technologies Safe?

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen

    2004-01-01

    The question is raised to what extend new technologies should - before released on the market - be subjected to a principle of precaution, including the relevance of the product. The issue is illustrated by examples from the past like asbestos and CFC gasses, as well as new cases like mobile phones...

  10. Specifying Skill-Based Training Strategies and Devices: A Model Description

    Science.gov (United States)

    1990-06-01

    Domain Resource C/ Spcify iB Costrai nts SBA4 dntf cfc kls hstciiyadsdti o h eea Informatilon - a e t identf fie he spcf DaaSkills ror for...otht dptd OSBATS (tca ta. 1988). log Typcaly Gethecsuv will be linear with slope B = (IlL + F)/U + r, where I represents per device investmkent cost (i.e

  11. JPRS Report, Near East & South Asia.

    Science.gov (United States)

    2007-11-02

    Pakistan and also sign the nuclear non-proliferation treaty. Creating mass hysteria against Pakistan is reflective of Rajiv Gandhi’s domestic inse ...The Montreal protocol is an agreement between govern- ments to reduce the use of chloroflorocarbon (CFC) gases , but it is the commercial giants and

  12. Water filtration of the forearm in short- and long-term diabetes mellitus

    DEFF Research Database (Denmark)

    Poulsen, H L; Nielsen, S L

    1976-01-01

    Blood flow and capillary filtration coefficient (CFC) were measured by strain-gauge plethysmography on the upper and lower third of the forearm in 9 normal subjects and 29 well regulated patients with diabetes mellitus of varying duration (less than 10 years, 10 to 20 years, and more than 20 years...

  13. AcEST: DK963290 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ein OS=Mus musculus GN=Cfc1 PE=... 36 0.16 sp|P0AA23|EBR_SALTY Putative ethidium bromide resistance protein...... 35 0.27 sp|P0AA24|EBR_PSEAE Putative ethidium bromide resistance protein... 35 0.27 sp|P0AA22|EBR_ECOLX Putative ethidium

  14. AcEST: DK962528 [AcEST

    Lifescience Database Archive (English)

    Full Text Available =Cfc1 PE=... 36 0.17 sp|P0AA23|EBR_SALTY Putative ethidium bromide resistance protein... 35 0.28 sp|P0AA24|EBR_PSEAE Putative ethidiu...m bromide resistance protein... 35 0.28 sp|P0AA22|EBR_ECOLX Putative ethidium

  15. Estimates of anthropogenic halocarbon emissions based on its measured ratios relative to CO in the Pearl River Delta

    Science.gov (United States)

    Shao, M.; Huang, D. K.; Gu, D. S.; Lu, S. H.; Chang, C. C.; Wang, J.-L.

    2011-01-01

    Using a GC/FID/MS system, we analyzed the mixing ratio levels of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD) region of southern China. The results revealed elevated regional mixing ratios for most halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE), CH2Cl2 (dichloromethane, DCM), CH3Br (bromomethane), HCFC-22, CHCl3 (trichloromethane), CCl4 (tetrachloromethane), Cl2C = CCl2 (perchloroethylene, PCE), CH3CCl3 (methyl chloroform, MCF), and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in concentrations (relative standard deviation ranged from 9.31% to 96.55%) of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO) were examined, and then each emission of halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg), CH3CCl3 (6.7 Gg), and Cl2C = CCl2 (2.3 Gg) accounted for about 62.9% of total emissions, suggesting a significant contribution to halocarbon emissions from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg), an alternative refrigerant to chlorofluorocarbons (CFCs), were about 2.3 times greater than those of CFC-12 (1.6 Gg). CFC-12 and HCFC-22 accounted for 21.5% of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of other CFCs, such as CFC-11, and levels of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl4, CHCl3, CH3Br, and CH3Cl, were also estimated. Where possible, the emissions estimated from the measured ratios were compared with results from source inventory techniques, we

  16. Estimate of anthropogenic halocarbon emission based on measured ratio relative to CO in the Pearl River Delta region, China

    Science.gov (United States)

    Shao, M.; Huang, D.; Gu, D.; Lu, S.; Chang, C.; Wang, J.

    2011-05-01

    Using a GC/FID/MS system, we analyzed the mixing ratio of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD) region of southern China. The results revealed that there are elevated mixing ratios for most of halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE), CH2Cl2 (dichloromethane, DCM), CH3 Br (bromomethane), HCFC-22, CHCl3 (trichloromethane), CCl4 (tetrachloromethane), Cl2C = CCl2 (perchloroethylene, PCE), CH3CCl3 (methyl chloroform, MCF), and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in mixing ratios (relative standard deviation ranged from 9.31 % to 96.55 %) of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO) was examined, and then the emission of each halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg), CH3CCl3 (6.7 Gg), and Cl2C = CCl2 (2.3 Gg) accounted for about 62.9 % of total halocarbon emissions, it suggested a significant contribution from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg), an alternative refrigerant to chlorofluorocarbons (CFCs), were about 2.3 times greater than those of CFC-12 (1.6 Gg). CFC-12 and HCFC-22 accounted for 21.5 % of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of CFCs, such as CFC-11, and the emission of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl4, CHCl3, CH3Br, and CH3Cl, were also estimated. Where possible, the emissions estimated from the measured ratios were compared with results from source inventory techniques, we

  17. A C1q domain containing protein from scallop Chlamys farreri serving as pattern recognition receptor with heat-aggregated IgG binding activity.

    Directory of Open Access Journals (Sweden)

    Leilei Wang

    Full Text Available BACKGROUND: The C1q domain containing (C1qDC proteins refer to a family of all proteins that contain the globular C1q (gC1q domain, and participate in a series of immune responses depending on their gC1q domains to bind a variety of self and non-self binding ligands. METHODOLOGY: In the present study, the mRNA expression patterns, localization, and activities of a C1qDC protein from scallop Chlamys farreri (CfC1qDC were investigated to understand its possible functions in innate immunity. The relative expression levels of CfC1qDC mRNA in hemocytes were all significantly up-regulated after four typical PAMPs (LPS, PGN, β-glucan and polyI:C stimulation. During the embryonic development of scallop, the mRNA transcripts of CfC1qDC were detected in all the stages, and the expression level was up-regulated from D-hinged larva and reached the highest at eye-spot larva. The endogenous CfC1qDC was dominantly located in the hepatopancreas, gill, kidney and gonad of adult scallop through immunofluorescence. The recombinant protein of CfC1qDC (rCfC1qDC could not only bind various PAMPs, such as LPS, PGN, β-glucan as well as polyI:C, but also enhance the phagocytic activity of scallop hemocytes towards Escherichia coli. Meanwhile, rCfC1qDC could interact with human heat-aggregated IgG, and this interaction could be inhibited by LPS. CONCLUSIONS: All these results indicated that CfC1qDC in C. farreri not only served as a PRR involved in the PAMPs recognition, but also an opsonin participating in the clearance of invaders in innate immunity. Moreover, the ability of CfC1qDC to interact with immunoglobulins provided a clue to understand the evolution of classical pathway in complement system.

  18. Neuronal oscillations with non-sinusoidal morphology produce spurious phase-to-amplitude coupling and directionality.

    Directory of Open Access Journals (Sweden)

    Diego Lozano-Soldevilla

    2016-08-01

    Full Text Available Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (> 40 Hz occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC. However, the CFC patterns be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 mg or 1.5 mg of lorazepam (LZP; GABAergic enhancer in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM, we were able to demonstrate that posterior alpha (8 – 12 Hz phase was coupled to beta-low gamma band (20 – 45 Hz amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD. Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs

  19. Neuronal Oscillations with Non-sinusoidal Morphology Produce Spurious Phase-to-Amplitude Coupling and Directionality

    Science.gov (United States)

    Lozano-Soldevilla, Diego; ter Huurne, Niels; Oostenveld, Robert

    2016-01-01

    Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (>40 Hz) occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC). However, the CFC patterns might be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 or 1.5 mg of lorazepam (LZP; GABAergic enhancer) in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM), we were able to demonstrate that posterior alpha (8–12 Hz) phase was coupled to beta-low gamma band (20–45 Hz) amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh) values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD). Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs. Furthermore, we

  20. Trace Gas Trends in the Stratosphere: 1991-2005

    Science.gov (United States)

    Elkins, J. W.; Moore, F. L.; Dutton, G. S.; Hurst, D. F.; Ray, E. A.; Montzka, S. A.; Butler, J. H.; Fahey, D. W.; Hall, B. H.; Atlas, E.; Wofsy, S. C.; Romashkin, P. A.

    2005-05-01

    The first NOAA airborne gas chromatograph measured chlorofluorocarbon-11 (CFC-11) and CFC-113 during the Arctic Airborne Stratospheric Experiment in 1991-1992. In 1994, we added nitrous oxide (N2O), sulfur hexafluoride (SF6), CFC-12, halon-1211, methyl chloroform, carbon tetrachloride, methane, and hydrogen. NOAA scientists have since operated five airborne gas chromatographs on NASA airborne platforms, including the NASA Jet Propulsion Laboratory (JPL) balloon gondola and ER-2, WB-57F, DC-8, and NASA Altair Unmanned Air Vehicle (UAV) aircraft. Using these in situ measurements and tracer-tracer correlations from flask observations for the unmeasured halogen species (HCFCs and methyl halides including methyl chloride and bromide), we have estimated trends of total chlorine and bromine in the stratosphere. The determination of inorganic equivalent chlorine (Cl + 45*Br) requires the trend of tropospheric equivalent chlorine and the mean age of the parcel of stratospheric air. In general, there is good agreement between the mean age of the air mass calculations using carbon dioxide and SF6, except for regions of extreme down welling of mesospheric air where SF6 is consumed. Tropospheric trends of the methyl halides have been compiled against stable standards. We operated a airborne gas chromatograph on the Sage 3 Ozone Loss Validation Experiment (SOLVE-II) mission from Kiruna, Sweden during 2002. It measured the major HCFCs and methyl halides, so that these compounds do not have to be estimated from tracer-tracer correlations in the future. In 2005, we have added a new lightweight airborne instrument (measure CFC-11, CFC-12, halon-1211, SF6, N2O, and ozone. This instrument can operate on small or UAV aircraft and will be used for Aura satellite validation. This presentation will show trends for selected trace gases and our estimates of total equivalent chlorine stratospheric trends since 1991.

  1. Combination of low O(2) concentration and mesenchymal stromal cells during culture of cord blood CD34(+) cells improves the maintenance and proliferative capacity of hematopoietic stem cells.

    Science.gov (United States)

    Hammoud, Mohammad; Vlaski, Marija; Duchez, Pascale; Chevaleyre, Jean; Lafarge, Xavier; Boiron, Jean-Michel; Praloran, Vincent; Brunet De La Grange, Philippe; Ivanovic, Zoran

    2012-06-01

    The physiological approach suggests that an environment associating the mesenchymal stromal cells (MSC) and low O(2) concentration would be most favorable for the maintenance of hematopoietic stem cells (HSCs) in course of ex vivo expansion of hematopoietic grafts. To test this hypothesis, we performed a co-culture of cord blood CD34(+) cells with or without MSC in presence of cytokines for 10 days at 20%, 5%, and 1.5% O(2) and assessed the impact on total cells, CD34(+) cells, committed progenitors (colony-forming cells-CFC) and stem cells activity (pre-CFC and Scid repopulating cells-SRC). Not surprisingly, the expansion of total cells, CD34(+) cells, and CFC was higher in co-culture and at 20% O(2) compared to simple culture and low O(2) concentrations, respectively. However, co-culture at low O(2) concentrations provided CD34(+) cell and CFC amplification similar to classical culture at 20% O(2) . Interestingly, low O(2) concentrations ensured a better pre-CFC and SRC preservation/expansion in co-culture. Indeed, SRC activity in co-culture at 1.5% O(2) was higher than in freshly isolated CD34(+) cells. Interleukin-6 production by MSC at physiologically low O(2) concentrations might be one of the factors mediating this effect. Our data demonstrate that association of co-culture and low O(2) concentration not only induces sufficient expansion of committed progenitors (with respect to the classical culture), but also ensures a better maintenance/expansion of hematopoietic stem cells (HSCs), pointing to the oxygenation as a physiological regulatory factor but also as a cell engineering tool.

  2. Langmuir monolayers of an inclusion complex formed by a new calixarene derivative and fullerene.

    Science.gov (United States)

    González-Delgado, Antonio M; Giner-Casares, Juan J; Brezesinski, Gerald; Regnouf-de-Vains, Jean-Bernard; Camacho, Luis

    2012-08-21

    The design of new molecules with directed interactions to functional molecules as complementary building blocks is one of the main goals of supramolecular chemistry. A new p-tert-butylcalix[6]arene monosubstituted derivative bearing only one alkyl chain with an acid group (C6A3C) has been synthesized. The C6A3C has been successfully used for building Langmuir monolayers at the air-water interface. The C6A3C molecule adopts a flatlike orientation with respect to the air-water interface. The molecular structure gives the molecule amphiphilic character, while allowing the control of both the dissociation degree and the molecular conformation at the air-water interface. The C63AC has been combined with pristine fullerene (C60) to form the supramolecular complex C6A3C:C60 in 2:1 molar ratio (CFC). The CFC complex retains the ability of C6A3C to form Langmuir monolayers at the air/water interface. The interfacial molecular arrangement of the CFC complex has been convincingly described by in situ UV-vis reflection spectroscopy and synchrotron X-ray reflectivity measurements. Computer simulations complement the experimental data, confirming a perpendicular orientation of the calixarene units of CFC with respect to the air-water interface. This orientation is stabilized by the formation of intermolecular H-bonds. The interfacial monolayer of the CFC supramolecular complex is proposed as a useful model for the well-defined self-assembly of recognition and functional building blocks.

  3. High RF power test of a lower hybrid module mock-up in carbon fiber composite

    Energy Technology Data Exchange (ETDEWEB)

    Goniche, M.; Bibet, P.; Brossaud, J.; Cano, V.; Froissard, P.; Kazarian, F.; Rey, G. [Association Euratom-CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. de Recherches sur la Fusion Controlee; Maebara, S.; Kiyono, K.; Seki, M.; Suganuma, K.; Ikeda, Y.; Imai, T. [Japan Atomic Energy Research Inst., Tokyo (Japan). Dept. of Fusion Facility

    1999-02-01

    A mock-up module of a Lower Hybrid Current Drive antenna module of a Carbon Fiber Composite (CFC) was fabricated for the development of heat resistive front facing the plasma. This module is made from CFC plates and rods which are copper coated to reduce the RF losses. The withstand-voltage, the RF properties and outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m{sup 2} were performed with no breakdowns. During these tests, the module temperaturewas increasing from 100-200 deg. C to 400-500 deg. C. It was also checked that high power density, up to 150 MW/m{sup 2}, could be transmitted when the waveguides are filled with H{sub 2} at a pressure of 5 x 10{sup -2} Pa. No significant change in the reflection coefficient is measured after the long pulse operation. During a long pulse, the power reflection increases during the pulse typically from 0.8% to 1.3%. It is concluded that the outgassing rate of Cu-plated CFC is about 6 times larger than of Dispersion Strengthened Copper (DSC) module at the module temperature of 300 deg. C. No significant increase of the global outgassing of the CFC module was measured after hydrogen pre-filling. After the test, visual inspection revealed that peeling of the copper coating occurred at one end of the module only on a very small area (0.2 cm{sup 2}). It is assessed that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (authors)

  4. Research on Risk Factors of Cold Fresh Chicken Supply Chain%冷鲜鸡供应链的风险因素调研分析

    Institute of Scientific and Technical Information of China (English)

    余伟; 陈海仪; 何楚臖; 钟楚敏; 吕尧

    2015-01-01

    文中对冷鲜鸡供应链中生产商、屠宰场、物流商、零售商、消费者进行了全面调研,分析了冷鲜鸡供应链的流程和风险因素。调研表明,目前冷鲜鸡在供应链各环节中,品质安全意识淡薄,相关的检疫标准不统一,存在重大的安全风险隐患。文中总结了冷鲜鸡供应链危机管理的主要风险因素以及可能演化为危机的风险因素,对冷鲜鸡的供应链危机管理具有重要参考价值。%A comprehensive investigation to the suppliers,logistics providers,retailers and consumers of cold fresh chicken (CFC)is conducted in this paper.The processes and risk status of CFC supply chain are analyzed.The results of investigation indicated that the quality safety consciousness is lacked;related quarantine standards are not unified.There are significant security risks in every link of the CFC supply chain.The risk and possible crisis factors of CFC supply chain are summarized.It will be of important reference value to CFC supply chain risk management.

  5. 神经振荡交叉节律耦合的生理学意义及在神经工程基础研究中的应用%Cross-Frequency Coupling of Neural Oscillations in Potential Physiological Significance and Its Applications in Neural Engineering

    Institute of Scientific and Technical Information of China (English)

    程宁; 徐霞霞; 李群; 张涛

    2015-01-01

    Cross-frequency coupling ( CFC) of neural oscillations could support integration and exchange information across different temporal and spatial scales, playing an important role in facilitating neural communication and promoting neural plasticity.Particularly, phase-amplitude coupling ( PAC), one of the CFC patterns, relates to multi-item working memory maintenance and long-term memory retrieval. This review presents a comprehensive introduction of CFC phenomenon in neural oscillation systems, and expounds the correspondent physiological significance.In order to quantitatively measure the CFC, three commonly used algorithms are introduced and their applications in neurobiological studies are presented accordingly.Finally, a brief description of the CFC potential applications in the fundamental research of neural engineering is provided.%交叉节律耦合( cross-frequency coupling,CFC)反映了不同时空尺度上信息的整合与交流,在神经信息通讯和促进突触可塑性等方面有重要作用。其中,相位-幅值耦合( phase-amplitude coupling,PAC)与工作记忆中多重对象的维持以及长时程记忆的回忆过程相关。此综述较全面地介绍了神经振荡CFC现象,阐述了其对应的生理学意义,给出了量化分析CFC的3种常用算法及其应用,并简单描述了CFC在神经工程研究中的潜在应用。

  6. Cooperative regulation of myosin-S1 binding to actin filaments by a continuous flexible Tm-Tn chain.

    Science.gov (United States)

    Mijailovich, Srboljub M; Kayser-Herold, Oliver; Li, Xiaochuan; Griffiths, Hugh; Geeves, Michael A

    2012-12-01

    The regulation of striated muscle contraction involves cooperative interactions between actin filaments, myosin-S1 (S1), tropomyosin (Tm), troponin (Tn), and calcium. These interactions are modeled by treating overlapping tropomyosins as a continuous flexible chain (CFC), weakly confined by electrostatic interactions with actin. The CFC is displaced locally in opposite directions on the actin surface by the binding of either S1 or Troponin I (TnI) to actin. The apparent rate constants for myosin and TnI binding to and detachment from actin are then intrinsically coupled via the CFC model to the presence of neighboring bound S1s and TnIs. Monte Carlo simulations at prescribed values of the CFC stiffness, the CFC's degree of azimuthal confinement, and the angular displacements caused by the bound proteins were able to predict the stopped-flow transients of S1 binding to regulated F-actin. The transients collected over a large range of calcium concentrations could be well described by adjusting a single calcium-dependent parameter, the rate constant of TnI detachment from actin, k(-I). The resulting equilibrium constant K(B) ≡ 1/K(I) varied sigmoidally with the free calcium, increasing from 0.12 at low calcium (pCa >7) to 12 at high calcium (pCa Hill coefficient of ~2.15. The similarity of the curves for excess-actin and excess-myosin data confirms their allosteric relationship. The spatially explicit calculations confirmed variable sizes for the cooperative units and clustering of bound myosins at low calcium concentrations. Moreover, inclusion of negative cooperativity between myosin units predicted the observed slowing of myosin binding at excess-myosin concentrations.

  7. Validation of a semi-quantitative food frequency questionnaire to assess food groups and nutrient intake.

    Science.gov (United States)

    Macedo-Ojeda, Gabriela; Vizmanos-Lamotte, Barbara; Márquez-Sandoval, Yolanda Fabiola; Rodríguez-Rocha, Norma Patricia; López-Uriarte, Patricia Josefina; Fernández-Ballart, Joan D

    2013-11-01

    Introducción. Los cuestionarios semicuantitativos de frecuencia de consumo (CFC) analizan ingestión promedio de alimentos y nutrimentos en períodos extensos para asociar consumo habitual con problemas de salud, como enfermedades crónicas. En México, no existe una herramienta similar, aplicable en mujeres y hombres. Objetivo. Validar un CFC en mujeres y hombres adultos. Métodos. El estudio incluyó 97 participantes (61% mujeres). Dos CFC fueron aplicados (un año entre ambos) para medir reproducibilidad. Para validez, se comparó el segundo CFC con registros dietéticos de nueve días. Los análisis incluyeron correlaciones de Pearson y coeficientes de correlación intraclase (CCI). Se controló desatenuación de CCI provocada por la variabilidad intraindividual. El análisis de validez se complementó con la comparación de la capacidad de clasificación entre CFC y registros dietéticos, mediante concordancia de categorías de consumo y gráficos de Bland y Altman. Resultados. Reproducibilidad: los CCI para grupos de alimentos oscilaron entre 0.42-0.87 y para nutrimentos entre 0.34-0.82. Validez: los CCI para grupos de alimentos variaron entre 0.35-0.84 y para nutrimentos entre 0.36-0.77. La mayoría de sujetos (56.7-76.3%) clasificaron en el mismo quintil o adyacente por ambos métodos (media 66.1%), para nutrimentos. La mala clasificación extrema para todos los ítems fue.

  8. Use of chloroflurocarbons as internal standards for the measurement of atmospheric non-methane volatile organic compounds sampled onto solid adsorbent cartridges.

    Science.gov (United States)

    Karbiwnyk, Christine M; Mills, Craig S; Helmig, Detlev; Birks, John W

    2003-03-01

    Solid adsorbents have proven useful for determining the vertical profiles of volatile organic compounds (VOCs) using sampling platforms such as balloons, kites, and light aircraft, and those profiles provide valuable information about the sources, sinks, transformations, and transport of atmospheric VOCs. One of the largest contributions to error in VOC concentrations is the estimation of the volume of air sampled on the adsorbent cartridge. These errors arise from different sources, such as variations in pumping flow rates from changes in ambient temperature and pressure with altitude, and decrease in the sampling pump battery power. Another significant source for sampling rate variations are differences in the flow resistance of individual sampling cartridges. To improve the accuracy and precision of VOC measurements, the use of ambient chlorofluorocarbons (CFCs) as internal standards was investigated. A multibed solid adsorbent, AirToxic (Supelco), was chosen for its wide sampling range (C3-C12). Analysis was accomplished by thermal desorption and dual detection GC/FID/ECD, resulting in sensitive and selective detection of both VOCs and CFCs in the same sample. Long-lived chlorinated compounds (CFC-11, CFC-12, CFC-113, CCl4 and CH3CCl3) banned by the Montreal Protocol and subsequent amendments were studied for their ability to predict sample volumes using both ground-based and vertical profiling platforms through the boundary layer and free troposphere. Of these compounds, CFC-113 and CCl4 were found to yield the greatest accuracy and precision for sampling volume determination. Use of ambient CFC-113 and CCl4 as internal standards resulted in accuracy and precision of generally better than 10% for the prediction of sample volumes in ground-, balloon-, and aircraft-based measurements. Consequently, use of CFCs as reference compounds can yield a significant improvement of accuracy and precision for ambient VOC measurements in situations where accurate flow

  9. Climate control of decadal-scale increases in apparent ages of eogenetic karst spring water

    Science.gov (United States)

    Martin, Jonathan B.; Kurz, Marie J.; Khadka, Mitra B.

    2016-09-01

    Water quantity and quality in karst aquifers may depend on decadal-scale variations in recharge or withdrawal, which we hypothesize could be assessed through time-series measurements of apparent ages of spring water. We tested this hypothesis with analyses of various age tracers (3H/3He, SF6, CFC-11, CFC-12, CFC-113) and selected solute concentrations [dissolved oxygen (DO), NO3, Mg, and SO4] from 6 springs in a single spring complex (Ichetucknee springs) in northern Florida over a 16-yr period. These springs fall into two groups that reflect shallow short (Group 1) and deep long (Group 2) flow paths. Some tracer concentrations are altered, with CFC-12 and CFC-113 concentrations yielding the most robust apparent ages. These tracers show a 10-20-yr monotonic increase in apparent age from 1997 to 2013, including the flood recession that followed Tropical Storm Debby in mid-2012. This increase in age indicates most water discharged during the study period recharged the aquifer within a few years of 1973 for Group 2 springs and 1980 for Group 1 springs. Inverse correlations between apparent age and DO and NO3 concentrations reflect reduced redox state in older water. Positive correlations between apparent age and Mg and SO4 concentrations reflect increased water-rock reactions. Concentrated recharge in the decade around 1975 resulted from nearly 2 m of rain in excess of the monthly average that fell between 1960 and 2014, followed by a nearly 4 m deficit to 2014. This excess rain coincided with two major El Niño events during the maximum cool phase in the Atlantic Multidecadal Oscillation. Although regional water withdrawal increased nearly 5-fold between 1980 and 2005, withdrawals represent only 2-5% of Ichetucknee River flow and are less important than decadal-long variations in precipitation. These results suggest that groundwater management should consider climate cycles as predictive tools for future water resources.

  10. Sexual selection for genetic compatibility: the role of the major histocompatibility complex on cryptic female choice in Chinook salmon (Oncorhynchus tshawytscha).

    Science.gov (United States)

    Gessner, C; Nakagawa, S; Zavodna, M; Gemmell, N J

    2017-05-01

    Cryptic female choice (CFC), a form of sexual selection during or post mating, describes processes of differential sperm utilization by females to bias fertilization outcomes towards certain males. In Chinook salmon (Oncorhynchus tshawytscha) the ovarian fluid surrounding the ova of a given female differently enhances the sperm velocity of males. Sperm velocity is a key ejaculate trait that determines fertilization success in externally fertilizing fishes, thus the differential effect on sperm velocity might bias male fertilization outcomes and represent a mechanism of CFC. Once sperm reach the oocyte, CFC could potentially be further facilitated by sperm-egg interactions, which are well understood in externally fertilizing marine invertebrates. Here, we explored the potential genetic basis of both possible mechanisms of CFC by examining whether the genotypic combinations of mates (amino-acid divergence, number of shared alleles) at the major histocompatibility complex (MHC) class I and II explain the variation in sperm velocity and/or male fertilization success that is not explained by sperm velocity, which might indicate MHC-based sperm-egg interactions. We recorded sperm velocity in ovarian fluid, employed paired-male fertilization trials and evaluated the fertilization success of each male using microsatellite-based paternity assignment. We showed that relative sperm velocity was positively correlated with fertilization success, confirming that the differential effect on sperm velocity may be a mechanism of CFC in Chinook salmon. The variation in sperm velocity was independent of MHC class I and II. However, the MHC class II divergence of mates explained fertilization success, indicating that this locus might influence sperm-egg interactions.

  11. Assessment of Halon-1301 as a groundwater age tracer

    Science.gov (United States)

    Beyer, M.; van der Raaij, R.; Morgenstern, U.; Jackson, B.

    2015-06-01

    Groundwater dating is an important tool to assess groundwater resources in regards to their dynamics, i.e. direction and timescale of groundwater flow and recharge, contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However, ambiguous age interpretations are often faced, due to a limited set of available tracers and their individual restricted application ranges. For more robust groundwater dating multiple tracers need to be applied complementarily (or other characterisation methods need to be used to complement tracer information). It is important that additional, groundwater age tracers are found to ensure robust groundwater dating in future. We have recently suggested that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate, but its behaviour in water and suitability as a groundwater age tracer had not yet been assessed in detail. In this study, we determined Halon-1301 and inferred age information in 17 New Zealand groundwater samples and various modern (river) water samples. The samples were simultaneously analysed for Halon-1301 and SF6, which allowed for identification of issues such as contamination of the water with modern air during sampling. All analysed groundwater sites had also been previously dated with tritium, CFC-12, CFC-11 and SF6, and exhibited mean residence times ranging from modern (close to 0 years) to over 100 years. The investigated groundwater samples ranged from oxic to highly anoxic. All samples with available CFC data were degraded and/or contaminated in one or both of CFC-11 and CFC-12. This allowed us to make a first attempt of assessing the conservativeness of Halon-1301 in water, in terms of presence of local sources and its sensitivity towards degradation, which could affect the suitability of Halon-1301 as groundwater age tracer. Overall we found Halon-1301

  12. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Tétard

    2008-02-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and CFC-12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10%, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences probably remain

  13. Reactivities of Precision Cleaning Solvents with Hypergolic Propellants

    Science.gov (United States)

    Davis, Dennis D.; Delgado, Rafael H.; Williams, James H.

    1999-01-01

    The reactivities of several selected halogenated precision cleaning solvents with hypergolic propellants has been determined by analysis of the rates of formation of halide ion decomposition products. The solvents were Asahiklin AK 225, Asahiklin AK 225 AES, HFE 7100, HFE 7100 DE, Vertrel XF, Vertrel MCA, Vertrel MCA Plus, 1,1,2-trichloro-1,2,2-trifluoroethane (CFC-113), and trans-1,2-dichloroethylene (DCE). The propellants were hydrazine (HZ), monomethylhydrazine (MMH), and mixed oxides of nitrogen (MON-3). The Vertrel solvents showed significant reactivity with HZ. All of the solvents except DCE exhibited significant reactivity with MMH, particularly HFE 7100 DE and CFC-113. HFE 7100 DE, Vertrel MCA, and Vertrel MCA Plus also showed significant reactivity with MON-3 oxidizer.

  14. Spurious cross-frequency amplitude-amplitude coupling in nonstationary, nonlinear signals

    Science.gov (United States)

    Yeh, Chien-Hung; Lo, Men-Tzung; Hu, Kun

    2016-07-01

    Recent studies of brain activities show that cross-frequency coupling (CFC) plays an important role in memory and learning. Many measures have been proposed to investigate the CFC phenomenon, including the correlation between the amplitude envelopes of two brain waves at different frequencies - cross-frequency amplitude-amplitude coupling (AAC). In this short communication, we describe how nonstationary, nonlinear oscillatory signals may produce spurious cross-frequency AAC. Utilizing the empirical mode decomposition, we also propose a new method for assessment of AAC that can potentially reduce the effects of nonlinearity and nonstationarity and, thus, help to avoid the detection of artificial AACs. We compare the performances of this new method and the traditional Fourier-based AAC method. We also discuss the strategies to identify potential spurious AACs.

  15. Addition of 1, 2 and 3% in mass of sodium alginate in calcium phosphate cement; Adicao de alginato de sodio a cimento de fosfato de calcio

    Energy Technology Data Exchange (ETDEWEB)

    Coelho, W.T.; Fernandes, J.M.; Vieira, R.S.; Thurmer, M.B.; Santos, L.A., E-mail: trajano@ufrgs.br [Universidade Federal do Rio Grande do Sul (LABIOMAT/UFRS), RS (Brazil)

    2011-07-01

    The calcium phosphate cement (CFC) are bone substitutes with great potential for use in orthopedics, traumatology and dentistry because of their biocompatibility, bioactivity, osteoconductivity and osteotransdutivity, and a paste that can be easily molded and placed into the surgical site. However, CFCs have low mechanical strength, which equals the maximum mechanical strength of trabecular bone. Aiming to evaluate the strength and time to handle a CFC phase composed mainly of alpha were added to sodium alginate (1%, 2% and 3% wt) and an accelerator handle in an aqueous medium. The cement powder was mixed with liquid takes 2 minutes and resigned in specimens and assessed for apparent density and porosity by the Archimedes method, X-ray diffraction and mechanical strength. We noticed a significant increase in mechanical properties of cement added sodium alginate. (author)

  16. Analysis of new species retrieved from MIPAS

    Directory of Open Access Journals (Sweden)

    Shaomin Cai

    2014-02-01

    Full Text Available The Michelson Interferometer for Passive Atmospheric Sounding (MIPAS instrument which operated on the Envisat satellite from 2002-2012 is a Fourier transform spectrometer for the measurement of high-resolution gaseous emission spectra at the Earth's limb. It operates in the near- to mid-infrared, where many of the main atmospheric trace gases have important emission features. The initial operational products were profiles of Temperature, H2O, O3, CH4, N2O, HNO3, and NO2, and this list was recently extended to include N2O5, ClONO2, CFC-11 and CFC-12. Here we present preliminary results of retrievals of the third set of species under consideration for inclusion in the operational processor: HCN, CF4, HCFC-22, COF2 and CCl4.

  17. The stratospheric ozone hole a man-caused chemical instability

    CERN Document Server

    Crutzen, P J

    1997-01-01

    The discovery of the spring time stratospheric ozone hole by scientists of the British Antarctic Survey, led by Joe Farman, was one of the greatest surprises in the history of the atmospheric sciences and global change studies. After intensive research efforts by many international scientific teams it has clearly been demonstrated that the observed rapid ozone depletions are due to catalytic reactions involving CIO radicals, more than 80571130f which are produced by the photochemical breakdown of the industrial chlorofluorocarbon (CFC) gases. In this lecture I will present the course of events leading to the rapid ozone depletions. International agreements have been reached to forbid the production of the CFC gases. However, despite these measures, it will take almost 50 years before the ozone hole will have disappeared. I will also show that mankind has indeed been very lucky and that things could have been far worse.

  18. Chlorofluorocarbons and ~3H/~3He in groundwater——Applications in tracing and dating young groundwater

    Institute of Scientific and Technical Information of China (English)

    秦大军; 王浩

    2001-01-01

    Based on the CFC concentration, the fraction of young groundwater in a mixture with old groundwater can be defined if the age of the young component is known. The authors argued that the ratio of [3HeJ/[3Ht] in a young water is independent of its mixing with old waters. Hence, the 3H-3He can be used to determine age of the young groundwater, though mixing with old ground-water may occur. CFC concentrations are susceptible to change by mixing of young and old water. The combination of CFCs and tritium/helium can provide confidential apparent age of the young groundwater and fraction of the young water in the mixture with old groundwater.

  19. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  20. Validation of MIPAS-ENVISAT by Correlative Measurements of MIPAS-STR

    Science.gov (United States)

    Keim, C.; Blom, C. E.; von der Gathen, P.; Gulde, T.; Höpfner, M.; Liu, G. Y.; Oulanovski, A.; Piesch, C.; Ravegnani, F.; Sartorius, C.; Schlager, H.; Volk, C. M.

    2004-08-01

    We report on the validation of profiles from the MIPAS-Envisat on-line processor of ESA version 4.61 with correlative measurements derived from MIPASSTR onboard the high-altitude aircraft M55-Geophysica. The validation is made for the July 22, 2002, orbit 2051 in the region of the campaign base in Forlí, Italy [1] and for several orbits in February / March 2003 around Kiruna, northern Sweden. This paper includes a careful comparison of the MIPASSTR data with O3 sondes and with in-situ measurements from the Geophysica obtained during ascent, descent and occasional dives. To obtain accurate N2O and CH4 profiles close to the MIPAS-Envisat tangent points we used the MIPAS-STR measurements of CFC-11 and CFC-12 and correlations [2] obtained by the HAGAR instrument.

  1. 氟利昂替代后吸入气雾剂(MDIs)的研究要求和进展Ⅱ抛射剂替代的MDIs的技术挑战和工业化生产%Transition of Propellants in Metered Dose Inhalers (MDIs) Ⅱ.Technical Challenge and Industrial Manufacture of Alternative Propellant MDIs

    Institute of Scientific and Technical Information of China (English)

    侯曙光; 魏农农; 金方

    2009-01-01

    吸入气雾剂(MDIs)中抛射剂氟利昂(CFC)的替代并非制剂中简单的辅料替换.综述了氢氟烷烃(HFA)替代CFC过程中所涉及的处方组成改变、工艺参数优化、给药装置的选择、制药设备的更新以及产业化过程中的特殊要求.%The propellant transition in metered dose inhalers (MDIs) is not a simple replacement of CFC by HFA in the formulations. This paper reviews the technical challenges for the development of alternative propellant MDIsincluding changes of formulation composition, optimization of product process, selection of container closure system,improvement of manufacture equipment, and requirements for industrial manufacture.

  2. A new environment-friendly refrigerant

    Institute of Scientific and Technical Information of China (English)

    赵晓宇; 史琳; 朱明善; 韩礼钟

    1999-01-01

    CFCs and HCFCs, widely used in refrigeration and air-conditioning equipment, have been or will be phased out according to the revisions of the Montreal Protocol because they deplete the ozone layer. Many substitutes have been proposed, but no one has perfectly replaced the CFC end HCFC refrigerants. New generation alternatives are being investigated worldwide. According to the industrial and environmental requirements, many factors should be considered in the screening and evaluation of refrigerant alternatives. A new method is proposed using the soft algebra method——fuzzy multiple evaluation. The weights for different factors are determined mathematically and criteria values for all the objects are made dimensionless to quantitatively compare the different alternatives. A new long-term drop-in mixture alternative THR02 is developed and evaluated in a series of theoretical and experimental evaluations.THR02 is proved to be an environment-friendly, nontoxic, inflammable, drop-in alternative to CFC-12 a

  3. Supermarket refrigerators with natural refrigerants; Supermarktkaelteanlagen mit natuerlichen Kaeltemitteln. Erfahrungsbericht

    Energy Technology Data Exchange (ETDEWEB)

    Haaf, S.; Heinbokel, B. [Linde AG, Koeln (Germany). Gechaeftsbereich Linde Kaeltetechnik

    2002-09-01

    In view of the high contribution to global warming of H-CFC refrigerants, substitution has been a key concern for several years now. Leakage protection measures were enhanced, and Linde also installed many supermarket refrigerators with natural refrigerants, i.e. ammonia, propene and carbon dioxide. The environmental and economic aspects are assessed on the basis of the experience gained, and the systems are compared with H-CFC refrigeration systems. [German] Wegen des betraechtlichen Treibhauspotentials von HFKW-Kaeltemitteln werden seit Jahren Anstrengungen unternommen, um den von diesen Stoffen ausgehenden Treibhauseffekt zu reduzieren. Neben Massnahmen zur Verminderung von Leckagen sowie zur Verringerung von Kaeltemittel-Fuellmengen wurden im Laufe der letzten 10 Jahre von Linde auch zahlreiche Kaelteanlagen mit den natuerlichen Kaeltemitteln Ammoniak, Propen und Kohlendioxid in Supermaerkten installiert. Auf Basis der gesammelten Erfahrungen wird eine Einschaetzung der umweltspezifischen und wirtschaftlichen Aspekte im Vergleich zu Anlagen mit HFKW-Kaeltemitteln vorgenommen. (orig.)

  4. HFC-134A and HCFC-22 supermarket refrigeration demonstration and laboratory testing. Phase I. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Aspen Systems and a team of nineteen agencies and industry participants conducted a series of tests to determine the performance of HFC-134a, HCFC-22, and CFC-502 for supermarket application. This effort constitutes the first phase of a larger project aimed at carrying out both laboratory and demonstration tests of the most viable HFC refrigerants and the refrigerants they replace. The results of the Phase I effort are presented in the present report. The second phase of the project has also been completed. It centered on testing all viable HFC replacement refrigerants for CFC-502. These were HFC-507, HFC-404A, and HFC-407A. The latter results are published in the Phase II report for this project. As part of Phase I, a refrigeration rack utilizing a horizontal open drive screw compressor was constructed in our laboratory. This refrigeration rack is a duplicate of one we have installed in a supermarket in Clifton Park, NY.

  5. Halon-1301, a new Groundwater Age Tracer

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2015-04-01

    Groundwater dating is an important tool to assess groundwater resources in regards to direction and time scale of groundwater flow and recharge and to assess contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However ambiguous age interpretations are often faced, due to a limited set of available tracers and limitations of each tracer method when applied alone. There is a need for additional, complementary groundwater age tracers. We recently discovered that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate [Beyer et al, 2014]. Halon-1301 can be determined along with SF6, SF5CF3 and CFC-12 in groundwater using a gas chromatography setup with attached electron capture detector developed by Busenberg and Plummer [2008]. Halon-1301 has not been assessed in groundwater. This study assesses the behaviour of Halon-1301 in water and its suitability as a groundwater age tracer. We determined Halon-1301 in 17 groundwater and various modern (river) waters sites located in 3 different groundwater systems in the Wellington Region, New Zealand. These waters have been previously dated with tritium, CFC-12, CFC-11 and SF6 with mean residence times ranging from 0.5 to over 100 years. The waters range from oxic to anoxic and some show evidence of CFC contamination or degradation. This allows us to assess the different properties affecting the suitability of Halon-1301 as groundwater age tracer, such as its conservativeness in water and local contamination potential. The samples are analysed for Halon-1301 and SF6simultaneously, which allows identification of issues commonly faced when using gaseous tracers such as contamination with modern air during sampling. Overall we found in the assessed groundwater samples Halon-1301 is a feasible new groundwater tracer. No sample indicated significantly elevated

  6. 杜邦Suva(R)407C和Suva(R)410A及Suva(R)134a的特性及应用

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ 1 前言 在过去的五十年中,一氯二氟甲烷(R-22或HCFC-22)在工业制冷、商业制冷、空调等很多领域中被作为制冷剂.与CFC-11(氯氟烃11)和CFC-12相比,其很低的ODP值和良好的制冷特性被作为CFCs的替代品.但是,因R-22将被逐步淘汰,因此,杜邦引入环保型替代品Suva407C和Suva410A来替代R-22,主要应用于空调器制冷剂领域.

  7. Nobel Prize in Chemistry 1995 "for their work in atmospheric chemistry, particularly concerning the formation and decomposition of ozone" : Paul J Crutzen, Mario J Molina and F Sherwood Rowland

    CERN Multimedia

    1997-01-01

    Prof. Paul J Crutzen presents "The stratospheric ozone hole : a man-caused chemical instability".The discovery of the spring time stratospheric ozone hole by scientists of the British Antarctic Survey, led by Joe Farman, was one of the greatest surprises in the history of the atmospheric sciences and global change studies. After intensive research efforts by many international scientific teams it has clearly been demonstrated that the observed rapid ozone depletions are due to catalytic reactions involving CIO radicals, more than 80571130f which are produced by the photochemical breakdown of the industrial chlorofluorocarbon (CFC) gases. In this lecture I will present the course of events leading to the rapid ozone depletions. International agreements have been reached to forbid the production of the CFC gases. However, despite these measures, it will take almost 50 years before the ozone hole will have disappeared. I will also show that mankind has indeed been very lucky and that things could have been far w...

  8. Evolution of genitalia: theories, evidence, and new directions.

    Science.gov (United States)

    Eberhard, William G

    2010-01-01

    Many hypotheses have been proposed to explain why male intromittent genitalia consistently tend to diverge more rapidly than other body traits of the same individuals in a wide range of animal taxa. Currently the two most popular involve sexual selection: sexually antagonistic coevolution (SAC) and cryptic female choice (CFC). A review of the most extensive attempts to discriminate between these two hypotheses indicates that SAC is not likely to have played a major role in explaining this pattern of genital evolution. Promising lines for future, more direct tests of CFC include experimental modification of male genital form and female sensory abilities, analysis of possible male-female dialogues during copulation, and direct observations of genital behavior.

  9. Replacements For Ozone-Depleting Foaming Agents

    Science.gov (United States)

    Blevins, Elana; Sharpe, Jon B.

    1995-01-01

    Fluorinated ethers used in place of chlorofluorocarbons and hydrochlorofluorocarbons. Replacement necessary because CFC's and HCFC's found to contribute to depletion of ozone from upper atmosphere, and manufacture and use of them by law phased out in near future. Two fluorinated ethers do not have ozone-depletion potential and used in existing foam-producing equipment, designed to handle liquid blowing agents soluble in chemical ingredients that mixed to make foam. Any polyurethane-based foams and several cellular plastics blown with these fluorinated ethers used in processes as diverse as small batch pours, large sprays, or double-band lamination to make insulation for private homes, commercial buildings, shipping containers, and storage tanks. Fluorinated ethers proved useful as replacements for CFC refrigerants and solvents.

  10. Speaker identification based on complete feature corpus and evaluation of mutual information

    Institute of Scientific and Technical Information of China (English)

    YU Yibiao; WANG Shuozhong

    2005-01-01

    A speaker model called complete feature corpus (CFC) and an evaluation algorithm of mutual information (MIE) are proposed for text-independent speaker identification. The CFC model represents the speech and pronunciation characteristics of speaker by a feature vector corpus which was trained from some typical speech samples. It hires multi-step mini-max search matching scheme for MIE algorithm to evaluate the similarity of speech features between input speech and the models in distance and information space. Maximum mutual information (MMI)decision criterion is used to decide the identity of speaker. Experiments on performance analysis with comparison to GMM method show that proposed model and evaluation algorithm are quite effective and presented a higher performance than ordinary GMM method.

  11. NSE与视频脑电图在儿童热性惊厥的相关研究%THE CORRELATION BETWEEN SERUM NEURON SPECIFIC ENOLASE AND VIDEO EEG IN FEBRILE CONVULSION OF CHILDREN

    Institute of Scientific and Technical Information of China (English)

    刘秀琴; 于树红; 孙若鹏

    2002-01-01

    Objective:To evaluate the diagnostic value of serum neuron specific enolase and Video EEG in Febrile Convulsion of childen. Method:Serum NSE was detected by RIA on the first day and the seventh day after seizure in 40 children with simple febrile convulsion and 18 with complex febrile convulsion. Video EEG was performed at 1st, 7th and 30th day in all the patients. Results: There were significant differences between NSE levels at 24th hour and on 7th day after convulsion (P<0.01). NSE concentrations in patients with SFC and CFC were also different (P < 0.01). The more slowly NSE restored, the higher the abnormal ratio of EGG was . Conclusion: NSE increased in patients within 24hours after seizure, especially in CFC patients. The abnormal ratio of VideoEEG was related to the change of NSE concentration.

  12. Development of a youth elixir; La mise en oeuvre d`un elixir de jouvence

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This short paper presents a new refrigerant developed by Quiri Refrigeration company in collaboration with Electricite de France (EdF), which can replace the no-longer produced R-12 CFC. This substitute, called `youth elixir` is a mixture of HCFCs and has similar physical characteristics, is compatible with the R-12 and can be used in a similar pressure range. Its use requires to modify the existing installation but with a reasonable cost. (J.S.)

  13. Model calculations of the relative effects of CFCs and their replacements on stratospheric ozone

    Science.gov (United States)

    Fisher, Donald A.; Hales, Charles H.; Filkin, David L.; Ko, Malcolm K. W.; Sze, N. Dak

    1990-01-01

    Because chlorine has been linked to the destruction of stratospheric ozone, the use of many fully halogenated compounds, such as the chlorofluorocarbons CFC-11 and -12, is restricted by international agreement. Hydrohalocarbons are under intensive development as replacements for CFCs. Because they contain hydrogen, these gases are susceptible to tropospheric destruction which significantly shortens their atmospheric lifetimes,. Model calculations show that chlorine-containing hydrohalocarbons have less effect on ozone, by an order of magnitude, than their regulated counterparts.

  14. A novel biomarker of amnestic MCI based on dynamic Cross-Frequency Coupling patterns during cognitive brain responses

    Directory of Open Access Journals (Sweden)

    Stavros I Dimitriadis

    2015-10-01

    Full Text Available The detection of mild cognitive impairment (MCI, the transitional stage between normal cognitive changes of aging and the cognitive decline caused by AD, is of paramount clinical importance, since MCI patients are at increased risk of progressing into AD. Electroencephalographic (EEG alterations in the spectral content of brainwaves and connectivity at resting state have been associated with early-stage AD. Recently, cognitive event-related potentials (ERPs have entered into the picture as an easy to perform screening test. Motivated by the recent findings about the role of cross-frequency coupling (CFC in cognition, we introduce a relevant methodological approach for detecting MCI based on cognitive responses from a standard auditory oddball paradigm. By using the single trial signals recorded at Pz sensor and comparing the responses to target and non-target stimuli, we first demonstrate that increased CFC is associated with the cognitive task. Then, considering the dynamic character of CFC, we identify instances during which the coupling between particular pairs of brainwave frequencies carries sufficient information for discriminating between normal subjects and patients with MCI. In this way, we form a multiparametric signature of impaired cognition. The new composite biomarker was tested using data from a cohort that consists of 25 amnestic MCI patients and 15 age-matched controls. Standard machine-learning algorithms were employed so as to implement the binary classification task. Based on leave-one-out cross-validation, the measured classification rate was found reaching very high levels (95%. Our approach compares favorably with the traditional alternative of using the morphology of averaged ERP response to make the diagnosis and the usage of features from spectro-temporal analysis of single-trial response. This further indicates that task-related CFC measurements can provide invaluable analytics in AD diagnosis and prognosis.

  15. AFRRI Reports, First Quarter 1994

    Science.gov (United States)

    1994-06-01

    eosinophil , and basophil numbers, as well as an increase in bone marrow cellularity, GM-CFC, and erythroid burst- forming units (BFU-E) [27]. In... granu - locyte colony-stimulating factor. Blood 78:961 27. Andrews RG, Knitter GH, Bartelmez SH, Langley KE, Far- rar D, Hendren W, Appelbaum FR...cell were found to have degranulated. In addition, endotoxin treatment resulted in the appearance of TNF in the secretory granules of all eosinophils

  16. TABES 93 - Annual Technical and Business Exhibition and Symposium, 9th, Huntsville, AL, May 11, 12, 1993, Submitted Papers

    Science.gov (United States)

    The present symposium on space science and engineering discusses commercial space opportunities, materials processing in space, and the impact of TQM concepts on inspection of aerospace systems. Attention is given to the defense budget environment, tactical missiles and the changing world, and government/contractor development teams. Topics addressed include technology demonstration and evaluation activities in the Department of the Army, total environmental quality management in corporate America, and environmental lessons to be learned from the upcoming CFC phase-out.

  17. Security Force Assistance in Afghanistan: Identifying Lessons for Future Efforts

    Science.gov (United States)

    2011-01-01

    Phoenix, see Chapter Two. Implications of SFA in Afghanistan for the U.S. Army 113 cult. The validation training team ( VTT ) echoed these complaints.15...According to these advisors and VTT members, this type of manage- ment of the overall advisory effort hurts performance. Finally, a consistent theme...plans, including those from KMTC and CFC; and doctrine • ISAF documents • ETT and VTT documents • Congressional Research Service reports • Government

  18. Department of Defense In-House RDT&E Activities. FY2000 Management Analysis Report

    Science.gov (United States)

    2000-01-01

    determine the health risks that are associated with the inhalation of smoke(s) evolved by pyrolysis of materials that are either commonly deployed in Naval...construction of a variety of operational systems. Potential health risks associated with the pyrolysis and combustion of these materials are unknown and...CFC: Global Grid, Consistent Battlespace Picture, Hyperspectral Imaging (HSI), and Space Based Radar Advanced Moving Target Indicator ( SBR -AMTI) are the

  19. The thermal regime of the Campi Flegrei magmatic system reconstructed through 3D numerical simulations

    Science.gov (United States)

    Di Renzo, Valeria; Wohletz, Kenneth; Civetta, Lucia; Moretti, Roberto; Orsi, Giovanni; Gasparini, Paolo

    2016-12-01

    We illustrate a quantitative conductive/convective thermal model incorporating a wide range of geophysical, petrological, geological, geochemical and isotopical observations that constrain the thermal evolution and present state of the Campi Flegrei caldera (CFc) magmatic system. The proposed model has been computed on the basis of the current knowledge of: (1) the volcanic and magmatic history of the volcano over the last 44 ka, (2) its underlying crustal structure, and (3) the physical properties of the erupted magmas. 3D numerical simulations of heat conduction and convection within heterogeneous rock/magma materials with evolving heat sources and boundary conditions that simulate magma rise from a deep (≥ 8 km depth) to shallow (2-6 km) reservoirs, magma chamber formation, magma extrusion, caldera collapse, and intra-caldera hydrothermal convection, have been carried out. The evolution of the CFc magmatic system through time has been simulated through different steps related to its changes in terms of depth, location and size of magma reservoirs and their replenishment. The thermal modeling results show that both heat conduction and convection have played an important role in the CFc thermal evolution, although with different timing. The simulated present heat distribution is in agreement with the measured geothermal profiles (Agip, 1987), reproduces the thermal gradient peaks at the CFc margins in correspondence to the anomalies in surface gradients (Corrado et al., 1998), and suggests temperatures of 700 °C at depth of 4 km in the central portion of the caldera, in agreement with the estimated temperature for the brittle-ductile transition (Hill, 1992).

  20. HCC-240fa氟化合成HFC-245fa技术进展%Progress on Synthesizing HFC -245fa by Fluorinating HCC -240fa

    Institute of Scientific and Technical Information of China (English)

    张国利; 杨会娥; 张文庆; 赵新堂

    2009-01-01

    HFC-245fa作为ODS发泡剂HCHC-141b和CFC-11的良好替代品,具有很好工业前景.全面综述了以HCC-240fa为原料合成HFC-245fa的各种工艺,并对HFC-245fa粗品的提纯进行详细的讨论.

  1. Hats off to CERN's Master of Apprenticeships ! Roland Gay of the HR Department (at right) recently received a special diploma from the Geneva Industrial Union (UIG).

    CERN Multimedia

    2004-01-01

    Presented by Carlo Lamprecht, Head of the Department of Economy, Employment and External Affairs of the State of Geneva, the diploma was awarded in recognition of the 199 CERN apprentices Roland has guided through the Certificat Fédéral de Capacité (CFC), an end-of-apprenticeship certificate awarded by the Cantonal authorities. Roland will be retiring in December 2004 after 37 years of service, 32 of which he spent in the role of apprenticeship supervisor.

  2. PEMANASAN GLOBAL

    Directory of Open Access Journals (Sweden)

    Vivi Triana

    2008-03-01

    Full Text Available Pemanasan global (global warming pada dasarnya merupakan fenomena peningkatan temperature global dari tahun ke tahun karena terjadinya efek rumah kaca (greenhouse effect yang disebabkan oleh meningkatnya emisi gas-gas seperti karbondioksida (CO2, metana (CH4, dinitrooksida (N2O dan CFC sehingga energy matahari terperangkap dalam atmosfer bumi. Berbagai literatur menunjukkan kenaikan temperatur global termasuk Indonesia yang terjadi pada kisaran 1,5 – 40 °C pada akhir abad 21.

  3. Adrenergic and histaminergic neural interactions in dog paws

    Energy Technology Data Exchange (ETDEWEB)

    Baker, C.H.; Davis, D.L.; Sutton, E.T.; Lindsey, B.G. (Univ. of South Florida, Tampa (USA))

    1988-09-01

    The mechanisms underlying the vascular responses of superficial fibular nerve stimulation (SFNS) have not been defined. Right hindpaws of anesthetized heparinized dogs were vascularly and neurally isolated, enclosed in a volume recorder, and perfused with controlled pressure. Vascular volume (VV) ({sup 131}I-labeled albumin) and rate of tissue volume changes (V{sub T}) (plethysmography) were determined. SFNS increased blood flow resistance, reduced capillary filtration coefficient (CFC) and permeability-surface area product (PS) of {sup 86}Rb, increased VV, and reduced {sup 131}I-albumin recovery. SFNS during terbutaline increased resistance, CFC, PS, and VV were unchanged, {sup 131}I-albumin recovery was complete, and V{sub T} increased at one-fourth the control rate. Phentolamine and yohimbine blocked all responses to SFNS. Prazosin with SFNS attenuated hemodynamic changes and V{sub T} increased to two-thirds of control, decreased VV, albumin, and Rb recovery but not PS and CFC. SFNS during pyrilamine maleate reduced V{sub T} increase to two-thirds of control rate and blocked decreases in PS and CFC. Metiamide did not change the SFNS responses, except to reduce vascular volume and V{sub T}. The combined histamine H{sub 1} and H{sub 2} blockers reduced V{sub T} increase to one-third of control and attenuated albumin loss, prevented histamine dilation, attenuated vasopressin and norepinephrine but not angiotensin constriction. SFNS stimulation increased precapillary resistance by {alpha}{sub 1}- and {alpha}{sub 2}-receptors and venous resistance by {alpha}{sub 2}-receptors and increased permeability by histamine release from endothelium.

  4. Mechanisms and Kinetics of Reactions of the O (1D,3p) + CF3Cl System

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ In the stratosphere, CF3Cl (CFC 13) can either photodecompose or react directly with atomic oxygen to generate ozone-depleting agents such as Cl and ClO in the gas phase[1-3]. Since the 1970s, attention has been focused on the effects of these compounds on the destruction of ozone in the stratosphere and on global warming[4,5].

  5. Heterogeneity Within Macrophage Populations: A Possible Role for Colony Stimulating Factors

    Science.gov (United States)

    1988-04-04

    strains of C3H lineage. Infect. Immun. 36: 696. Elberg, S.S., P. Schneider, and J. Fong. 1957. Cross-immunity between Brucella melitensis and...Mycobacterium tuberculosis: intracellular behavior of Brucella melitensis in moncytes from vaccinated animals. J. Exp. Med. 106: 545. Fertsch, D., D.R...macrophage colony-forming cell GS, goat serum 3H, tritiated HPLC, high performance liquid chromatography HPP-CFC, high proliferative colony-forming cell

  6. Greenhouse effect of chlorofluorocarbons and other trace gases

    Science.gov (United States)

    Hansen, James; Lacis, Andrew; Prather, Michael

    1989-01-01

    A comparison is made of the radiative (greenhouse) forcing of the climate system due to changes of atmospheric chlorofluorocarbons and other trace gases. It is found that CFCs, defined to include chlorofluorocarbons, chlorocarbons, and fluorocarbons, now provide about one-quater of current annual increases in anthropogenic greenhouse climate forcing. If the growth rates of CFC production in the early 1970s had continued to the present, current annual growth of climate forcing due to CFCs would exceed that due to CO2.

  7. Effects of intra-infralimbic prefrontal cortex injections of cannabidiol in the modulation of emotional behaviors in rats: contribution of 5HT₁A receptors and stressful experiences.

    Science.gov (United States)

    Marinho, A L Z; Vila-Verde, C; Fogaça, M V; Guimarães, F S

    2015-06-01

    The infralimbic (IL) and prelimbic (PL) regions of the prefrontal cortex are involved in behavioral responses observed during defensive reactions. Intra-PL or IL injections of cannabidiol (CBD), a major non-psychotomimetic cannabinoid present in the Cannabis sativa plant, result in opposite behavioral effects in the contextual fear conditioning (CFC) paradigm. The intra-PL effects of CBD are mediated by 5HT1A receptors and depend on previous stressful experiences but the mechanisms and effects of intra-IL CBD injected are unknown. To this aim the present work verified the effects of intra-IL administration of CBD on two animal models of anxiety, the elevated plus maze (EPM) and CFC. We also investigated if these effects were mediated by 5HT1A receptors and depended on previous stressful experience. Male Wistar rats received bilateral microinjections of vehicle, WAY100635 (5HT1A receptor antagonist, 0.37 nmol) and/or CBD (15, 30 or 60 nmol) before being submitted to the behavioral tests. Intra-IL CBD induced anxiolytic and anxiogenic in the EPM and CFC, respectively. To verify if these effects are influenced by the previous stressful experience (footshocks) in the CFC model, we tested the animals in the EPM 24h after a 2-h restraint period. The anxiolytic-like effect of CBD in the EPM disappeared when the animals were previously stressed. Both responses, i.e., anxiolytic and anxiogenic, were prevented by WAY100635, indicating that they involve local 5HT1A-mediated neurotransmission. Together these results indicate that CBD effects in the IL depend on the nature of the animal model, being influenced by previous stressful experiences and mediated by facilitation of 5HT1A receptors-mediated neurotransmission.

  8. AFRRI (Armed Forces Radiobiology Research Institute) Reports, January-March 1985

    Science.gov (United States)

    1985-01-01

    stains for cell sorting 56 genesis 213 Anticoagulants long-term hematopoiesis, role :472 granulocytic diffeentiation 56 medullary vs.extramedullary 215...functional ability of the mononuclear and macro- phage progeny of the M-CFC derived from the bone marrow and extra- medullary sources. The point to be...hemopoictic aplasia , the implications vival2’. The exact correlation between giucan’s hemo- and possible applications of glueall treatment are in- poietic

  9. The Effect of Condensate Inundation on Steam Condensation Heat Transfer in a Tube Bundle.

    Science.gov (United States)

    1985-06-01

    APPENDIX B: UNCERTAINTY ANALYSIS------------------------ 80 APPENDIX C: COMPUTER PROGRAMS--------------------------- 88 APPENDIX D: SIEDER -TATE CONSTANT...Correction factor (p c/Pw) Cf,c Calculated correction factor C. Sieder -Tate coefficient C Specific heat of water (kJ/kg.K)PC DF Average flow...coefficient was computed using the Sieder -Tate equation described in Holman [Ref. 31]: Nu = hi Di/k c = C i Re Pr 1 3 (c/w) (4.1) where the coefficient C

  10. Greenhouse effect: an issue for the refrigeration and air conditioning sector; Effet de serre: quelle problematique pour le froid et le conditionnement de l`air?

    Energy Technology Data Exchange (ETDEWEB)

    Billiard, F. [Institut International du Froid, 75 - Paris (France)

    1997-12-31

    The principles of greenhouse effect and the greenhouse gas main direct and indirect emission sources due to refrigeration and air conditioning systems are first reviewed. Evolution scenarios from 1992 to 2020 and 2100 for the emissions of CFC, HCFC and HFC are presented and related to the Kyoto protocol project limitations; technical improvements in refrigerating and air conditioning systems (lower refrigerant utilization, fluid confinement, alternative technologies, natural refrigerant utilization, etc.) could lead to substantial diminutions of these greenhouse gases

  11. Evaporation of refrigerant HFC 407C on plain tubes or at an improved surface; Evaporation du refrigerant HFC 407C sur des tubes lisses ou a surface amelioree

    Energy Technology Data Exchange (ETDEWEB)

    Zuercher, O.; Favrat, D.; Thome, J.R.; Kattan, N.; Nidegger, E. [Ecole polytechnique federale, Lab. d`energetique industrielle, Lausanne (Switzerland)

    1996-11-15

    The substitution of CFC refrigerants in refrigeration systems, heat pumps and organic Rankine cycles for heat recovery, requires good methods for predicting heat transfer of substitute fluids. The measurements in the LENI test facility (concentric tubes with water flowing in a counter-current flow) with HFC 407C, HFC 134a, HCFC 123, HFC 404a and HFC/HCFC 402A provide a new data bank for new refrigerants, and allow a coherent comparison with old refrigerants CFC 11, CFC 12, CFC/HCFC 502 and with existing correlations. The existing correlations were found to be inadequate. Because of this work, an improved flow pattern map and flow boiling model were developed, which resulted in a substantial progress in the accurate predict of heat transfer in plain, horizontal tubes for refrigerants without oil. The Kattan et al. correlation was programmed to calculate and compare predicted heat transfer coefficients to the new HFC 407C test data. The flow pattern map proposed by Kattan et al. was also programmed and compared to flow regimes observed for HFC 407C. It predicted the HFC 407C flow pattern data quite accurately. The original objective of the HFC 407C measurements was the validation of the Kattan et al. correlation applied to a zeotropic refrigerant blend. Local flow boiling heat transfer coefficients were measured for HFC 407C evaporating inside a microfin and a plain tube. In addition, microfin heat transfer augmentation relative to a plain tube was investigated. The presence of oil in the evaporator had a complex effect on heat transfer coefficients. Local flow boiling heat transfer coefficients were measured for refrigerant HFC 407C ester oil mixtures (Mobil EAL Arctic 68). A new thermodynamic approach for modeling mixtures of zeotropic refrigerant blends and lubricating oils was also developed. (author) figs., tabs., 14 refs.

  12. A New Paradigm to Address Bid Protests

    Science.gov (United States)

    2010-08-02

    is unlimited. Prepared for: Naval Postgraduate School, Monterey, California 93943 NPS-CM-10-159 ^`nrfpfqflk=obpb^o`e= pmlkploba=obmloq=pbofbp...Investigator Dr. Melese earned his BA in economics at the University of California , Berkeley, and his PhD at the Catholic University of Louvain, Belgium...GAO and CFC statistics from Schaengold, Guiffré, & Gill, 2009, p. 255). 4 For example, in GTSI Corp. v. Wildflower International, Inc., Case No. 1

  13. JPRS Report Latin America Reference Aid Abbreviations and Acronyms in the Latin American Press.

    Science.gov (United States)

    2007-11-02

    America (IA) AESNE Asociaciön de Empleados del Servicio Nacional de Electricidad Association of National Electricity Service Employees (CR...Culture Council (Br) CFC Corporaciön Financiers Colombians Colombian Finance Corporation (Co) CFE Comisiön Federal de Electricidad Federal...Nacional de Radio- Electricidad , Metalurgia y Afines National Inter-Trade Union Committee of Radio Engineering, Metallurgical, and Related

  14. Narrowing the uncertainty for deep-ocean injection efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Orr, J.C.; Aumont, O. [Laboratoire des Sciences du Climat et de l' Environnement, CEA-CNRS, Gif-sur-Yvette (France); Yool, A. [Southampton Oceanography Centre, Southampton (United Kingdom); Plattner, G.K.; Joos, F. [Bern Univ., Bern (Switzerland). Physics Inst.; Maier-Reimer, E. [Max Planck Inst. fuer Meteorologie, Hamburg (Germany); Weirig, M.F.; Schlitzer, R. [Alfred Wegener Inst. for Polar and Marine Research, Bremerhaven (Germany); Caldeira, K.; Wickett, M.E. [Lawrence Livermore National Laboratory, CA (United States); Matear, R.J. [Australian Commonwealth Scientific and Research Organization, Hobart (Australia); Mignone, B.K.; Sarmiento, J.L. [Princeton Univ., Princeton, NJ (United States). AOS Program

    2005-07-01

    Ten ocean general circulation models (OCGMs) were compared as part of an international study investigating the ocean's ability to efficiently sequester carbon dioxide (CO{sub 2}). The models were selected for their ability to simulate radiocarbon and CFC-11. All of the model simulations neglected the influence of marine biota, and the simulations used only dissolved inorganic carbon (DIC) as a tracer in order to conserve computing resources. The models were integrated using standard ocean carbon-cycle model intercomparison project (OCMIP) formulations for gas exchange boundary conditions to obtain pre-industrial conditions. All models used the same predefined atmospheric CO{sub 2} records compiled from 1765 to 2000, as well as future scenarios in which atmospheric CO{sub 2} was stabilized at 650 ppm. Injections occurred over a period of 100 years. Results of the study showed that global budgets for CFC-11 and radiocarbon were correlated with global efficiencies for a 3000 m injection simulation. The 3000 m injection efficiency was then correlated with the global mean for deep natural radiocarbon. Results showed that simultaneously accounting for constraints from both CFC-11 and natural radiocarbon narrowed the range for a 3000 m injection efficiency in the year 2500 by a factor of 4. The study showed that models must be able to simulate global inventories for CFC-11 as well as global means for radiocarbon in deep ocean scenarios in order to be credible. It was concluded that models using both constraints will more accurately simulate global injection efficiencies.

  15. Ex vivo expansions and transplantations of mouse bone marrow-derived hematopoietic stem/progenitor cells

    Institute of Scientific and Technical Information of China (English)

    王金福; 吴亦凡; HARRINTONGJenny; McNIECEIanK.

    2004-01-01

    To examine the effects of co-culture with bone marrow mesenchymal stem cells on expansion of hematopoietic tem/progenitor cells and the capacities of rapid neutrophil engraftment and hematopoietic reconstitution of the expanded ells, we expanded mononuclear cells (MNCs) and CD34+/c-kit+ cells from mouse bone marrow and transplanted the expanded cells into the irradiated mice. MNCs were isolated from mouse bone marrow and CD34+/c-kit+ cells were selected from MNCs by using MoFlo Cell Sorter. MNCs and CD34+/c-kit+ cells were co-cultured with mouse bone marrow-derived mesenchymal stem cells (MSCs) under a two-step expansion. The expanded cells were then transplanted into sublethally irradiated BDF 1 mice. Results showed that the co-culture with MSCs resulted in expansions of median total nucleated cells, CD34+ cells, GM-CFC and HPP-CFC respectively by 10.8-, 4.8-, 65.9- and 38.8-fold for the mononuclear cell culture, and respectively by 76.1-, 2.9-, 71.7- and 51.8-fold for the CD34+/c-kit+ cell culture. The expanded cells could rapidly engraft in the sublethally irradiated mice and reconstitute their hematopoiesis. Co-cultures with MSCs in conjunction with two-step expansion increased expansions of total nucleated cells, GM-CFC and HPP-CFC, which led us to conclude MSCs may create favorable environment for expansions of hematopoietic stem/progenitor cells. The availability of increased numbers of expanded ceils by the co-culture with MSCs may result in more rapid engraftment ofneutrophils following infusion to transplant recipients.

  16. Ex vivo expansions and transplantations of mouse bone marrow-derived hematopoietic stem/progenitor cells

    Institute of Scientific and Technical Information of China (English)

    WANG Jin-fu(王金福); WU Yi-fan(吴亦凡); HARRINTONG Jenny; McNIECE Ian K.

    2004-01-01

    To examine the effects of co-culture with bone marrow mesenchymal stem cells on expansion of hematopoietic stem/progenitor cells and the capacities of rapid neutrophil engraftment and hematopoietic reconstitution of the expanded cells, we expanded mononuclear cells (MNCs) and CD34+/c-kit+ cells from mouse bone marrow and transplanted the expanded cells into the irradiated mice. MNCs were isolated from mouse bone marrow and CD34+/c-kit+ cells were selected from MNCs by using MoFlo Cell Sorter. MNCs and CD34+/c-kit+ cells were co-cultured with mouse bone marrow-derived mesenchymal stem cells (MSCs) under a two-step expansion. The expanded cells were then transplanted into sublethally irradiated BDF1 mice. Results showed that the co-culture with MSCs resulted in expansions of median total nucleated cells,CD34+ cells, GM-CFC and HPP-CFC respectively by 10.8-, 4.8-, 65.9- and 38.8-fold for the mononuclear cell culture, and respectively by 76.1-, 2.9-, 71.7- and 51.8-fold for the CD34+/c-kit+ cell culture. The expanded cells could rapidly engraft in the sublethally irradiated mice and reconstitute their hematopoiesis. Co-cultures with MSCs in conjunction with two-step expansion increased expansions of total nucleated cells, GM-CFC and HPP-CFC, which led us to conclude MSCs may create favorable environment for expansions of hematopoietic stem/progenitor cells. The availability of increased numbers of expanded cells by the co-culture with MSCs may result in more rapid engraftment ofneutrophils following infusion to transplant recipients.

  17. Hydrothermal fluid venting in the offshore sector of Campi Flegrei caldera: A geochemical, geophysical, and volcanological study

    Science.gov (United States)

    Di Napoli, R.; Aiuppa, A.; Sulli, A.; Caliro, S.; Chiodini, G.; Acocella, V.; Ciraolo, G.; Di Vito, M. A.; Interbartolo, F.; Nasello, C.; Valenza, M.

    2016-10-01

    The ongoing unrest at the Campi Flegrei caldera (CFc) in southern Italy is prompting exploration of its poorly studied offshore sector. We report on a multidisciplinary investigation of the Secca delle Fumose (SdF), a submarine relief known since antiquity as the largest degassing structure of the offshore sector of CFc. We combined high-resolution morphobathymetric and seismostratigraphic data with onshore geological information to propose that the present-day SdF morphology and structure developed during the initial stages of the last CFc eruption at Monte Nuovo in AD 1538. We suggest that the SdF relief stands on the eastern uplifted border of a N-S-trending graben-like structure formed during the shallow emplacement of the Monte Nuovo feeding dike. We also infer that the high-angle bordering faults that generated the SdF relief now preferentially allow the ascent of hot brines (with an equilibrium temperature of 179°C), thereby sustaining hydrothermal degassing on the seafloor. Systematic vertical seawater profiling shows that hydrothermal seafloor venting generates a sizeable CO2, pH, and temperature anomaly in the overlying seawater column. Data for the seawater vertical profile can be used to estimate the CO2 and energy (heat) outputs from the SdF area at ˜50 tons/d (˜0.53 kg/s) and ˜80 MW, respectively. In view of the cause-effect relationship with the Monte Nuovo eruption, and the substantial gas and energy outputs, we consider that the SdF hydrothermal system needs to be included in monitoring programs of the ongoing CFc unrest.

  18. Effect of feeding whole compared with cell-free colostrum on calf immune status: The neonatal period.

    Science.gov (United States)

    Langel, S N; Wark, W A; Garst, S N; James, R E; McGilliard, M L; Petersson-Wolfe, C S; Kanevsky-Mullarky, I

    2015-06-01

    Mortality and decreased weight gain resulting from infection and disease in dairy calves are problems within the dairy industry. The bovine neonate relies solely on colostrum to acquire antibodies through passive transfer. To date, colostrum quality is determined by the concentration of antibodies. However, proteins and cells in the colostrum might also enhance immune development in the neonate. To determine the effect of maternal colostral immune cells on calf health and immune status, maternal colostrum was fed either fresh or after lysis of cells by flash-freezing in liquid nitrogen. Thirty-seven female Holstein and Jersey dairy calves were fed 4 quarts total of whole colostrum (WC) or cell-free colostrum (CFC) at birth. Respiratory and fecal scores were measured from birth to d 45 of life. Calf peripheral blood samples were obtained before and after feeding colostrum as well as on d 1, 3, 7, 14, 21, and 28 of life. Peripheral blood mononuclear cells were collected and analyzed for cellular parameters by flow cytometry. Total respiratory scores were greater in CFC-fed calves compared with WC-fed calves on d 38 of life. There were fewer CD4+ T cells and CD4+CD62L+CD45RO- T cells on d 1 and fewer CD4+CD62L+CD45RO+ T cells on d 1 and 3 in CFC-fed calves compared with WC-fed calves. Compared with WC-fed calves, CFC-fed calves had a greater percentage of CD4+CD62L-CD45RO+ T cells on d 0.25, 1, 3, and 7, and a greater percentage of monocytes on d 7. Our data suggest that colostral cells adoptively transfer and enhance neonatal immunity during the first month of life.

  19. Gravitational waves in Fully Constrained Formulation in a dynamical spacetime with matter content

    Energy Technology Data Exchange (ETDEWEB)

    Cordero-Carrion, Isabel; Cerda-Duran, Pablo [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Str. 1, D-85741, Garching (Germany); Ibanez, Jose MarIa, E-mail: chabela@mpa-garching.mpg.de, E-mail: cerda@mpa-garching.mpg.de, E-mail: jose.m.ibanez@uv.es [Departamento de AstronomIa y Astrofisica, Universidad de Valencia, C/ Dr. Moliner 50, E-46100 Burjassot, Valencia (Spain)

    2011-09-22

    We analyze numerically the behaviour of the hyperbolic sector of the Fully Constrained Formulation (FCF) (Bonazzola et al. 2004). The numerical experiments allow us to be confident in the performances of the upgraded version of the CoCoNuT code (Dimmelmeier et al. 2005) by replacing the Conformally Flat Condition (CFC), an approximation of Einstein equations, by FCF. First gravitational waves in FCF in a dynamical spacetime with matter content will be shown.

  20. Dynamical spacetimes and gravitational radiation in a Fully Constrained Formulation

    CERN Document Server

    Cordero-Carrión, Isabel; Ibáñez, José María

    2010-01-01

    This contribution summarizes the recent work carried out to analyze the behavior of the hyperbolic sector of the Fully Constrained Formulation (FCF) derived in Bonazzola et al. 2004. The numerical experiments presented here allows one to be confident in the performances of the upgraded version of CoCoNuT's code by replacing the Conformally Flat Condition (CFC) approximation of the Einstein equations by the FCF.

  1. Dynamical spacetimes and gravitational radiation in a Fully Constrained Formulation

    Energy Technology Data Exchange (ETDEWEB)

    Cordero-Carrion, Isabel; Ibanez, Jose MarIa [Departamento de Astronomia y Astrofisica, Universidad de Valencia, C/ Dr. Moliner 50, E-46100 Burjassot, Valencia (Spain); Cerda-Duran, Pablo, E-mail: isabel.cordero@uv.e, E-mail: cerda@mpa-garching.mpg.d, E-mail: jose.m.ibanez@uv.e [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Strasse 1, D-85741 Garching (Germany)

    2010-05-01

    This contribution summarizes the recent work carried out to analyze the behavior of the hyperbolic sector of the Fully Constrained Formulation (FCF) derived in Bonazzola et al. 2004. The numerical experiments presented here allows one to be confident in the performances of the upgraded version of CoCoNuT's code by replacing the Conformally Flat Condition (CFC) approximation of the Einstein equations by the FCF.

  2. Shari’a Compliant Finance: The Overlooked Element for Developing an Effective Financial System in Afghanistan

    Science.gov (United States)

    2012-06-08

    oversight, retail banking, small and medium enterprise finance, and microfinance . USAID also provided advice on how to implement on-site examinations of... microfinance market assessment in Syria and found that 43.2 percent of the population only wanted to use SCF because they perceived conventional...4CFC-8D5B-1 090 18D30895113298/BPSESJatengenglish.pdf (accessed 28 September 20 11 ), 21. 90 Grameen-Jameel Pan-Arab Microfinance Limited and the

  3. Preliminary Guidelines for Safe and Effective Use of Hot, High-Pressure Washers for Maintenance Cleaning of Army Vehicles.

    Science.gov (United States)

    1982-11-01

    275W0) (31005 (34 4501 PRESSURE, psi ( tiPo ) Figure A3. Impact versus pressure; 0 constant. 31 A00- -- - I =.0526 Q/r- Q = CONSTANT 16 15 (66.7)(57 149...Cosbined Fores Comand V6301 Sunny Point NOT 266t ATTr DAN-Ca- ATTW: EUSA-HIC-CFC/Engr ATTN: tAIN-CWO NARADO M. ATTN O DNA -P 071160 ATTN. DALN-CwP -SA

  4. New Delivery Systems and Propellants

    Directory of Open Access Journals (Sweden)

    Myrna Dolovich

    1999-01-01

    Full Text Available The removal of chlorofluorocarbon (CFC propellants from industrial and household products has been agreed to by over 165 countires of which more than 135 are developing countries. The timetable for this process is outlined in the Montreal Protocol on Substances that Deplete the Ozone Layer document and in several subsequent amendments. Pressured metered dose inhalers (pMDIs for medical use have been granted temporary exemptions until replacement formulations, providing the same medication via the same route, and with the same efficacy and safety profiles, are approved for human use. Hydrofluoroalkanes (HFAs are the alternative propellants for CFCs-12 and -114. Their potential for damage to the ozone layer is nonexistent, and while they are greenhouse gases, their global warming potential is a fraction (one-tenth of that of CFCs. Replacement formulations for almost all inhalant respiratory medications have been or are being produced and tested; in Canada, it is anticipated that the transition to these HFA or CFC-free pMDIs will be complete by the year 2005. Initially, an HFA pMDI was to be equivalent to the CFC pMDI being replaced, in terms of aerosol properties and effective clinical dose. However, this will not necessarily be the situation, particularly for some corticosteroid products. Currently, only one CFC-free formulation is available in Canada – Airomir, a HFA salbutamol pMDI. This paper discusses the in vitro aerosol characteristics, in vivo deposition and clinical data for several HFA pMDIs for which there are data available in the literature. Alternative delivery systems to the pMDI, namely, dry powder inhalers and nebulizers, are briefly reviewed.

  5. Effect of feeding whole compared with cell-free colostrum on calf immune status: Vaccination response.

    Science.gov (United States)

    Langel, S N; Wark, W A; Garst, S N; James, R E; McGilliard, M L; Petersson-Wolfe, C S; Kanevsky-Mullarky, I

    2016-05-01

    Vaccination contributes to improved herd health and production. Boosting immune development at a young age may have long-term effects by enhancing vaccine immune response and efficacy. In the bovine, colostrum is the sole source of maternal immunity, having a substantial effect on health status in the neonate. To date, colostral antibody concentration is used to evaluate colostrum quality. However, colostrum also contains proteins and cells, which may affect immune development and future responses to vaccines. To determine the effect of maternal colostral cells on immune development, 37 female Holstein and Jersey dairy calves were bottle-fed 4 quarts total of whole colostrum (WC) or cell-free colostrum (CFC) at birth. Calves were vaccinated with 2 series of multivalent vaccines. Series A consisted of vaccines given between 1 and 4mo of life. Series B consisted of vaccines given between 5 and 10mo of life. Calf peripheral blood samples were obtained before each vaccination series and monthly for 3mo after each vaccination series. Cellular blood parameters were determined by flow cytometry. Quantitative real-time PCR was used to determine cytokine gene expression in peripheral blood mononuclear cells before vaccination series B and once a month for 2mo after vaccination series B. Calves fed CFC had fewer numbers of B cells in mo 2 after vaccination series A when compared with WC-fed calves. Calves fed CFC had decreased gene expression levels of IL-2 in mo 1 and numbers of CD4(+)CD62L(+)CD45RO(-) and CD4(+)CD62L(+)CD45RO(+) T cells in mo 0 and 1 after vaccination series B as compared with WC-fed calves. Our findings indicate a greater response to vaccines up to 6 to 10mo post-WC feeding when compared with CFC. These data suggest that adoptive transfer of maternal colostral cells at birth has a long-term effect on development of the neonatal immune system.

  6. Overview of co-deposition and fuel inventory in castellated divertor structures at JET

    Science.gov (United States)

    Rubel, M. J.; Coad, J. P.; Pitts, R. A.; JET-EFDA Work Programme

    2007-08-01

    The main focus of this work is fuel retention in plasma components of the JET water-cooled Mk-I divertors operated with small tiles, first with carbon fibre composite (CFC) and then with castellated beryllium. Until recently these have been the only large-scale structures of this type used in fusion experiments. Three issues regarding fuel retention and material migration are addressed: (i) accumulation in gaps separating tiles and in the grooves of castellation; (ii) comparison of deposition on carbon and beryllium; (iii) in-depth migration of deuterium into the bulk of CFC. The essential results are summarised as follows: (i) co-deposition occurs up to a few cm deep in the gaps between the Mk-I tiles; (ii) fuel inventory in the CFC tile gaps exceeds that on plasma-facing surfaces by up to a factor of 2; (iii) in gaps between the beryllium tiles from the inner divertor corner the fuel content reaches 30% of that on plasma-facing surfaces, whereas in the grooves of castellation in Be the fuel content is less than 3.0% of that found on the top surface; (iv) fuel inventory on the Be tiles is strongly associated with the carbon co-deposition; (v) the D content measured in the bulk (1.5 mm below the surface) on cleaved CFC tiles exceeds 1 × 10 15 cm -2. Implications of these results for a next-step device are addressed and the transport mechanism into the gaps is briefly discussed. The results presented here suggest that in a machine with non-carbon walls in the main chamber (as foreseen for ITER) the material transport and subsequent fuel inventory in the castellation would be reduced.

  7. Sampling efficiency of modified 37-mm sampling cassettes using computational fluid dynamics.

    Science.gov (United States)

    Anthony, T Renée; Sleeth, Darrah; Volckens, John

    2016-01-01

    In the U.S., most industrial hygiene practitioners continue to rely on the closed-face cassette (CFC) to assess worker exposures to hazardous dusts, primarily because ease of use, cost, and familiarity. However, mass concentrations measured with this classic sampler underestimate exposures to larger particles throughout the inhalable particulate mass (IPM) size range (up to aerodynamic diameters of 100 μm). To investigate whether the current 37-mm inlet cap can be redesigned to better meet the IPM sampling criterion, computational fluid dynamics (CFD) models were developed, and particle sampling efficiencies associated with various modifications to the CFC inlet cap were determined. Simulations of fluid flow (standard k-epsilon turbulent model) and particle transport (laminar trajectories, 1-116 μm) were conducted using sampling flow rates of 10 L min(-1) in slow moving air (0.2 m s(-1)) in the facing-the-wind orientation. Combinations of seven inlet shapes and three inlet diameters were evaluated as candidates to replace the current 37-mm inlet cap. For a given inlet geometry, differences in sampler efficiency between inlet diameters averaged less than 1% for particles through 100 μm, but the largest opening was found to increase the efficiency for the 116 μm particles by 14% for the flat inlet cap. A substantial reduction in sampler efficiency was identified for sampler inlets with side walls extending beyond the dimension of the external lip of the current 37-mm CFC. The inlet cap based on the 37-mm CFC dimensions with an expanded 15-mm entry provided the best agreement with facing-the-wind human aspiration efficiency. The sampler efficiency was increased with a flat entry or with a thin central lip adjacent to the new enlarged entry. This work provides a substantial body of sampling efficiency estimates as a function of particle size and inlet geometry for personal aerosol samplers.

  8. AcEST: DK953813 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s musculus GN=Cfc1 PE=... 36 0.14 sp|P0AA23|EBR_SALTY Putative ethidium bromide resistance protein... 35 0.2...4 sp|P0AA24|EBR_PSEAE Putative ethidium bromide resistance protein... 35 0.24 sp|...P0AA22|EBR_ECOLX Putative ethidium bromide resistance protein... 35 0.24 sp|P0AFU2|YFBS_ECOLI Uncharacterize

  9. On the age of stratospheric air and inorganic chlorine and bromine release

    Science.gov (United States)

    Daniel, J. S.; Schauffler, S. M.; Pollock, W. H.; Solomon, S.; Weaver, A.; Heidt, L. E.; Garcia, R. R.; Atlas, E. L.; Vedder, J. F.

    1996-07-01

    We estimate the average transport time from the tropical tropopause to various regions of the northern hemisphere lower stratosphere (stratospheric age) using simultaneous mixing ratio measurements of CFC-115 and CO2 measured by the Whole Air Sampler (WAS) during Airborne Arctic Stratospheric Expedition II (AASE II). Our inferred ages are consistent with those presented in previous studies. We discuss sources of uncertainties that affect age estimates in general, as well as specific uncertainties arising from inferring ages using CO2 and CFC-115 abundances. We infer inorganic chlorine (Cly) and bromine (Bry) at various lower stratospheric locations using the WAS organic chlorine and bromine measurements in combination with modeled tropospheric halocarbon trends and with our estimated ages. Inferred Cly and Bry abundances generally increase with increasing latitude and altitude. For our analyzed locations inside the polar vortex, we estimate a maximum Cly abundance of about 2.7 parts per billion by volume (ppbv) and a maximum Bry abundance of about 13.7 parts per trillion by volume (pptv). The locations of these maxima correspond to an average N2O mixing ratio of about 100 ppbv, and to a fractional dissociation of organic chlorine and bromine of 0.85 and 0.90, respectively. Finally, we discuss the expected future limitations of using CFC-115 to estimate stratospheric age due to the production limitations prescribed by the amendments and adjustments to the Montreal Protocol.

  10. Replacement Technologies for Precision Cleaning of Aerospace Hardware for Propellant Service

    Science.gov (United States)

    Beeson, Harold; Kirsch, Mike; Hornung, Steven; Biesinger, Paul

    1997-01-01

    The NASA White Sands Test Facility (WSTF) is developing cleaning and verification processes to replace currently used chlorofluorocarbon-l13- (CFC-113-) based processes. The processes being evaluated include both aqueous- and solvent-based techniques. Replacement technologies are being investigated for aerospace hardware and for gauges and instrumentation. This paper includes the findings of investigations of aqueous cleaning and verification of aerospace hardware using known contaminants, such as hydraulic fluid and commonly used oils. The results correlate nonvolatile residue with CFC 113. The studies also include enhancements to aqueous sampling for organic and particulate contamination. Although aqueous alternatives have been identified for several processes, a need still exists for nonaqueous solvent cleaning, such as the cleaning and cleanliness verification of gauges used for oxygen service. The cleaning effectiveness of tetrachloroethylene (PCE), trichloroethylene (TCE), ethanol, hydrochlorofluorocarbon 225 (HCFC 225), HCFC 141b, HFE 7100(R), and Vertrel MCA(R) was evaluated using aerospace gauges and precision instruments and then compared to the cleaning effectiveness of CFC 113. Solvents considered for use in oxygen systems were also tested for oxygen compatibility using high-pressure oxygen autogenous ignition and liquid oxygen mechanical impact testing.

  11. Recurrent fuzzy neural network by using feedback error learning approaches for LFC in interconnected power system

    Energy Technology Data Exchange (ETDEWEB)

    Sabahi, Kamel; Teshnehlab, Mohammad; Shoorhedeli, Mahdi Aliyari [Department of Electrical Engineering, K.N. Toosi University of Technology, Intelligent System Lab, Tehran (Iran)

    2009-04-15

    In this study, a new adaptive controller based on modified feedback error learning (FEL) approaches is proposed for load frequency control (LFC) problem. The FEL strategy consists of intelligent and conventional controllers in feedforward and feedback paths, respectively. In this strategy, a conventional feedback controller (CFC), i.e. proportional, integral and derivative (PID) controller, is essential to guarantee global asymptotic stability of the overall system; and an intelligent feedforward controller (INFC) is adopted to learn the inverse of the controlled system. Therefore, when the INFC learns the inverse of controlled system, the tracking of reference signal is done properly. Generally, the CFC is designed at nominal operating conditions of the system and, therefore, fails to provide the best control performance as well as global stability over a wide range of changes in the operating conditions of the system. So, in this study a supervised controller (SC), a lookup table based controller, is addressed for tuning of the CFC. During abrupt changes of the power system parameters, the SC adjusts the PID parameters according to these operating conditions. Moreover, for improving the performance of overall system, a recurrent fuzzy neural network (RFNN) is adopted in INFC instead of the conventional neural network, which was used in past studies. The proposed FEL controller has been compared with the conventional feedback error learning controller (CFEL) and the PID controller through some performance indices. (author)

  12. Clinical-scale cultures of cord blood CD34(+) cells to amplify committed progenitors and maintain stem cell activity.

    Science.gov (United States)

    Ivanovic, Zoran; Duchez, Pascale; Chevaleyre, Jean; Vlaski, Marija; Lafarge, Xavier; Dazey, Bernard; Robert-Richard, Elodie; Mazurier, Frédéric; Boiron, Jean-Michel

    2011-01-01

    We developed a clinical-scale cord blood (CB) cell ex vivo procedure to enable an extensive expansion of committed progenitors--colony-forming cells (CFCs) without impairing very primitive hematopoietic stem cells (HSCs). CD34(++) cells, selected from previously cryopreserved and thawed CB units, were cultured in two steps (diluted 1:4 after 6 days) in the presence of stem cell factor (SCF), fms-related tyrosine kinase 3 ligand (Flt-3L), megakaryocyte growth and development factor (MGDF) (100 ng/ml each), granulocyte-colony stimulating factor (G-CSF) (10 ng/ml) in HP01 serum-free medium. HSC activity was evaluated in a serial transplantation assay, by detection of human cells (CD45, CD33, CD19 and CFC of human origin) in bone marrow (BM) of primary and secondary recipient NOD/SCID mice 6-8 weeks after transplantation. A wide amplification of total cells (∼350-fold), CD34(+) cells (∼100-fold), and CFC (∼130-fold) without impairing the HSC activity was obtained. The activity of a particular HSC subpopulation (SRC(CFC)) was even enhanced.Thus, an extensive ex vivo expansion of CFCs is feasible without impairing the activity of HSCs. This result was enabled by associating antioxidant power of medium with an appropriate cytokine cocktail (i.e., mimicking physiologic effects of a weak oxygenation in hematopoietic environment).

  13. Assessment of the safety, targeting, and distribution characteristics of a novel pH-sensitive hydrogel.

    Science.gov (United States)

    Dong, Kai; Dong, Yalin; You, Cuiyu; Xu, Wei; Huang, Xiaoyan; Yan, Yan; Zhang, Lu; Wang, Ke; Xing, Jianfeng

    2014-11-01

    In our previous study, we synthesized a pH-sensitive hydrogel based on poly (ɛ-caprolactone) (PCL), Pluronic (Poloxamer) and methacrylic acid (MAA) using UV-initiated free-radical polymerization. In the present study, we evaluated the safety of the obtained GMA-PCFC-GMA copolymer and a P(CFC-MAA-MEG) hydrogel both in vitro and in vivo. The pharmacokinetics study and distribution characteristics of dexamethasone in rat blood and mouse colon were investigated in detail. The in vitro toxicity of the GMA-PCFC-GMA copolymer was evaluated using a cell viability assay with HEK293 cells. An acute oral toxicity test was conducted by orally administering mice with a total of 10,000 mg/kg body weight of the P(CFC-MAA-MEG) hydrogel. The mice were then observed continuously for 14 days. After which, they were sacrificed and their blood collected for routine blood and serum chemistry tests. Pharmacokinetic and colonic tissue distribution studies were conducted using high-performance liquid chromatography to detect the concentration of dexamethasone in rat blood and mouse colon tissue. All of the results indicated that both the GMA-PCFC-GMA copolymer and P(CFC-MAA-MEG) hydrogel were nontoxic. Moreover, the hydrogel significantly enhanced the colon-targeting behavior of dexamethasone. These results suggested that the novel hydrogel has great potential in colon-targeted drug delivery.

  14. Prediction of antiepileptic drug treatment outcomes using machine learning

    Science.gov (United States)

    Colic, Sinisa; Wither, Robert G.; Lang, Min; Zhang, Liang; Eubanks, James H.; Bardakjian, Berj L.

    2017-02-01

    Objective. Antiepileptic drug (AED) treatments produce inconsistent outcomes, often necessitating patients to go through several drug trials until a successful treatment can be found. This study proposes the use of machine learning techniques to predict epilepsy treatment outcomes of commonly used AEDs. Approach. Machine learning algorithms were trained and evaluated using features obtained from intracranial electroencephalogram (iEEG) recordings of the epileptiform discharges observed in Mecp2-deficient mouse model of the Rett Syndrome. Previous work have linked the presence of cross-frequency coupling (I CFC) of the delta (2-5 Hz) rhythm with the fast ripple (400-600 Hz) rhythm in epileptiform discharges. Using the I CFC to label post-treatment outcomes we compared support vector machines (SVMs) and random forest (RF) machine learning classifiers for providing likelihood scores of successful treatment outcomes. Main results. (a) There was heterogeneity in AED treatment outcomes, (b) machine learning techniques could be used to rank the efficacy of AEDs by estimating likelihood scores for successful treatment outcome, (c) I CFC features yielded the most effective a priori identification of appropriate AED treatment, and (d) both classifiers performed comparably. Significance. Machine learning approaches yielded predictions of successful drug treatment outcomes which in turn could reduce the burdens of drug trials and lead to substantial improvements in patient quality of life.

  15. Rhythmic Working Memory Activation in the Human Hippocampus

    Directory of Open Access Journals (Sweden)

    Marcin Leszczyński

    2015-11-01

    Full Text Available Working memory (WM maintenance is assumed to rely on a single sustained process throughout the entire maintenance period. This assumption, although fundamental, has never been tested. We used intracranial electroencephalography (EEG recordings from the human hippocampus in two independent experiments to investigate the neural dynamics underlying WM maintenance. We observed periodic fluctuations between two different oscillatory regimes: Periods of “memory activation” were reflected by load-dependent alpha power reductions and lower levels of cross-frequency coupling (CFC. They occurred interleaved with periods characterized by load-independent high levels of alpha power and CFC. During memory activation periods, a relevant CFC parameter (load-dependent changes of the peak modulated frequency correlated with individual WM capacity. Fluctuations between these two periods predicted successful performance and were locked to the phase of endogenous delta oscillations. These results show that hippocampal maintenance is a dynamic rather than constant process and depends critically on a hierarchy of oscillations.

  16. Mothers’ Participation and Compliance toward the Improvement of the Infants’ Nutritional in Community Feeding Center Lagarutu Palu

    Directory of Open Access Journals (Sweden)

    Nurdin Rahman

    2016-06-01

    Full Text Available Nutrition is one of the indicators in building the qualified human resources. Nationally, the prevalence of malnutrition is 19,6%. This shows that the problem of malnutrition in Indonesia is still a public health problem. In Palu Province, malnutrition is also a health problem that continues to be handled. Community Feeding Center is a program of the government in tackling the cases of malnutrition through the supplementary feeding and education in the mothers. This study was aimed to determine the relationship between the mothers’ participation and compliance in giving supplementary feeding with improved nutritional status of infants in CFC Lagarutu. The type of this research is in the form of analytic survey with cross sectional approach with 31 samples taken by purposive sampling technique. The data were analyzed using Chi-square test with α 5%. The research was conducted in April-June 2015. The results show that no relationship between the participation (p=0,001 and the improvement of the infants’ nutritional status, where the more active of the mothers in the CFC program, the more improvement of the infants’ nutritional status. There is a relationship between the compliance and the improved nutritional status (p=0,000, where the more obedient of the mothers in giving supplementary feeding, the more improvement of the infants’ nutritional status. It is recommended to the mothers to always be active in the CFC program and dutifully provide supplementary food to their children in order to improve the nutritional status of infants.

  17. Functional Class in Children with Idiopathic Dilated Cardiomyopathy. A pilot Study

    Directory of Open Access Journals (Sweden)

    Aline Cristina Tavares

    2016-01-01

    Full Text Available Abstract Background: Idiopathic dilated cardiomyopathy (IDCM, most common cardiac cause of pediatric deaths, mortality descriptor: a low left ventricular ejection fraction (LVEF and low functional capacity (FC. FC is never self reported by children. Objective: The aims of this study were (i To evaluate whether functional classifications according to the children, parents and medical staff were associated. (iv To evaluate whether there was correlation between VO2 max and Weber's classification. Method: Prepubertal children with IDCM and HF (by previous IDCM and preserved LVEF were selected, evaluated and compared. All children were assessed by testing, CPET and functional class classification. Results: Chi-square test showed association between a CFm and CFp (1, n = 31 = 20.6; p = 0.002. There was no significant association between CFp and CFc (1, n = 31 = 6.7; p = 0.4. CFm and CFc were not associated as well (1, n = 31 = 1.7; p = 0.8. Weber's classification was associated to CFm (1, n = 19 = 11.8; p = 0.003, to CFp (1, n = 19 = 20.4; p = 0.0001and CFc (1, n = 19 = 6.4; p = 0.04. Conclusion: Drawing were helpful for children's self NYHA classification, which were associated to Weber's stratification.

  18. On the age of stratospheric air and ozone depletion potentials in polar regions

    Science.gov (United States)

    Pollock, W. H.; Heidt, L. E.; Lueb, R. A.; Vedder, J. F.; Mills, M. J.; Solomon, S.

    1992-01-01

    Observations of the nearly inert, man-made chlorofluorocarbon CFC-115 obtained during January 1989 are used to infer the age of air in the lower stratosphere. These observations together with estimated release rates suggest an average age of high-latitude air at pressure altitudes near 17-21 km of about 3 to 5 yr. This information is used together with direct measurements of HCFC-22, HCFC-142b, CH3Br, H-1301, H-1211, and H-2402 to examine the fractional dissociation of these species within the Arctic polar lower stratosphere compared to that of CFC-11 and hence to estimate their local ozone depletion potentials in this region. It is shown that these HCFCs are much less efficiently dissociated within the stratosphere than CFC-11, lowering their ozone depletion potentials to only about 30-40 percent of their chlorine loading potentials. In contrast, the observations of CH3Br and the Halons considered confirm that they are rapidly dissociated within the stratosphere, with important implications for their ozone depletion potentials.

  19. Substitutes for potent green house gases. HFCs, PFCs and SF{sub 6}. Status report

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, P.H. [Dansk Teknologisk Institut (Denmark)

    1997-12-31

    CFCs (halogenated chlorofluorocarbons), HCFCs (hydrochlorofluorocarbons), HFCs (hydrofluorocarbons), PFCs (fluorocarbons) and SF{sub 6} (sulphur hexafluoride) are all artificial substances which were not to be found in nature until recently. In 1995 the Danish consumption of HFC substances was approximately 740 tonnes, where the corresponding amount of SF{sub 6} was about 17 tonnes. If the entire amount of these substances was released to to the atmosphere, the resulting impact would correspond to an increased emission of greenhouse gases, corresponding to approximately 1.5 million tonnes of CO{sub 2}. HFC substances would account for 73%, SF{sub 6} with 25% and PFC for 1%. This corresponds to approximately 2.6% of the Danish CO{sub 2} emission (nearly 60 million tonnes per year). This corresponds to about half of the aimed 6% reduction of CO{sub 2} emission attained by introduction of mandatory green taxes on CO{sub 2}. According to experience from the CFC programme it is possible to recover some CFC and send it to controlled destruction. From 1993 to 1996 the refrigeration industry, for instance, has returned a total amount of 163 tonnes of CFC refrigerant through the KMO organization (Koelebranchens Miljoe Ordning). Most of this has been destroyed and a small amount has been purified and recycled afterwards. Similarly, it is likely to believe that some HFC refrigerant will be returned through the KMO organization. (au) 11 refs., also published in Danish

  20. Transit Time Distribution based on the ECCO-JPL Ocean Data Assimilation

    Science.gov (United States)

    Ito, Takamitsu; Wang, Ou

    2017-03-01

    Oceanic water mass is a mixture of waters with varying ages, and the Transit Time Distribution (TTD) measures its age spectrum. We construct a model-based TTD using the data-constrained circulation fields from the ECCO-JPL Ocean Data Assimilation, and test it against the observed and directly simulated distribution of pCFC-11 from the Pacific and Atlantic basins. The ECCO-JPL circulation provides overall reliable estimates of the upper ocean ventilation rates suitable for biogeochemical studies. Observed distributions of pCFC-11 in the upper ocean thermocline are well reproduced by the convolution integral of the model-based TTD (mean bias 0.87) but there are significant regional biases in particular near the base of the thermocline and in the deep water formation regions. The model underestimates the deep pCFC-11 (> 2000 m) in the North Atlantic and in the Southern Ocean. The ratio between the mean and the spread of the age spectrum (Γ/Δ) is close to unity (mean = 1.04, median = 0.99) in the ventilated thermocline of the Pacific basin but there are significant regional variations of the ratio.

  1. Comparison of halocarbon measurements in an atmospheric dry whole air sample

    Directory of Open Access Journals (Sweden)

    George C. Rhoderick

    2015-11-01

    Full Text Available Abstract The growing awareness of climate change/global warming, and continuing concerns regarding stratospheric ozone depletion, will require continued measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track atmospheric mole fractions and assess the impact of policy on emission rates, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. Precise measurements of these species aid in determining small changes in their atmospheric abundance. A common source of standards/scales and/or well-documented agreement of different scales used to calibrate the measurement instrumentation are key to understanding many sets of data reported by researchers. This report describes the results of a comparison study among National Metrology Institutes and atmospheric research laboratories for the chlorofluorocarbons (CFCs dichlorodifluoromethane (CFC-12, trichlorofluoromethane (CFC-11, and 1,1,2-trichlorotrifluoroethane (CFC-113; the hydrochlorofluorocarbons (HCFCs chlorodifluoromethane (HCFC-22 and 1-chloro-1,1-difluoroethane (HCFC-142b; and the hydrofluorocarbon (HFC 1,1,1,2-tetrafluoroethane (HFC-134a, all in a dried whole air sample. The objective of this study is to compare calibration standards/scales and the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. The results of this study show agreement among four independent calibration scales to better than 2.5% in almost all cases, with many of the reported agreements being better than 1.0%.

  2. REM Sleep-Dependent Bidirectional Regulation of Hippocampal-Based Emotional Memory and LTP.

    Science.gov (United States)

    Ravassard, Pascal; Hamieh, Al Mahdy; Joseph, Mickaël Antoine; Fraize, Nicolas; Libourel, Paul-Antoine; Lebarillier, Léa; Arthaud, Sébastien; Meissirel, Claire; Touret, Monique; Malleret, Gaël; Salin, Paul-Antoine

    2016-04-01

    Prolonged rapid-eye-movement (REM) sleep deprivation has long been used to study the role of REM sleep in learning and memory processes. However, this method potentially induces stress and fatigue that may directly affect cognitive functions. Here, by using a short-term and nonstressful REM sleep deprivation (RSD) method we assessed in rats the bidirectional influence of reduced and increased REM sleep amount on hippocampal-dependent emotional memory and plasticity. Our results indicate that 4 h RSD impaired consolidation of contextual fear conditioning (CFC) and induction of long-term potentiation (LTP), while decreasing density of Egr1/Zif268-expressing neurons in the CA1 region of the dorsal hippocampus. LTP and Egr1 expression were not affected in ventral CA1. Conversely, an increase in REM sleep restores and further facilitates CFC consolidation and LTP induction, and also increases Egr1 expression in dorsal CA1. Moreover, CFC consolidation, Egr1 neuron density, and LTP amplitude in dorsal CA1 show a positive correlation with REM sleep amount. Altogether, these results indicate that mild changes in REM sleep amount bidirectionally affect memory and synaptic plasticity mechanisms occurring in the CA1 area of the dorsal hippocampus.

  3. Design and Optimization of a Composite Canard Control Surface of an Advanced Fighter Aircraft under Static Loading

    Directory of Open Access Journals (Sweden)

    Shrivastava Sachin

    2015-01-01

    Full Text Available The minimization of weight and maximization of payload is an ever challenging design procedure for air vehicles. The present study has been carried out with an objective to redesign control surface of an advanced all-metallic fighter aircraft. In this study, the structure made up of high strength aluminum, titanium and ferrous alloys has been attempted to replace by carbon fiber composite (CFC skin, ribs and stiffeners. This study presents an approach towards development of a methodology for optimization of first-ply failure index (FI in unidirectional fibrous laminates using Genetic-Algorithms (GA under quasi-static loading. The GAs, by the application of its operators like reproduction, cross-over, mutation and elitist strategy, optimize the ply-orientations in laminates so as to have minimum FI of Tsai-Wu first-ply failure criterion. The GA optimization procedure has been implemented in MATLAB and interfaced with commercial software ABAQUS using python scripting. FI calculations have been carried out in ABAQUS with user material subroutine (UMAT. The GA's application gave reasonably well-optimized ply-orientations combination at a faster convergence rate. However, the final optimized sequence of ply-orientations is obtained by tweaking the sequences given by GA's based on industrial practices and experience, whenever needed. The present study of conversion of an all metallic structure to partial CFC structure has led to 12% of weight reduction. Therefore, the approach proposed here motivates designer to use CFC with a confidence.

  4. Functional Class in Children with Idiopathic Dilated Cardiomyopathy. A pilot Study

    Science.gov (United States)

    Tavares, Aline Cristina; Bocchi, Edimar Alcides; Guimarães, Guilherme Veiga

    2016-01-01

    Background Idiopathic dilated cardiomyopathy (IDCM), most common cardiac cause of pediatric deaths, mortality descriptor: a low left ventricular ejection fraction (LVEF) and low functional capacity (FC). FC is never self reported by children. Objective The aims of this study were (i) To evaluate whether functional classifications according to the children, parents and medical staff were associated. (iv) To evaluate whether there was correlation between VO2 max and Weber's classification. Method Prepubertal children with IDCM and HF (by previous IDCM and preserved LVEF) were selected, evaluated and compared. All children were assessed by testing, CPET and functional class classification. Results Chi-square test showed association between a CFm and CFp (1, n = 31) = 20.6; p = 0.002. There was no significant association between CFp and CFc (1, n = 31) = 6.7; p = 0.4. CFm and CFc were not associated as well (1, n = 31) = 1.7; p = 0.8. Weber's classification was associated to CFm (1, n = 19) = 11.8; p = 0.003, to CFp (1, n = 19) = 20.4; p = 0.0001and CFc (1, n = 19) = 6.4; p = 0.04). Conclusion Drawing were helpful for children's self NYHA classification, which were associated to Weber's stratification. PMID:27168472

  5. Modulation of gene expression in contextual fear conditioning in the rat.

    Directory of Open Access Journals (Sweden)

    Giuseppe Federighi

    Full Text Available In contextual fear conditioning (CFC a single training leads to long-term memory of context-aversive electrical foot-shocks association. Mid-temporal regions of the brain of trained and naive rats were obtained 2 days after conditioning and screened by two-directional suppression subtractive hybridization. A pool of differentially expressed genes was identified and some of them were randomly selected and confirmed with qRT-PCR assay. These transcripts showed high homology for rat gene sequences coding for proteins involved in different cellular processes. The expression of the selected transcripts was also tested in rats which had freely explored the experimental apparatus (exploration and in rats to which the same number of aversive shocks had been administered in the same apparatus, but temporally compressed so as to make the association between painful stimuli and the apparatus difficult (shock-only. Some genes resulted differentially expressed only in the rats subjected to CFC, others only in exploration or shock-only rats, whereas the gene coding for translocase of outer mitochondrial membrane 20 protein and nardilysin were differentially expressed in both CFC and exploration rats. For example, the expression of stathmin 1 whose transcripts resulted up regulated was also tested to evaluate the transduction and protein localization after conditioning.

  6. Determination of interlaminar shear strength of carbon fibre-reinforced carbons applying the compression-shear test in the temperature range from room temparature up to 2000 C; Die Ermittlung der interlaminaren Scherfestigkeit von Kohlenstoffaser-verstaerkten Kohlenstoffen mit dem Druck-Scherversuch im Temperaturbereich zwischen Raumtemperatur und 2000 C

    Energy Technology Data Exchange (ETDEWEB)

    Thielicke, B.

    1997-07-01

    There are several testing methods that can be selected to determine the interlaminar shear strength, but the results obtained may differ considerably in terms of strength data or failure modes derived. The work reported here therefore was to apply the established testing methods to determination of the interlaminar shear strength of CFC, and to verify and evaluate their results by means of stress analyses and the observed failure modes. On this basis, a novel testing method was to be developed and, if suitable, modified and optimized particularly for laminated CFCs. One major criterion was applicability of the novel testing method over the entire range of hitherto known service temperatures, i.e. up to at least 2000 C. (orig./CB) [Deutsch] Zur Ermittlung der ILSF (Interlaminare Scherfestigkeit) existieren verschiedene Pruefmethoden, deren Anwendung zum Teil zu sehr unterschiedlichen Versagensmustern und Festigkeitswerten fuehrt. Erstes Ziel der vorgelegten Arbeit war es deshalb, die etablierten Methoden zur Ermittlung der Interlaminaren Schwerfestigkeit auf CFC anzuwenden und die Aussagekraft der ermittelten Werte mit Hilfe von Spannungsanalysen und anhand der beobachteten Versagensmuster zu ueberpruefen und zu bewerten. Darauf aufbauend sollte zweitens ein fuer laminiertes CFC geeignetes Pruefverfahren ausgewaehlt, gegebenenfalls modifiziert und optimiert oder ein neues Verfahren entwickelt werden. Hierbei sollte die Anwendbarkeit der Pruefmethode im gesamten Bereich der moeglichen Einsatztemperaturen, d.h. bis mindestens 2000 C, ein wesentliches Kriterium sein. (orig./MM)

  7. High-global warming potential F-gas emissions in California: comparison of ambient-based versus inventory-based emission estimates, and implications of refined estimates.

    Science.gov (United States)

    Gallagher, Glenn; Zhan, Tao; Hsu, Ying-Kuang; Gupta, Pamela; Pederson, James; Croes, Bart; Blake, Donald R; Barletta, Barbara; Meinardi, Simone; Ashford, Paul; Vetter, Arnie; Saba, Sabine; Slim, Rayan; Palandre, Lionel; Clodic, Denis; Mathis, Pamela; Wagner, Mark; Forgie, Julia; Dwyer, Harry; Wolf, Katy

    2014-01-21

    To provide information for greenhouse gas reduction policies, the California Air Resources Board (CARB) inventories annual emissions of high-global-warming potential (GWP) fluorinated gases, the fastest growing sector of greenhouse gas (GHG) emissions globally. Baseline 2008 F-gas emissions estimates for selected chlorofluorocarbons (CFC-12), hydrochlorofluorocarbons (HCFC-22), and hydrofluorocarbons (HFC-134a) made with an inventory-based methodology were compared to emissions estimates made by ambient-based measurements. Significant discrepancies were found, with the inventory-based emissions methodology resulting in a systematic 42% under-estimation of CFC-12 emissions from older refrigeration equipment and older vehicles, and a systematic 114% overestimation of emissions for HFC-134a, a refrigerant substitute for phased-out CFCs. Initial, inventory-based estimates for all F-gas emissions had assumed that equipment is no longer in service once it reaches its average lifetime of use. Revised emission estimates using improved models for equipment age at end-of-life, inventories, and leak rates specific to California resulted in F-gas emissions estimates in closer agreement to ambient-based measurements. The discrepancies between inventory-based estimates and ambient-based measurements were reduced from -42% to -6% for CFC-12, and from +114% to +9% for HFC-134a.

  8. Quantitative genetic insights into the coevolutionary dynamics of male and female genitalia.

    Science.gov (United States)

    Evans, Jonathan P; van Lieshout, Emile; Gasparini, Clelia

    2013-07-22

    The spectacular variability that typically characterizes male genital traits has largely been attributed to the role of sexual selection. Among the evolutionary mechanisms proposed to account for this diversity, two processes in particular have generated considerable interest. On the one hand, females may exploit postcopulatory mechanisms of selection to favour males with preferred genital traits (cryptic female choice; CFC), while on the other hand females may evolve structures or behaviours that mitigate the direct costs imposed by male genitalia (sexual conflict; SC). A critical but rarely explored assumption underlying both processes is that male and female reproductive traits coevolve, either via the classic Fisherian model of preference-trait coevolution (CFC) or through sexually antagonistic selection (SC). Here, we provide evidence for this prediction in the guppy (Poecilia reticulata), a polyandrous livebearing fish in which males transfer sperm internally to females via consensual and forced matings. Our results from a paternal half-sibling breeding design reveal substantial levels of additive genetic variation underlying male genital size and morphology-two traits known to predict mating success during non-consensual matings. Our subsequent finding that physically interacting female genital traits exhibit corresponding levels of genetic (co)variation reveals the potential intersexual coevolutionary dynamics of male and female genitalia, thereby fulfilling a fundamental assumption underlying CFC and SC theory.

  9. Sexual conflict and cryptic female choice in the black field cricket, Teleogryllus commodus.

    Science.gov (United States)

    Bussière, Luc F; Hunt, John; Jennions, Michael D; Brooks, Robert

    2006-04-01

    The prevalence and evolutionary consequences of cryptic female choice (CFC) remain highly controversial, not least because the processes underlying its expression are often concealed within the female reproductive tract. However, even when female discrimination is relatively easy to observe, as in numerous insect species with externally attached spermatophores, it is often difficult to demonstrate directional CFC for certain male phenotypes over others. Using a biological assay to separate male crickets into attractive or unattractive categories, we demonstrate that females strongly discriminate against unattractive males by removing their spermatophores before insemination can be completed. This results in significantly more sperm being transferred by attractive males than unattractive males. Males respond to CFC by mate guarding females after copulation, which increases the spermatophore retention of both attractive and unattractive males. Interestingly, unattractive males who suffered earlier interruption of sperm transfer benefited more from mate guarding, and they guarded females more vigilantly than attractive males. Our results suggest that postcopulatory mate guarding has evolved via sexual conflict over insemination times rather than through genetic benefits of biasing paternity toward vigorous males, as has been previously suggested.

  10. Cryptic female preference for colorful males in guppies.

    Science.gov (United States)

    Pilastro, Andrea; Simonato, Martina; Bisazza, Angelo; Evans, Jonathan P

    2004-03-01

    Cryptic female choice (CFC) refers to female-mediated processes occurring during or after copulation that result in biased sperm use in favor of preferred or compatible males. Despite recent empirical support for this hypothesis, evidence that CFC contributes towards the evolution of male body ornaments, in the same way that precopulatory female choice does, is currently lacking. Here, we tested the possibility that CFC selects for increased male attractiveness in the guppy Poecilia reticulata, a freshwater fish exhibiting internal fertilization. Specifically, we examined whether females are able to manipulate the number of sperm transferred or retained at copulation in favor of relatively attractive males. In support of this prediction, we found that following solicited copulations the number of sperm inseminated is influenced exclusively by the female's perception of relative male coloration, independent of any direct manipulation of males themselves. Because females prefer brightly colored males during precopulatory mate choice, our finding that colorful males are also favored as a consequence of enhanced insemination success indicates that cryptic female choice can reinforce precopulatory preferences for extravagant male ornaments.

  11. Experimental modifications imply a stimulatory function for male tsetse fly genitalia, supporting cryptic female choice theory.

    Science.gov (United States)

    Briceño, R D; Eberhard, William G

    2009-07-01

    One of the most sweeping of all patterns in morphological evolution is that animal genitalia tend to diverge more rapidly than do other structures. Abundant indirect evidence supports the cryptic female choice (CFC) explanation of this pattern, which supposes that male genitalia often function to court females during copulation; but direct experimental demonstrations of a stimulatory function have been lacking. In this study, we altered the form of two male genital structures that squeeze the female's abdomen rhythmically in Glossina pallidipes flies. As predicted by theory, this induced CFC against the male: ovulation and sperm storage decreased, while female remating increased. Further experiments showed that these effects were due to changes in tactile stimuli received by the female from the male's altered genitalia, and were not due to other possible changes in the males due to alteration of their genital form. Stimulation from male genital structures also induces females to permit copulation to occur. Together with previous studies of tsetse reproductive physiology, these data constitute the most complete experimental confirmation that sexual selection (probably by CFC) acts on the stimulatory properties of male genitalia.

  12. [Cystic Fibrosis Cloud database: An information system for storage and management of clinical and microbiological data of cystic fibrosis patients].

    Science.gov (United States)

    Prieto, Claudia I; Palau, María J; Martina, Pablo; Achiary, Carlos; Achiary, Andrés; Bettiol, Marisa; Montanaro, Patricia; Cazzola, María L; Leguizamón, Mariana; Massillo, Cintia; Figoli, Cecilia; Valeiras, Brenda; Perez, Silvia; Rentería, Fernando; Diez, Graciela; Yantorno, Osvaldo M; Bosch, Alejandra

    2016-01-01

    The epidemiological and clinical management of cystic fibrosis (CF) patients suffering from acute pulmonary exacerbations or chronic lung infections demands continuous updating of medical and microbiological processes associated with the constant evolution of pathogens during host colonization. In order to monitor the dynamics of these processes, it is essential to have expert systems capable of storing and subsequently extracting the information generated from different studies of the patients and microorganisms isolated from them. In this work we have designed and developed an on-line database based on an information system that allows to store, manage and visualize data from clinical studies and microbiological analysis of bacteria obtained from the respiratory tract of patients suffering from cystic fibrosis. The information system, named Cystic Fibrosis Cloud database is available on the http://servoy.infocomsa.com/cfc_database site and is composed of a main database and a web-based interface, which uses Servoy's product architecture based on Java technology. Although the CFC database system can be implemented as a local program for private use in CF centers, it can also be used, updated and shared by different users who can access the stored information in a systematic, practical and safe manner. The implementation of the CFC database could have a significant impact on the monitoring of respiratory infections, the prevention of exacerbations, the detection of emerging organisms, and the adequacy of control strategies for lung infections in CF patients.

  13. Hierarchical Ni0.54Co0.46O2 nanowire and nanosheet arrays grown on carbon fiber cloth for high-performance supercapacitors

    Science.gov (United States)

    Jiang, Yuanzhi; Zhang, Lijuan; Zhang, Hang; Zhang, Cui; Liu, Shuangxi

    2016-10-01

    Hierarchical Ni0.54Co0.46O2 architectures composed by nanowires or nanosheets were successfully grown on bio-mass carbon fiber cloth (CFC) by hydrothermal method. The morphology of Ni0.54Co0.46O2 can be effectively controlled by using different precipitators. The structural effects of the two kinds of morphologies were researched. the results suggest that the Ni0.54Co0.46O2 nanosheet arrays grown on CFC (NCO-NSs/CFC) shows a higher Faradaic areal capacity of 438 μAh cm-2 (238.1 mAh g-1) at a current density of 1 mA cm-2 and still about 90.3% initial capacity retention even at the high current density of 50 mA cm-2. Moreover, an all-solid-state flexible symmetric supercapacitor device has been successfully assembled. The optimized device delivers superior electrochemical performance with an outstanding energy density of 92.4 Wh kg-1 at a power density of 207.2 W kg-1. Such hierarchical nanostructure composed by well-aligned uniform Ni0.54Co0.46O2 nanosheet arrays grown on bio-mass carbon fiber cloth might hold great promise as battery-type electrode material for high-performance supercapacitor.

  14. Impact of cryopreservation on tetramer, cytokine flow cytometry, and ELISPOT

    Directory of Open Access Journals (Sweden)

    Morse Michael A

    2005-07-01

    Full Text Available Abstract Background Cryopreservation of PBMC and/or overnight shipping of samples are required for many clinical trials, despite their potentially adverse effects upon immune monitoring assays such as MHC-peptide tetramer staining, cytokine flow cytometry (CFC, and ELISPOT. In this study, we compared the performance of these assays on leukapheresed PBMC shipped overnight in medium versus cryopreserved PBMC from matched donors. Results Using CMV pp65 peptide pool stimulation or pp65 HLA-A2 tetramer staining, there was significant correlation between shipped and cryopreserved samples for each assay (p ≤ 0.001. The differences in response magnitude between cryopreserved and shipped PBMC specimens were not significant for most antigens and assays. There was significant correlation between CFC and ELISPOT assay using pp65 peptide pool stimulation, in both shipped and cryopreserved samples (p ≤ 0.001. Strong correlation was observed between CFC (using HLA-A2-restricted pp65 peptide stimulation and tetramer staining (p Conclusion We conclude that all three assays show concordant results on shipped versus cryopreserved specimens, when using a peptide-based readout. The assays are also concordant with each other in pair wise comparisons using equivalent antigen systems.

  15. Hemopoiesis in the splenectomized-pregnant mouse following low-dose total-body irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Weinberg, S.R.; MacVittie, T.J.

    1981-09-01

    The effect of splenectomy (SPLX) and total-body irradiation (TBI) (50-200 rad) on virgin and pregnant mouse hemopoiesis was studied, using peripheral blood hemogram values and femoral marrow hemopoietic progenitor cell activity (i.e., CFUlt. slash/sub E/, BFU/sub E/, and GM-CFC). The SPLX-maternal red cell counts and hematocrit values were lower than those of SPLX-virgin mice, reflecting the anemia of pregnancy. But the white cell counts of both SPLX-virgin and SPLX-day-14.5 pregnant mice were significantly higher (P<0.005) than normal-virgin mice. Both nonirradiated and day-4 irradiated SPLX-maternal marrow Ep-independent and Ep-dependent CFU/sub E/ were higher than the nonirradiated and day-4 irradiated SPLX-virgin values (respectively, for each TBI dose studied). On the other hand, nonirradiated and day-4 irradiated SPLX-maternal GM-CFC were lower than the nonirradiated and day-4 irradiated SPLX-virgin GM-CFC values. The data demonstrate the potential of the SPLX-maternal femoral marrow to respond to the stress of low-dose TBI with effective compensatory erythropoiesis, possibly at the expense of granulopoiesis.

  16. Os usos do civismo em tempos autoritários: as comemorações e ações do Conselho Federal de Cultura (1966-1975

    Directory of Open Access Journals (Sweden)

    Tatyana de Amaral Maia

    2014-06-01

    Full Text Available O Conselho Federal de Cultura (CFC foi o principal órgão responsável pelas políticas culturais entre 1967 e 1975. O CFC era formado por 24 intelectuais com o objetivo de organizar o setor cultural e elaborar o inédito Plano Nacional de Cultura. A criação do Conselho está integrada à participação desses intelectuais no campo político e cultural brasileiro desde a década de 1920. Além disso, seus discursos e projetos incorporam o ideário cívico vigente na ditadura civil-militar (1964-1985. Dentre as ações do CFC, a criação de calendários culturais anuais destinados a instituições de ensino e cultura foi uma tentativa de valorizar os elementos cívicos que comporiam a cultura nacional. A associação entre memória e história aparece aqui traduzida na relação entre memória histórica e prática cívica, tão utilizada em períodos autoritários.

  17. Learned fear, emotional reactivity and fear of heights: a factor analytic map from a large F(2) intercross of Roman rat strains.

    Science.gov (United States)

    Aguilar, Raúl; Gil, Luis; Flint, Jonathan; Gray, Jeffrey A; Dawson, Gerard R; Driscoll, Peter; Giménez-Llort, Lydia; Escorihuela, Rosa M; Fernández-Teruel, Alberto; Tobeña, Adolf

    2002-01-01

    Anxiety-related behaviours were evaluated across various tests in a 800 F(2)-intercross of the Roman high- and low-avoidance inbred rats. These tests either evoke unlearned (open field [OF]; plus-maze [PM]; hole-board [HB]; spontaneous activity [A]; and acoustic startle reflex [ASR]) or learned (classical fear conditioning [CFC]; and shuttlebox avoidance conditioning [SAC]), anxious/fearful responses. Using factor analysis (oblique rotation), we obtained a six-fold solution with 14 variables derived from all tests. These six factors represented SAC, CFC, PM anxiety, PM and OF activity, ASR anxiety, plus a mixed whole of anxious and activity variables (from OF and A), respectively. In searching for a smaller number of meaningful factors, we applied a three-factor solution that coherently corresponded with differentiated facets of fearfulness, rather than with the tests. Results showed that (1) measures of SAC and CFC strongly loaded onto Factor 1, labelled as "Learned Fear"; (2) a blend of almost all variables loaded onto Factor 2, called "Emotional Reactivity"; and (3) open arm behaviour in the PM loaded onto Factor 3, called "Fear of Heights." After discussing limitations of this apparently consistent behavioural map of anxiety, we advance some connections between those factors with quantitative trait loci candidates (genetic markers) as detected in the same sample.

  18. The effects of early-life adversity on fear memories in adolescent rats and their persistence into adulthood.

    Science.gov (United States)

    Chocyk, Agnieszka; Przyborowska, Aleksandra; Makuch, Wioletta; Majcher-Maślanka, Iwona; Dudys, Dorota; Wędzony, Krzysztof

    2014-05-01

    Adolescence is a developmental period characterized by extensive morphological and functional remodeling of the brain. The processes of brain maturation during this period may unmask malfunctions that originate earlier in life as a consequence of early-life stress (ELS). This is associated with the emergence of many psychopathologies during adolescence, particularly affective spectrum disorders. In the present study, we applied a maternal separation (MS) procedure (3h/day, on postnatal days 1-14) as a model of ELS to examine its effects on the acquisition, expression and extinction of fear memories in adolescent rats. Additionally, we studied the persistence of these memories into adulthood. We found that MS decreased the expression of both contextual (CFC) and auditory (AFC) fear conditioning in adolescent rats. Besides, MS had no impact on the acquisition of extinction learning. During the recall of extinction MS animals both, those previously subjected and not subjected to the extinction session, exhibited equally low levels of freezing. In adulthood, the MS animals (conditioned during adolescence) still displayed impairments in the expression of AFC (only in males) and CFC. Furthermore, the MS procedure had also an impact on the expression of CFC (but not AFC) after retraining in adulthood. Our findings imply that ELS may permanently affect fear learning and memory. The results also support the hypothesis that, depending on individual predispositions and further experiences, ELS may either lead to a resilience or a vulnerability to early- and late-onsets psychopathologies.

  19. Modulation of Gene Expression in Contextual Fear Conditioning in the Rat

    Science.gov (United States)

    Macchi, Monica; Ciampini, Cristina; Bernardi, Rodolfo; Baldi, Elisabetta; Bucherelli, Corrado; Brunelli, Marcello; Scuri, Rossana

    2013-01-01

    In contextual fear conditioning (CFC) a single training leads to long-term memory of context-aversive electrical foot-shocks association. Mid-temporal regions of the brain of trained and naive rats were obtained 2 days after conditioning and screened by two-directional suppression subtractive hybridization. A pool of differentially expressed genes was identified and some of them were randomly selected and confirmed with qRT-PCR assay. These transcripts showed high homology for rat gene sequences coding for proteins involved in different cellular processes. The expression of the selected transcripts was also tested in rats which had freely explored the experimental apparatus (exploration) and in rats to which the same number of aversive shocks had been administered in the same apparatus, but temporally compressed so as to make the association between painful stimuli and the apparatus difficult (shock-only). Some genes resulted differentially expressed only in the rats subjected to CFC, others only in exploration or shock-only rats, whereas the gene coding for translocase of outer mitochondrial membrane 20 protein and nardilysin were differentially expressed in both CFC and exploration rats. For example, the expression of stathmin 1 whose transcripts resulted up regulated was also tested to evaluate the transduction and protein localization after conditioning. PMID:24278235

  20. Assessment of human embryos by time-lapse videography: A comparison of quantitative and qualitative measures between two independent laboratories.

    Science.gov (United States)

    Liu, Yanhe; Copeland, Christopher; Stevens, Adam; Feenan, Katie; Chapple, Vincent; Myssonski, Kim; Roberts, Peter; Matson, Phillip

    2015-12-01

    A total of 488 Day 3 human embryos with known implantation data from two independent in vitro fertilization laboratories were included for analysis, with 270 from Fertility North (FN) and 218 from Canberra Fertility Centre (CFC). Implanting embryos grew at different rates between FN and CFC as indicated in hours of the time intervals between pronuclear fading and the 4- (13.9 ± 1.1 vs. 14.9 ± 1.8), 5- (25.7 ± 1.9 vs. 28.4 ± 3.7) and 8-cell stages (29.0 ± 3.2 vs. 32.2 ± 4.6), as well as the durations of 2- (10.8 ± 0.8 vs. 11.6 ± 1.1), 3- (0.4 ± 0.5 vs. 0.9 ± 1.2), and 4-cell stages (11.8 ± 1.4 vs. 13.6 ± 2.9), all pqualitative measures including poor conventional morphology, direct cleavage, reverse cleavage and 0.05) or non-implanting embryos (30.4% vs. 38.3%, p>0.05) between FN and CFC. Furthermore, implanting embryos favored lower proportions of the above biological events compared to the non-implanting ones in both laboratories (both pquantitative timing parameters may have reduced inter-laboratory transferability; qualitative measures are independent of cell division timings, with potentially improved inter-laboratory reproducibility.

  1. Evaluation of non-azeotropic mixtures containing HFOs as potential refrigerants in refrigeration and high-temperature heat pump systems

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    With the increasing environmental concern on global warming, hydrofluoro-olefin (HFOs), possessing low GWP, has attracted great attention of many researchers recently. In this study, non-azeotropic mixtures composed of HFOs (HFO-1234yf, HFO-1234ze(z), HFO-1234ze(e) and HFO-1234zf) are developed to substitute for HFC-134a and CFC-114 in air-conditioning and high-temperature heat pump systems, respectively. The cycle performances were evaluated by an improved theoretical cy-cle evaluation methodology. The results showed that all the mixtures proposed herein were favorable refrigerants with excel-lent thermodynamic cycle performances. M1A presented lower discharge temperature and pressure ratio and higher COPc than that of HFC-134a. The volumetric cooling capacity was similar to HFC-134a. It can be served as a good environmentally friendly alternative to replace HFC-134a. M3H delivered similar discharge temperature as CFC-114 did. And the COPh was 3% higher. It exhibits excellent cycle performance in high-temperature heat pump and is a promising refrigerant to substitute for CFC-114. And the gliding temperature differences enable them to exhibit better coefficient of performance by matching the sink/source temperature in practice. Because the toxicity, flammability and other properties are not investigated in detail, ex-tensive toxicity and flammability testing needs to be conducted before they are used in a particular application.

  2. Singular Value Decomposition Analysis of Cloud Fraction Cover and Sea Ice Concentration over the Arctic Region, 1982-2009

    Science.gov (United States)

    Boccolari, Mauro; Parmiggiani, Flavio

    2016-08-01

    In this study, the coupled spatial and temporal variability between seasonal data of Cloud Fraction Cover (CFC) and Sea Ice Concentration (SIC) in the Arctic Ocean for the 1982-2009 period were investigated by using the Singular Value Decomposition (SVD) method.The spatial patterns of CFCs related to the first mode of co-variability, identify the maximum covariance, for all seasons, in the Barents Sea and in the Arctic Ocean Canada, while the SIC and 'found in the Chukchi Sea in autumn (in according to the maximum sea ice melting) and the Barents sea during both the winter and spring.CFC spatial patterns related to the first mode of co- variability, locate maximum covariance, for all seasons, in the Barents Sea and in the Canadian side of the Arctic Ocean, while for SIC is found in the Chukchi Sea during autumn (corresponding to the maximum sea ice melting) and in the Barents Sea during both the winter and spring.Finally, the correlation between the seasonal time series of expansion coefficients derived from the SVD analysis, for both CFC and SIC fields, with the seasonal time series of some relevant climate indices for the Arctic (NAO, AO, PDO and PNA). Statistically significant values for both fields were found during summer with the AO, and during autumn with the PNA.

  3. [Frequency of eating away-from-home and quality of dietary carbohydrate and fat intake in the SUN Project].

    Science.gov (United States)

    Villacis, Cecilia; Zazpe, Itziar; Santiago, Susana; De la Fuente-Arrillaga, Carmen; Bes-Rastrollo, Maira; Martínez-González, Miguel Angel

    2014-10-03

    Objetivo: Investigar la asociación entre la frecuencia de comidas fuera de casa (CFC) con a) la calidad de hidratos de carbono y b) la calidad de grasas. Materiales y métodos: Se evaluaron 19.371 participantes de la cohorte SUN que completaron un cuestionario basal de frecuencia de consumo de alimentos previamente validado. Se utilizaron los índices de calidad de hidratos de carbono (ICHC) en una escala de 4 a 20 y de grasas (ICG) en una escala de 0,62 a 5,92. En ambos casos, a mayor puntuación mayor calidad. Se utilizó la regresión lineal múltiple para determinar la asociación entre la frecuencia de CFC (4 categorías) y la puntuación de ambos índices, y la regresión logística para medir la asociación entre la frecuencia de CFC y un bajo ICHC o ICG (

  4. Ozone loss derived from balloon-borne tracer measurements and the SLIMCAT CTM

    Directory of Open Access Journals (Sweden)

    A. D. Robinson

    2004-11-01

    Full Text Available Balloon-borne measurements of CFC-11 (on flights of the DIRAC in situ gas chromatograph and the DESCARTES grab sampler, ClO and O3 were made during the 1999/2000 winter as part of the SOLVE-THESEO 2000 campaign. Here we present the CFC-11 data from nine flights and compare them first with data from other instruments which flew during the campaign and then with the vertical distributions calculated by the SLIMCAT 3-D CTM. We calculate ozone loss inside the Arctic vortex between late January and early March using the relation between CFC-11 and O3 measured on the flights, the peak ozone loss (1200 ppbv occurs in the 440–470 K region in early March in reasonable agreement with other published empirical estimates. There is also a good agreement between ozone losses derived from three independent balloon tracer data sets used here. The magnitude and vertical distribution of the loss derived from the measurements is in good agreement with the loss calculated from SLIMCAT over Kiruna for the same days.

  5. Cryopreservation of sperm of red abalone (Haliotis rufescens)

    Science.gov (United States)

    Salinas-Flores, L.; Paniagua-Chavez, C. G.; Jenkins, J.A.; Tiersch, T.R.

    2005-01-01

    Abalone culture, a developing industry in Baja California, Mexico, would benefit from genetic improvement and controlled breeding. The use of cryopreserved sperm would allow germplasm availability, and this study was designed to develop sperm cryopreservation protocols for red abalone Haliotis rufescens. The acute toxic effects of the cryoprotectants dimethyl sulfoxide (DMSO), propylene glycol (PG), and glycerol (GLY) were assessed after suspending sperm in different concentrations, whereby cryoprotectant treatments of 10% DMSO and 10% GLY equilibrated for 10 min yielded the highest range of motile sperm in preliminary freezing trials and were used for cryopreservation studies. To determine effective cooling rates, three freezing chambers were tested. Replicate samples of sperm from 4 males were placed in 0.5-mL French straws and frozen using a commercial freezing chamber (CFC) used for bull sperm, a programmable rate chamber (PRC), and a manually controlled styrofoam chamber (MCC). For the CFC, the cooling rate was 16??C/min, from 4??C to -140??C. For the PRC and MCC, it was 1??C/min, from -20??C to -30??C. The samples were held at -30??C for 5 min before being plunged into liquid nitrogen (-196??C) for storage, and each sample was thawed in a water bath at 45??C for 8 s. The quality of thawed sperm was determined by estimating percent motility, evaluating membrane integrity using a dual-staining technique and flow cytometry, and estimating fertilization rate. Statistical analyses were performed using 2-way ANOVA where chamber and treatment were the independent variables. Sperm quality parameters were independent. For motilities, a significant interaction was noted between the cryoprotective treatment and the chamber type, whereby motilities for DMSO and GLY were higher (P = 0.0055) using MCC. Membrane integrities were significantly lower after using the PRC than the CFC or the MCC (P = 0.0167). The highest post-thaw motility (48 ?? 7%) was found using sperm

  6. Stirring by deep cyclones and the evolution of Denmark strait overflow water observed at line W

    Science.gov (United States)

    Andres, M.; Toole, J. M.; Torres, D. J.; Smethie, W. M.; Joyce, T. M.; Curry, R. G.

    2016-03-01

    Shipboard velocity and water property data from 18 transects across the North Atlantic Deep Western Boundary Current (DWBC) near 40 °N are examined to study the evolution of the Denmark Strait Overflow Water (DSOW) component of the DWBC and mixing between DSOW and the interior. The examined transects along Line W - which stretches from the continental shelf south of New England to Bermuda - were made between 1994 and 2014. The shipboard data comprise measurements at regular stations of velocity from lowered acoustic Doppler current profilers, CTD profiles and trace gas chlorofluorocarbon (CFC) concentrations from bottle samples at discrete depths. Comparison of the Line W velocity sections with concurrent sea surface height maps from satellite altimetry indicates that large cyclones in the deep ocean accompany intermittent quasi-stationary meander troughs in the Gulf Stream path at Line W. A composite of 5 velocity sections along Line W suggests that a typical cyclone reaches swirl speeds of greater than 30 cm s-1 at 3400-m depth and has a radius (distance between the center and the maximum velocity) of 75 km. Tracer data suggest that these cyclones affect not only the deep velocity structure along Line W, but also provide a mechanism for water exchange between the DWBC's DSOW and the interior. Vigorous exchange is corroborated by a mismatch in the CFC-11:CFC-12 and CFC-113:CFC-12 ratio ages calculated for DSOW at Line W. During the most recent 5-year period (2010-2014), a decrease in DSOW density has been driven by warming (increasing by almost 0.1 °C) as salinity has increased only slightly (by 0.003, which is close to the 0.002 uncertainty of the measurements). The abyssal ocean offshore of the DWBC and Gulf Stream and deeper than 3000-m depth has freshened at a rate of 6×10-4 yr-1 since at least 2003. Density here remains nearly unchanged over this period, due to temperature compensation, though a linear cooling trend in the abyssal ocean (to compensate the

  7. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Servais

    2008-10-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and -12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10% above 20 km altitude, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences

  8. An evaluation of total and inhalable samplers for the collection of wood dust in three wood products industries.

    Science.gov (United States)

    Harper, Martin; Muller, Brian S

    2002-10-01

    In 1998 the American Conference for Governmental Industrial Hygienists (ACGIH) proposed size selective sampling for wood dust based on the inhalable fraction. Thus the proposed threshold limit values (TLVs) require the use of a sampler whose performance matches the inhalable convention. The Institute of Occupational Medicine (IOM) sampler has shown good agreement with the inhalable convention under controlled conditions, and the Button sampler, developed by the University of Cincinnati, has shown reasonable agreement in at least one laboratory study. The Button sampler has not been previously evaluated under wood working conditions, and the IOM has been shown to sample more mass than expected when compared to the standard closed-face cassette, which may be due to the collection of very large particles in wood working environments. Some projectile particles may be > 100 microm aerodynamic diameter and thus outside the range of the convention. Such particles, if present, can bias the estimates of concentration considerably. This study is part of an on-going research focus into selecting the most appropriate inhalable sampler for use in these industries, and to examine the impact of TLV changes. This study compared gravimetric analyses (National Institute of Occupational Safety and Health Method 0500) of side-by-side personal samples using the Button, IOM, and 37 mm closed-face cassette (CFC) under field-use conditions. A total of 51 good sample pairs were collected from three wood products industries involved in the manufacturing of cabinets, furniture, and shutters. Paired t-tests were run on each sample pair using Statistical Package for the Social Sciences (SPSS) version 10. The IOM and the CFC measured statistically different concentrations (p woodworking environments, and, taken together, the data imply a conversion factor greater than the 2.5 normally applied to CFC results to approximate inhalable values, as measured by the IOM. Raising the limit values by

  9. Simultaneous measurements of capillary filtration and diffusion capacities during graded infusions of noradrenaline (NA) and 5-hydroxytryptamine (5-HT) into the rat hindquarter vascular bed.

    Science.gov (United States)

    Rippe, B; Folkow, B

    1980-07-01

    The relationships between capillary diffusion capacity (PS) for Cr-EDTA respective capillary filtration capacity (CFC) and vascular resistance during graded intraarterial infusions of NA and 5-HT into the artificially constant flow perfused rat hindquarter vascular bed were investigated. During maximal vasodilatation PS for Cr-EDTA was some 5.5--5.7 ml/min x 100 g, CFC some 0.04 ml/min x mmHg x 100 g, while vascular resistance was 2.8 mmHg x ml-1 x min x 100 g (PRU100) and isogravimetric capillary pressure 12.8 mmHg on an average. Setting out from maximal vasodilatation, increasing doses of NA and 5-HT produced graded reductions in capillary surface area as reflected by progressive decreases in both PS for Cr-EDTA and CFC. These changes occurred simultaneously with progressive increases in both pre- and postcapillary resistances, causing elevations in both arterial and capillary hydrostatic pressures and hance in capillary fluid filtration at constant flow. Capillary hydrostatic pressure increased maximally to 45 mmHg (calculated for NA) and vascular resistance to some 21 mmHg x ml-1 x min x 100 g on an average. PS for Cr-EDTA decreased maximally to some 0.7--1 ml/min x 100 g for both NA and 5-HT and furthermore, the relationships between PS for Cr-EDTA and PRU100 for NA respective 5-HT were almost identical. This was taken to indicate that capillary surface area for nutritional exchange is affected similarly by both drugs. However, the CFU-PRU100 relationship was shifted towards some 30--50% higher CFC values for 5-HT than for NA at almost every level of vasoconstriction. This might suggest that 5-HT besides reducing capillary surface area also induced moderate increases in capillary permeability though increases in number and/or radius of large pores (gaps) (cf. Rippe, Kamiya & Folkow 1978). Even during NA-induced vasoconstriction, when virtually no changes in capillary permeability occurred, PS for Cr-EDTA was reduced to a relatively greater extent than CFC, the

  10. Estimate of anthropogenic halocarbon emission based on measured ratio relative to CO in the Pearl River Delta region, China

    Directory of Open Access Journals (Sweden)

    M. Shao

    2011-05-01

    Full Text Available Using a GC/FID/MS system, we analyzed the mixing ratio of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD region of southern China. The results revealed that there are elevated mixing ratios for most of halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE, CH2Cl2 (dichloromethane, DCM, CH3 Br (bromomethane, HCFC-22, CHCl3 (trichloromethane, CCl4 (tetrachloromethane, Cl2C = CCl2 (perchloroethylene, PCE, CH3CCl3 (methyl chloroform, MCF, and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in mixing ratios (relative standard deviation ranged from 9.31 % to 96.55 % of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO was examined, and then the emission of each halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg, CH3CCl3 (6.7 Gg, and Cl2C = CCl2 (2.3 Gg accounted for about 62.9 % of total halocarbon emissions, it suggested a significant contribution from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg, an alternative refrigerant to chlorofluorocarbons (CFCs, were about 2.3 times greater than those of CFC-12 (1.6 Gg. CFC-12 and HCFC-22 accounted for 21.5 % of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of CFCs, such as CFC-11, and the emission of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl

  11. Estimates of anthropogenic halocarbon emissions based on its measured ratios relative to CO in the Pearl River Delta

    Directory of Open Access Journals (Sweden)

    M. Shao

    2011-01-01

    Full Text Available Using a GC/FID/MS system, we analyzed the mixing ratio levels of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD region of southern China. The results revealed elevated regional mixing ratios for most halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE, CH2Cl2 (dichloromethane, DCM, CH3Br (bromomethane, HCFC-22, CHCl3 (trichloromethane, CCl4 (tetrachloromethane, Cl2C = CCl2 (perchloroethylene, PCE, CH3CCl3 (methyl chloroform, MCF, and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in concentrations (relative standard deviation ranged from 9.31% to 96.55% of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO were examined, and then each emission of halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg, CH3CCl3 (6.7 Gg, and Cl2C = CCl2 (2.3 Gg accounted for about 62.9% of total emissions, suggesting a significant contribution to halocarbon emissions from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg, an alternative refrigerant to chlorofluorocarbons (CFCs, were about 2.3 times greater than those of CFC-12 (1.6 Gg. CFC-12 and HCFC-22 accounted for 21.5% of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of other CFCs, such as CFC-11, and levels of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl

  12. Historical trends in occurrence and atmospheric inputs of halogenated volatile organic compounds in untreated ground water used as a source of drinking water

    Science.gov (United States)

    Shapiro, S.D.; Busenberg, E.; Focazio, M.J.; Plummer, L.N.

    2004-01-01

    Analyses of samples of untreated ground water from 413 community-, non-community- (such as restaurants), and domestic-supply wells throughout the US were used to determine the frequency of detection of halogenated volatile organic compounds (VOCs) in drinking-water sources. The VOC data were compiled from archived chromatograms of samples analyzed originally for chlorofluorocarbons (CFCs) by purge-and-trap gas chromatography with an electron-capture detector (GC-ECD). Concentrations of the VOCs could not be ascertained because standards were not routinely analyzed for VOCs other than trichloromonofluoromethane (CFC-11), dichlorodifluoromethane (CFC-12) and 1,1,2-trichloro-1,2,2-trifluoroethane (CFC-113). Nevertheless, the peak areas associated with the elution times of other VOCs on the chromatograms can be classified qualitatively to assess concentrations at a detection limit on the order of parts per quadrillion. Three or more VOCs were detected in 100% (percent) of the chromatograms, and 77.2% of the samples contained 10 or more VOCs. The maximum number of VOCs detected in any sample was 24. Modeled ground-water residence times, determined from concentrations of CFC-12, were used to assess historical trends in the cumulative occurrence of all VOCs detected in this analysis, as well as the occurrence of individual VOCs, such as CFC-11, carbon tetrachloride (CCl4), chloroform and tetrachloroethene (PCE). The detection frequency for all of the VOCs detected has remained relatively constant from approximately 1940 to 2000; however, the magnitude of the peak areas on the chromatograms for the VOCs in the water samples has increased from 1940 to 2000. For CFC-11, CCl4, chloroform and PCE, small peaks decrease from 1940 to 2000, and large peaks increase from 1940 to 2000. The increase in peak areas on the chromatograms from analyses of more recently recharged water is consistent with reported increases in atmospheric concentrations of the VOCs. Approximately 44% and 6

  13. Age dating of shallow groundwater with chlorofluorocarbons, tritium/helium 3, and flow path analysis, southern New Jersey coastal plain

    Science.gov (United States)

    Szabo, Z.; Rice, D.E.; Plummer, L.N.; Busenberg, E.; Drenkard, S.; Schlosser, P.

    1996-01-01

    Groundwater age dating through the combination of transient tracer methods (chlorofluorocarbons (CFCs) and tritium/helium 3 (3H/3He)) and groundwater flow path analysis is useful for investigating groundwater travel times, flow patterns, and recharge rates, as demonstrated by this study of the homogeneous shallow, unconfined Kirkwood-Cohansey aquifer system in the southern New Jersey coastal plain. Water samples for age dating were collected from three sets of nested observation wells (10 wells) with 1.5-m-long screens located near groundwater divides. Three steady state finite difference groundwater flow models were calibrated by adjusting horizontal and vertical hydraulic conductivities to match measured heads and head differences (range, 0.002-0.23 m) among the nested wells, with a uniform recharge rate of 0.46 m per year and porosities of 0.35 (sand) and 0.45 (silt) that were assumed constant for all model simulations and travel time calculations. The simulated groundwater travel times increase with depth in the aquifer, ranging from about 1.5 to 6.5 years for the shallow wells (screen bottoms 3-4 m below the water table), from about 10 to 25 years for the medium-depth wells (screen bottoms 8-19 m below the water table), and from about 30 to more than 40 years for the deep wells (screen bottoms 24-26 m below the water table). Apparent groundwater ages based on CFC- and 3H/3He-dating techniques and model-based travel times could not be statistically differentiated, and all were strongly correlated with depth. Confinement of 3He was high because of the rapid vertical flow velocity (of the order of 1 m/yr), resulting in clear delineation of groundwater travel times based on the 3H/3He-dating technique. The correspondence between the 3H/3He and CFC ages indicates that dispersion has had a minimal effect on the tracer-based ages of water in this aquifer. Differences between the tracer-based apparent ages for seven of the 10 samples were smaller than the error values

  14. Flunisolide hydrofluoroalkane with integrated spacer for treating asthma: an updated review.

    Science.gov (United States)

    Berger, William E; Tashkin, Donald P

    2015-01-01

    Flunisolide hydrofluoroalkane (HFA) with integrated spacer is the most recent reformulated inhaled corticosteroid (ICS) for asthma available in the United States. It is the only product that combines a corticosteroid extrafine aerosol with a built-in spacer. The potential clinical benefit of the flunisolide HFA formulation and its integrated spacer for treating persistent asthma was assessed through a comprehensive review of the published literature and data from the past 10 years focusing on (1) flunisolide, the molecule, and the impact of the HFA reformulation; (2) updated information on the anti-inflammatory response to flunisolide HFA, particularly in the distal airways; and (3) the usefulness of an integrated spacer. Flunisolide HFA was found effective and safe in clinical studies and comparable with the chlorofluorocarbon (CFC) formulation, but at about one-third the dose of flunisolide CFC, likely reflecting both the device and the particle size of the reformulated product. Compared with the CFC formulation, the extrafine aerosol and smaller particle size of flunisolide HFA substantially increased pulmonary deposition and decreased oropharyngeal deposition. The integrated spacer further enhanced the pulmonary/oropharyngeal deposition ratio. Examination of lung biopsy specimens indicated a favorable anti-inflammatory response to flunisolide HFA in peripheral airways. Pediatric studies showed no significant effects on growth. The data indicate that flunisolide HFA is a safe and effective maintenance therapy for asthma patients. The integrated spacer may provide an added advantage for patients, especially those who may be more likely to experience adverse effects of ICSs, both local and systemic, including children susceptible to adverse effects on growth.

  15. Vertical profile of peroxyacetyl nitrate (PAN from MIPAS-STR measurements over Brazil in February 2005 and its contribution to tropical UT NOy partitioning

    Directory of Open Access Journals (Sweden)

    A. Roiger

    2008-08-01

    Full Text Available We report on the retrieval of PAN (CH3C(OOONO2 in the upper tropical troposphere from limb measurements by the remote-sensor MIPAS-STR on board the Russian high altitude research aircraft M55-Geophysica. The measurements were performed close to Araçatuba, Brazil, on 17 February 2005. The retrieval was made in the spectral range 775–820 cm−1 where PAN exhibits its strongest feature but also more than 10 species interfere. Especially trace gases such as CH3CCl3, CFC-113, CFC-11, and CFC-22, emitting also in spectrally broad not-resolved branches, make the processing of PAN prone to errors. Therefore, the selection of appropriate spectral windows, the separate retrieval of several interfering species and the careful handling of the water vapour profile are part of the study presented. The retrieved profile of PAN has a maximum of about 0.14 ppbv at 10 km altitude, slightly larger than the lowest reported values (<0.1 ppbv and much lower than the highest reported in the literature (0.65 ppbv. Besides the NOy constituents measured by MIPAS-STR (HNO3, ClONO2, HO2NO2, PAN, the in situ instruments aboard the Geophysica provide simultaneous measurements of NO, NO2, and the sum NOy. Comparing the sum of in-situ and remotely derived NO+NO2+HNO3+ClONO2+HO2NO2+PAN with total NOy a deficit of 30–40% (0.2–0.3 ppbv in the troposphere remains unexplained whereas the values fit well in the stratosphere.

  16. Vertical profile of peroxyacetyl nitrate (PAN from MIPAS-STR measurements over Brazil in February 2005 and the role of PAN in the UT tropical NOy partitioning

    Directory of Open Access Journals (Sweden)

    A. Roiger

    2008-04-01

    Full Text Available We report on the retrieval of PAN (CH3C(OOONO2 in the upper tropical troposphere from limb measurements by the remote-sensor MIPAS-STR on board the Russian high altitude research aircraft M55-Geophysica. The measurements were performed close to Araçatuba, Brazil, on 17 February 2005. The retrieval was made in the spectral range 775–820 cm−1 where PAN exhibits its strongest feature but also more than 10 species interfere. Especially trace gases such as CH3CCl3, CFC-113, CFC-11, and CFC-22, emitting also in spectrally broad not-resolved branches, make the processing of PAN prone to errors. Therefore, the selection of appropriate spectral windows, the separate retrieval of several interfering species and the careful handling of the water vapour profile are part of the study presented. The retrieved profile of PAN has a maximum of about 0.14 ppbv at 10 km altitude, slightly larger than the lowest reported values (<0.1 ppbv and much lower than the highest (0.65 ppbv. Besides the NOy constituents measured by MIPAS-STR (HNO3, ClONO2, PAN, the situ instruments aboard the Geophysica provide simultaneous measurements of NO, NO2, and the sum NOy. Comparing the sum of in-situ and remotely derived NO+NO2+HNO3+ClONO2+PAN with total NOy a deficit of 30–40% (0.2–0.3 ppbv in the troposphere remains unexplained whereas the values fit well in the stratosphere.

  17. Vertical profile of peroxyacetyl nitrate (PAN) from MIPAS-STR measurements over Brazil in February 2005 and its contribution to tropical UT NOy partitioning

    Science.gov (United States)

    Keim, C.; Liu, G. Y.; Blom, C. E.; Fischer, H.; Gulde, T.; Höpfner, M.; Piesch, C.; Ravegnani, F.; Roiger, A.; Schlager, H.; Sitnikov, N.

    2008-08-01

    We report on the retrieval of PAN (CH3C(O)OONO2) in the upper tropical troposphere from limb measurements by the remote-sensor MIPAS-STR on board the Russian high altitude research aircraft M55-Geophysica. The measurements were performed close to Araçatuba, Brazil, on 17 February 2005. The retrieval was made in the spectral range 775 820 cm-1 where PAN exhibits its strongest feature but also more than 10 species interfere. Especially trace gases such as CH3CCl3, CFC-113, CFC-11, and CFC-22, emitting also in spectrally broad not-resolved branches, make the processing of PAN prone to errors. Therefore, the selection of appropriate spectral windows, the separate retrieval of several interfering species and the careful handling of the water vapour profile are part of the study presented. The retrieved profile of PAN has a maximum of about 0.14 ppbv at 10 km altitude, slightly larger than the lowest reported values (<0.1 ppbv) and much lower than the highest reported in the literature (0.65 ppbv). Besides the NOy constituents measured by MIPAS-STR (HNO3, ClONO2, HO2NO2, PAN), the in situ instruments aboard the Geophysica provide simultaneous measurements of NO, NO2, and the sum NOy. Comparing the sum of in-situ and remotely derived NO+NO2+HNO3+ClONO2+HO2NO2+PAN with total NOy a deficit of 30 40% (0.2 0.3 ppbv) in the troposphere remains unexplained whereas the values fit well in the stratosphere.

  18. Vertical profile of peroxyacetyl nitrate (PAN) from MIPAS-STR measurements over Brazil in February 2005 and the role of PAN in the UT tropical NOy partitioning

    Science.gov (United States)

    Keim, C.; Liu, G. Y.; Blom, C. E.; Fischer, H.; Gulde, T.; Höpfner, M.; Piesch, C.; Ravegnani, F.; Roiger, A.; Schlager, H.; Sitnikov, N.

    2008-04-01

    We report on the retrieval of PAN (CH3C(O)OONO2) in the upper tropical troposphere from limb measurements by the remote-sensor MIPAS-STR on board the Russian high altitude research aircraft M55-Geophysica. The measurements were performed close to Araçatuba, Brazil, on 17 February 2005. The retrieval was made in the spectral range 775-820 cm-1 where PAN exhibits its strongest feature but also more than 10 species interfere. Especially trace gases such as CH3CCl3, CFC-113, CFC-11, and CFC-22, emitting also in spectrally broad not-resolved branches, make the processing of PAN prone to errors. Therefore, the selection of appropriate spectral windows, the separate retrieval of several interfering species and the careful handling of the water vapour profile are part of the study presented. The retrieved profile of PAN has a maximum of about 0.14 ppbv at 10 km altitude, slightly larger than the lowest reported values (<0.1 ppbv) and much lower than the highest (0.65 ppbv). Besides the NOy constituents measured by MIPAS-STR (HNO3, ClONO2, PAN), the situ instruments aboard the Geophysica provide simultaneous measurements of NO, NO2, and the sum NOy. Comparing the sum of in-situ and remotely derived NO+NO2+HNO3+ClONO2+PAN with total NOy a deficit of 30-40% (0.2-0.3 ppbv) in the troposphere remains unexplained whereas the values fit well in the stratosphere.

  19. Expansion of CD34+ cells from human umbilical cord blood by FL and/or TPO gene transfected human marrow stromal cell lines

    Institute of Scientific and Technical Information of China (English)

    张毅; 唐佩弦; 金滢; 李秀森; 张双喜; 吴英; 毛宁

    2001-01-01

    To elucidate the effect of gene transfected marrow stromal cell on expansion of human cord blood CD34+ cells, a culture system was established in which FL and TPO genes were transfected into human stromal cell line HFCL. To establish gene transfected stromal cells co-culture system, cord blood CD34+ cells were purified by using a magnetic beads sorting system. The number of all cells and the number of CD34+ cells and CFC (CFU-GM and BFU-E) were counted in different culture systems. The results showed that in all 8 culture systems, SCF+IL-3+HFT manifested the most potent combination, with the number of total nucleated cells increasing by (893.3±52.1)-fold, total progenitor cells (CFC) by (74.5±5.2)-fold and CD34+ cells by 15.7-fold.Maximal expansions of CFC and CD34+ cells were observed at the end of the second week of culture. Within 14 days of culture, (78.1 ± 5.5)-fold and (57.0 ± 19.7)-fold increases in CFU-GM and BFU-E were obtained. Moreover, generation of LTC-IC from amplified CD34+ cells within 28 days was found only in two combinations, I.e. SCF+IL-3+FL+TPO and SCF+IL-3+HFT, and there was no significant difference between these two groups statistically. These results suggest that human umbilical cord blood CD34+ cells can be extensively expanded ex vivo by using gene transfected stromal cells along with cytokines.

  20. Nitrate source indicators in ground water of the Scimitar Subdivision, Peters Creek area, Anchorage, Alaska

    Science.gov (United States)

    Wang, Bronwen; Strelakos, Pat M.; Jokela, Brett

    2000-01-01

    A combination of aqueous chemistry, isotopic measurement, and in situ tracers were used to study the possible nitrate sources, the factors contributing to the spatial distribution of nitrate, and possible septic system influence in the ground water in the Scimitar Subdivision, Municipality of Anchorage, Alaska. Two water types were distinguished on the basis of the major ion chemistry: (1) a calcium sodium carbonate water, which was associated with isotopically heavier boron and with chlorofluorocarbons (CFC's) that were in the range expected from equilibration with the atmosphere (group A water) and (2) a calcium magnesium carbonate water, which was associated with elevated nitrate, chloride, and magnesium concentrations, generally isotopically lighter boron, and CFC's concentrations that were generally in excess of that expected from equilibration with the atmosphere (group B water). Water from wells in group B had nitrate concentrations that were greater than 3 milligrams per liter, whereas those in group A had nitrate concentrations of 0.2 milligram per liter or less. Nitrate does not appear to be undergoing extensive transformation in the ground-water system and behaves as a conservative ion. The major ion chemistry trends and the presence of CFC's in excess of an atmospheric source for group B wells are consistent with waste-water influences. The spatial distribution of the nitrate among wells is likely due to the magnitude of this influence on any given well. Using an expanded data set composed of 16 wells sampled only for nitrate concentration, a significant difference in the static water level relative to bedrock was found. Well water samples with less than 1 milligram per liter nitrate had static water levels within the bedrock, whereas those samples with greater than 1 milligram per liter nitrate had static water levels near or above the top of the bedrock. This observation would be consistent with a conceptual model of a low-nitrate fractured bedrock

  1. Adrenocortical reserves in hyperthyroidism.

    Science.gov (United States)

    Agbaht, Kemal; Gullu, Sevim

    2014-02-01

    Explicit data regarding the changes in adrenocortical reserves during hyperthyroidism do not exist. We aimed to document the capability (response) of adrenal gland to secrete cortisol and DHEA-S during hyperthyroidism compared to euthyroidism, and to describe factors associated with these responses. A standard-dose (0.25 mg/i.v.) ACTH stimulation test was performed to the same patients before hyperthyroidism treatment, and after attainment of euthyroidism. Baseline cortisol (Cor(0)), DHEA-S (DHEA-S(0)), cortisol binding globulin (CBG), ACTH, calculated free cortisol (by Coolen's equation = CFC), free cortisol index (FCI), 60-min cortisol (Cor(60)), and DHEA-S (DHEA-S(60)), delta cortisol (ΔCor), delta DHEA-S (ΔDHEA-S) responses were evaluated. Forty-one patients [22 females, 49.5 ± 15.2 years old, 32 Graves disease, nine toxic nodular goiter] had similar Cor(0), DHEA-S(0), CFC, FCI, and DHEA-S(60) in hyperthyroid and euthyroid states. Cor(60), ΔCor, and ΔDHEA-S were lower in hyperthyroidism. In four (10 %) patients the peak ACTH-stimulated cortisol values were lower than 18 μg/dL. When the test repeated after attainment of euthyroidism, all of the patients had normal cortisol response. Regression analysis demonstrated an independent association of Cor(60) with free T3 in hyperthyroidism. However, the predictors of CFC, FCI, and DHEA-S levels were serum creatinine levels in hyperthyroidism, and both creatinine and transaminase levels in euthyroidism. ACTH-stimulated peak cortisol, delta cortisol, and delta DHEA-S levels are decreased during hyperthyroidism, probably due to increased turnover. Since about 10 % of the subjects with hyperthyroidism are at risk for adrenal insufficiency, clinicians dealing with Graves' disease should be alert to the possibility of adrenal insufficiency during hyperthyroid stage.

  2. Precision and linearity targets for validation of an IFNγ ELISPOT, cytokine flow cytometry, and tetramer assay using CMV peptides

    Directory of Open Access Journals (Sweden)

    Lyerly Herbert K

    2008-03-01

    Full Text Available Abstract Background Single-cell assays of immune function are increasingly used to monitor T cell responses in immunotherapy clinical trials. Standardization and validation of such assays are therefore important to interpretation of the clinical trial data. Here we assess the levels of intra-assay, inter-assay, and inter-operator precision, as well as linearity, of CD8+ T cell IFNγ-based ELISPOT and cytokine flow cytometry (CFC, as well as tetramer assays. Results Precision was measured in cryopreserved PBMC with a low, medium, or high response level to a CMV pp65 peptide or peptide mixture. Intra-assay precision was assessed using 6 replicates per assay; inter-assay precision was assessed by performing 8 assays on different days; and inter-operator precision was assessed using 3 different operators working on the same day. Percent CV values ranged from 4% to 133% depending upon the assay and response level. Linearity was measured by diluting PBMC from a high responder into PBMC from a non-responder, and yielded R2 values from 0.85 to 0.99 depending upon the assay and antigen. Conclusion These data provide target values for precision and linearity of single-cell assays for those wishing to validate these assays in their own laboratories. They also allow for comparison of the precision and linearity of ELISPOT, CFC, and tetramer across a range of response levels. There was a trend toward tetramer assays showing the highest precision, followed closely by CFC, and then ELISPOT; while all three assays had similar linearity. These findings are contingent upon the use of optimized protocols for each assay.

  3. Coupling groundwater residence time and 234U/238U isotopic ratios in a granitic catchment (Vosges, Eastern France)

    Science.gov (United States)

    Viville, Daniel; Aquilina, Luc; Ackerer, Julien; Chatton, Eliot; Labasque, Thierry; Pierret, Marie-Claire; Granet, Mathieu; Perrone, Thierry; Chabaux, François

    2016-04-01

    Weathering processes are active in surface waters but groundwater also represents no neglectable chemical fluxes. As residence-time in groundwater are high, silicate weathering might take place and control Si, Ca and C fluxes. Weathering processes can be deduced from U isotopic ratios but the kinetics of these processes remain relatively poorly constrained. In order to better characterize these processes, we have coupled residence-times deduced from anthropogenic gases (CFC and SF6) analysis and 234U/238U isotopic ratios determination. Samples were collected in the Strengbach catchment (Hydro-geochemical Observatory OHGE, Vosges, eastern France). Two campaigns were carried out in May and August 2015 during two highly contrasted hydro-climatic periods. Both springs and boreholes down to 80 m depth have been sampled. A very clear geochemical distinction is observed between groundwater from surface springs and deeper groundwater from boreholes. Springs show much lower residence-time (few years) and specific chemical composition. Deeper groundwater have residence-time of several decades and different geochemical composition. A clear SF6 production is observed with increasing SF6 concentrations with residence-time. The campaign of May is characterized by highly groundwater levels and spring fluxes. All groundwater show very low residence time, except in the boreholes at depth greater than 40 m. Conversely, during low groundwater-level period in August, the residence times are much higher and CFC concentrations indicate a large mixing process between surface groundwater and deeper levels. The 234U/238U isotopic ratios confirm this vertical zonation in the boreholes, with much higher activity ratios in the deep ground-waters from borehole than in the surface and spring waters; Such high U activity ratios are indicative of long water-rock interactions, which is consistent with the long residence times deducted from the CFC and SF6 data.

  4. European emissions of halogenated greenhouse gases inferred from atmospheric measurements.

    Science.gov (United States)

    Keller, Christoph A; Hill, Matthias; Vollmer, Martin K; Henne, Stephan; Brunner, Dominik; Reimann, Stefan; O'Doherty, Simon; Arduini, Jgor; Maione, Michela; Ferenczi, Zita; Haszpra, Laszlo; Manning, Alistair J; Peter, Thomas

    2012-01-01

    European emissions of nine representative halocarbons (CFC-11, CFC-12, Halon 1211, HCFC-141b, HCFC-142b, HCFC-22, HFC-125, HFC-134a, HFC-152a) are derived for the year 2009 by combining long-term observations in Switzerland, Italy, and Ireland with campaign measurements from Hungary. For the first time, halocarbon emissions over Eastern Europe are assessed by top-down methods, and these results are compared to Western European emissions. The employed inversion method builds on least-squares optimization linking atmospheric observations with calculations from the Lagrangian particle dispersion model FLEXPART. The aggregated halocarbon emissions over the study area are estimated at 125 (106-150) Tg of CO(2) equiv/y, of which the hydrofluorocarbons (HFCs) make up the most important fraction with 41% (31-52%). We find that chlorofluorocarbon (CFC) emissions from banks are still significant and account for 35% (27-43%) of total halocarbon emissions in Europe. The regional differences in per capita emissions are only small for the HFCs, while emissions of CFCs and hydrochlorofluorocarbons (HCFCs) tend to be higher in Western Europe compared to Eastern Europe. In total, the inferred per capita emissions are similar to estimates for China, but 3.5 (2.3-4.5) times lower than for the United States. Our study demonstrates the large benefits of adding a strategically well placed measurement site to the existing European observation network of halocarbons, as it extends the coverage of the inversion domain toward Eastern Europe and helps to better constrain the emissions over Central Europe.

  5. Analysis of groundwater dynamics in the complex aquifer system of Kazan Trona, Turkey, using environmental tracers and noble gases

    Science.gov (United States)

    Arslan, Sebnem; Yazicigil, Hasan; Stute, Martin; Schlosser, Peter; Smethie, William M.

    2015-02-01

    The Eocene deposits of Kazan Basin in Turkey contain a rare trona mineral which is planned to be extracted by solution mining. The complex flow dynamics and mixing mechanisms as noted from previous hydraulic and hydrochemical data need to be augmented with environmental tracer and noble gas data to develop a conceptual model of the system for the assessment of the impacts of the mining and to develop sustainable groundwater management policies throughout the area. The tracers used include the stable isotopes of water (δ2H, δ18O), δ13C and 14C of dissolved inorganic carbon (DIC), tritium (3H), the chlorofluorocarbons CFC-11 and CFC-12, and the noble gases He and Ne. The system studied consists of three aquifers: shallow, middle, and deep. CFC data indicate modern recharge in the shallow system. The estimates of ages through 14C dating for the deeper aquifer system are up to 34,000 years. Helium concentrations cover a wide range of values from 5 × 10-8 to 1.5 × 10-5 cm3 STP/g. 3He/4He ratios vary from 0.09RA to 1.29RA (where RA is the atmospheric 3He/4He ratio of 1.384 × 10-6), the highest found in water from the shallow aquifer. Mantle-derived 3He is present in some of the samples indicating upward groundwater movement, possibly along a NE-SW-striking fault-like feature in the basin.

  6. Structure and Topology Dynamics of Hyper-Frequency Networks during Rest and Auditory Oddball Performance.

    Science.gov (United States)

    Müller, Viktor; Perdikis, Dionysios; von Oertzen, Timo; Sleimen-Malkoun, Rita; Jirsa, Viktor; Lindenberger, Ulman

    2016-01-01

    Resting-state and task-related recordings are characterized by oscillatory brain activity and widely distributed networks of synchronized oscillatory circuits. Electroencephalographic recordings (EEG) were used to assess network structure and network dynamics during resting state with eyes open and closed, and auditory oddball performance through phase synchronization between EEG channels. For this assessment, we constructed a hyper-frequency network (HFN) based on within- and cross-frequency coupling (WFC and CFC, respectively) at 10 oscillation frequencies ranging between 2 and 20 Hz. We found that CFC generally differentiates between task conditions better than WFC. CFC was the highest during resting state with eyes open. Using a graph-theoretical approach (GTA), we found that HFNs possess small-world network (SWN) topology with a slight tendency to random network characteristics. Moreover, analysis of the temporal fluctuations of HFNs revealed specific network topology dynamics (NTD), i.e., temporal changes of different graph-theoretical measures such as strength, clustering coefficient, characteristic path length (CPL), local, and global efficiency determined for HFNs at different time windows. The different topology metrics showed significant differences between conditions in the mean and standard deviation of these metrics both across time and nodes. In addition, using an artificial neural network approach, we found stimulus-related dynamics that varied across the different network topology metrics. We conclude that functional connectivity dynamics (FCD), or NTD, which was found using the HFN approach during rest and stimulus processing, reflects temporal and topological changes in the functional organization and reorganization of neuronal cell assemblies.

  7. Stem cell factor leads to reduced blood processing during apheresis or the use of whole blood aliquots to support dose-intensive chemotherapy.

    Science.gov (United States)

    Weaver, A; Testa, N G

    1998-07-01

    The addition of stem cell factor (SCF) to G-CSF and chemotherapy results in a dose-dependent, significantly increased mobilisation of peripheral blood progenitor cells compared with the use of chemotherapy and G-CSF alone. The enhanced mobilisation may benefit patients in several ways. Firstly, in clinical settings where currently multiple aphereses are having to be performed to obtain a specified target number of cells, the addition of SCF may lead to a reduction in this number. Alternatively, when only a single apheresis is currently being performed to obtain sufficient cells then the addition of SCF to the mobilisation regimen would allow between 5- and 8-fold reduction in the volume of blood required to be processed during the apheresis procedure to obtain a specified target of GM-CFC, CD34+ cells and LTC-IC for those receiving the highest dose of SCF (20 microg/kg) plus G-CSF following chemotherapy compared with those patients receiving G-CSF alone following chemotherapy. The increased mobilisation resulting from the addition of SCF to the regimen makes feasible the use of whole blood aliquots to support dose-intensive therapy. We have calculated that in patients mobilised using cyclophosphamide 3 g/m2, SCF 20 microg/kg and G-CSF 5 microg/kg a median 512 ml aliquot of whole blood would contain 2 x 10(6)/kg CD34+ cells and over 3.7 x 10(5)/kg GM-CFC. This aliquot would be sufficient to rescue the patient following a myeloablative therapy. Significantly, because less individual variation was seen after the administration of SCF the patient who showed the worst mobilisation in that group would have the usually required content of 2 x 10(6) CD34+ cells/kg and 1 x 10(5) GM-CFC/kg in only 731 ml of blood.

  8. Evaluation of AK-225(R), Vertrel(R) MCA and HFE A 7100 as Alternative Solvents for Precision Cleaning and Verification Technology

    Science.gov (United States)

    Melendez, Orlando; Trizzino, Mary; Fedderson, Bryan

    1997-01-01

    The National Aeronautics and Space Administration (NASA), Kennedy Space Center (KSC) Materials Science Division conducted a study to evaluate alternative solvents for CFC-113 in precision cleaning and verification on typical samples that are used in the KSC environment. The effects of AK-225(R), Vertrel(R), MCA, and HFE A 7100 on selected metal and polymer materials were studied over 1, 7 and 30 day test times. This report addresses a study on the compatibility aspects of replacement solvents for materials in aerospace applications.

  9. An evaluation of alternative cleaning methods for removing an organic contaminant from a stainless steel part

    Energy Technology Data Exchange (ETDEWEB)

    Boyd, J.L.

    1996-08-01

    As of December 1995, the manufacture of Freon, along with many other chlorofluorocarbons (CFCs), was prohibited by the Clean Air Act of 1990 (CAA). The ban of CFC solvents has forced manufacturers across the country to search for alternative metal cleaning techniques. The objective of this study was to develop a thorough, scientific based approach for resolving one specific manufacturer`s problem of removing organic contamination from a stainless steel part. This objective was accomplished with an approach that involved: (1) defining the problem, (2) identifying the process constraints, (3) researching alternate cleaning methods, (4) researching applicable government regulations, (5) performing a scientific evaluation and (6) drawing conclusions.

  10. Theoretical foundation for measuring the groundwater age distribution.

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, William Payton; Arnold, Bill Walter

    2014-01-01

    In this study, we use PFLOTRAN, a highly scalable, parallel, flow and reactive transport code to simulate the concentrations of 3H, 3He, CFC-11, CFC-12, CFC-113, SF6, 39Ar, 81Kr, 4He and themean groundwater age in heterogeneous fields on grids with an excess of 10 million nodes. We utilize this computational platform to simulate the concentration of multiple tracers in high-resolution, heterogeneous 2-D and 3-D domains, and calculate tracer-derived ages. Tracer-derived ages show systematic biases toward younger ages when the groundwater age distribution contains water older than the maximum tracer age. The deviation of the tracer-derived age distribution from the true groundwater age distribution increases with increasing heterogeneity of the system. However, the effect of heterogeneity is diminished as the mean travel time gets closer the tracer age limit. Age distributions in 3-D domains differ significantly from 2-D domains. 3D simulations show decreased mean age, and less variance in age distribution for identical heterogeneity statistics. High-performance computing allows for investigation of tracer and groundwater age systematics in high-resolution domains, providing a platform for understanding and utilizing environmental tracer and groundwater age information in heterogeneous 3-D systems. Groundwater environmental tracers can provide important constraints for the calibration of groundwater flow models. Direct simulation of environmental tracer concentrations in models has the additional advantage of avoiding assumptions associated with using calculated groundwater age values. This study quantifies model uncertainty reduction resulting from the addition of environmental tracer concentration data. The analysis uses a synthetic heterogeneous aquifer and the calibration of a flow and transport model using the pilot point method. Results indicate a significant reduction in the uncertainty in permeability with the addition of environmental tracer data, relative

  11. Environmentally Sound Processing Technology: JANNAF Safety and Environmental Protection Subcommittee and Propellant Development and Characterization Subcommittee Joint Workshop

    Science.gov (United States)

    Pickett, Lorri A. (Editor)

    1995-01-01

    Topics covered include: Risk assessment of hazardous materials, Automated systems for pollution prevention and hazardous materials elimination, Study design for the toxicity evaluation of ammonium perchlorate, Plasma sprayed bondable stainless surface coatings, Development of CFC-free cleaning processes, New fluorinated solvent alternatives to ozone depleting solvents, Cleaning with highly fluorinated liquids, Biotreatment of propyleneglycol nitrate by anoxic denitrification, Treatment of hazardous waste with white rot fungus, Hydrothermal oxidation as an environmentally benign treatment technology, Treatment of solid propellant manufacturing wastes by base hydrolysis, Design considerations for cleaning using supercritical fluid technology, and Centrifugal shear carbon dioxide cleaning.

  12. Isotope Method for Confined Groundwater Recharge of the Lower Reaches of the Heihe River, Inner Mongolia, China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Environmental isotopes have been applied to analyze confined groundwater recharge in the lower reaches of the Heihe River, Inner Mongolia. CFC is regarded as a tracer that determines the date of groundwater, the date being less than 45 a. The confined groundwater within the Gurinai area and Ejin Basin other than the surface water of Heihe River might have originated from precipitation from Qilian Mountain or/and the Tibetan Plateau. The deep confined groundwater overflows into an upper aquifer and emerges into the ground, forming springs and lakes within the low-lying area. The recharge volume is estimated to be around 400 million-cubic meters.

  13. Hats off to CERN's Master of Apprenticeships!

    CERN Multimedia

    2004-01-01

    Roland Gay of the HR Department (at right) recently received a special diploma from the Geneva Industrial Union (UIG). Presented by Carlo Lamprecht, Head of the Department of Economy, Employment and External Affairs of the State of Geneva, the diploma was awarded in recognition of the 199 CERN apprentices Roland has guided through the Certificat Fédéral de Capacité (CFC), an end-of-apprenticeship certificate awarded by the Cantonal authorities. Roland will be retiring in December 2004 after 37 years of service, 32 of which he spent in the role of apprenticeship supervisor.

  14. 预成型纺织材料用于纤维增强复合材料%Textile preforms with high level of pre-fabrication for fiber reinforced composites

    Institute of Scientific and Technical Information of China (English)

    H. Illing-Günther; R. Helbig; R. Arnold; H. Erth; P. Schiebel; H. Purol; A. S. Herrmann; 李丽敏

    2009-01-01

    研究了利用双针床多轴向经编技术编织生产可反复拉挤的玻璃纤维或碳纤维增强聚合物复合材料(GFC或CFC)的发展和制造状况,并基于优化的挤压成型工艺过程(MVI,挤压和牵拉技术),对这些预成型材料进行测试,对其用于复合材料的经济适用性进行了评估.

  15. Performance and Application of Model CWS Non-ODS Powder Sprayer%CWS型非ODS喷粉机性能与应用

    Institute of Scientific and Technical Information of China (English)

    朱响年; 王建民

    2004-01-01

    文章介绍了喷粉机在液晶显示器生产工艺中的重要作用、CWS型非ODS喷粉机性能与应用情况,实践证明:使用异丙醇做为分散剂的新型喷粉机替代使用CFC-113的喷粉机在技术上是成功的,并具有良好的经济效益,是淘汰ODS的最佳解决方案.

  16. Mariage des maillages: A new 3D general relativistic hydro code for simulation of gravitational waves from core-collapses.

    Science.gov (United States)

    Novak, Jerome; Dimmelmeier, Harrald; Font-Roda, Jose A.

    2004-12-01

    We present a new three-dimensional general relativistic hydrodynamics code which can be applied to study stellar core collapses and the resulting gravitational radiation. This code uses two different numerical techniques to solve partial differential equations arising in the model: high-resolution shock capturing (HRSC) schemes for the evolution of hydrodynamic quantities and spectral methods for the solution of Einstein equations. The equations are written and solved using spherical polar coordinates, best suited to stellar topology. Einstein equations are formulated within the 3+1 formalism and conformal flat condition (CFC) for the 3-metric and gravitational radiation is extracted using Newtonian quadrupole formulation.

  17. 怎样维修"HFC-134a"制冷剂冰箱

    Institute of Scientific and Technical Information of China (English)

    徐进华

    2003-01-01

    @@ 美国杜邦(DuPont)公司推出了HFC-I34a,即四氯乙烷,它仍属于卤代烃类,但不含氟和溴,所以ODP(Ozone Deplete Potentia即臭氧消耗潜值)为零.家用电冰箱发展到现在,主要采用的制冷剂有:R12(CFC-12)、R134a(HFC-134a)、HC-600a等.

  18. Desarrollo de un modelo matemático fenomenológico que permita simular el comportamiento de sistemas termoeléctricos

    OpenAIRE

    Múnera Cano, Andrés Felipe

    2012-01-01

    Resumen: El uso irracional y desmedido de la energía ha llevado al planteamiento de nuevas formas de generaciones energéticas, conocidas como tecnologías limpias. Uno de los retos actuales es la generación de frío de forma limpia debido a que los métodos más comunes son aquellos que utilizan la compresión de gases (CFC), que contribuyen a la contaminación ambiental y al creciente efecto invernadero. La ingeniería hace posible el desarrollo de máquinas de refrigeración que evitan...

  19. Influence of Tube‘s Diameter on Boling Heat Transfer Performance in Small Diameter Tubes

    Institute of Scientific and Technical Information of China (English)

    GanChengjun; WangWeicheng; 等

    1998-01-01

    This paper reports the experiments of evaporation study in 6 mm inner copper diameter tubes using HFC-134a,HCFC-22 and CFC-12 as working fluid.The results show that the evaporation heat transfer cofeeicient increasese with the decreasing of inner diameter of tubes,A new concept of nondimensional tube diameter U is proposed in this paper for correction of the influence of the tube diameter on the evaporation heat transfer coefficient.And further,a conveinent empirical correction method is preseted.

  20. Chemical and thermal stability of refrigerant-lubricant mixtures with metals

    Energy Technology Data Exchange (ETDEWEB)

    Huttenlocher, D.F.

    1992-10-09

    This report presents the results of a sealed tube stability study on twenty-one refrigerant-lubricant mixtures selected from the following groupings: HFCs R-32, R-125, R-134, R-134a, R-143a, and R-152a with one or more lubricants selected from among three pentaerythritol esters and three polyalkylene glycols. All lubricants were carefully predried to 25 ppm or less moisture content. HCFCs R-22, R-123, R-124, and R-142b, as well as CFC R-11, with one or more lubricants selected from among two mineral oils and one alkylbenzene fluid. Bach test mixture was aged at three temperature levels.

  1. Chemical and thermal stability of refrigerant-lubricant mixtures with metals. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Huttenlocher, D.F.

    1992-10-09

    This report presents the results of a sealed tube stability study on twenty-one refrigerant-lubricant mixtures selected from the following groupings: HFCs R-32, R-125, R-134, R-134a, R-143a, and R-152a with one or more lubricants selected from among three pentaerythritol esters and three polyalkylene glycols. All lubricants were carefully predried to 25 ppm or less moisture content. HCFCs R-22, R-123, R-124, and R-142b, as well as CFC R-11, with one or more lubricants selected from among two mineral oils and one alkylbenzene fluid. Bach test mixture was aged at three temperature levels.

  2. Drug diffusion and biological responses of arteries using a drug-eluting stent with nonuniform coating

    Directory of Open Access Journals (Sweden)

    Saito N

    2016-03-01

    Full Text Available Noboru Saito, Yuhei Mori, Sayaka Uchiyama Terumo Corporation R&D Center, Inokuchi, Nakai-machi, Ashigarakami-gun, Kanagawa, Japan Abstract: The purpose of this study was to determine the effect of a nonuniform coating, abluminal-gradient coating (AGC, which leaves the abluminal surface of the curves and links parts of the stent free from the drug coating, on the diffusion direction of the drug and the biological responses of the artery to drug-eluting stent (DES by comparing the AGC-sirolimus stent and the conventional full-surface coating (CFC sirolimus stent. The study aimed to verify whether the AGC approach was appropriate for the development of a safer DES, minimizing the risks of stent thrombosis due to delayed endothelialization by the drug and distal embolization due to cracking of the coating layer on the hinge parts of the DES on stent expansion. In the in vitro local drug diffusion study, we used rhodamine B as a model drug, and rhodamine B released from the AGC stent diffused predominantly into the abluminal side of the alginate artery model. Conversely, rhodamine B released from the CFC stent quickly spread to the luminal side of the artery model, where endothelial cell regeneration is required. In the biological responses study, the luminal surface of the iliac artery implanted with the AGC-sirolimus stent in a rabbit iliac artery for 2 weeks was completely covered with endothelial-like cells. On the other hand, the luminal surface of the iliac artery implanted with the CFC-sirolimus stent for 2 weeks only showed partial coverage with endothelial-like cells. While thrombosis was observed in two of the three CFC-sirolimus stents, it was observed in only one of the three AGC-sirolimus stents. Taken together, these findings indicate that the designed nonuniform coating (AGC is an appropriate approach to ensure a safer DES. However, the number of studies is limited and a larger study should be conducted to reach a statistically

  3. Transport, mixing and ozone loss in the 2010 Arctic vortex region from in-situ tracer observations during RECONCILE

    Science.gov (United States)

    Hösen, E.; Volk, C. M.; vom Scheidt, M.; Wintel, J.; Ulanovsky, A.; Ravegnani, F.; Grooß, J. U.; Günther, G.; Walker, K. A.

    2012-04-01

    The 2009/2010 Arctic stratospheric vortex was dynamically very active, splitting and reforming twice, first in mid December and then again in mid February. We use in-situ measurements of tracers and ozone both in- and outside the Arctic vortex during the 2010 RECONCILE campaign to investigate isentropic transport and irreversible mixing in the vortex region and to assess chemical ozone loss. N2O and CFC-11, along with CO2, CFC-12, H-1211, CH4, SF6 and H2 were simultanously measured by the High Altitude Gas Analyser (HAGAR) during 13 Geophysica flights between mid January and mid March. Ozone was measured onboard the M55 Geophysica aircraft by the Fast Ozone Analyser (FOZAN). Early winter reference profiles for a number of tracers are provided by the satellite instrument ACE-FTS. We derive an empirical "vortex index" from the observed isentropic distribution of N2O as an altitude-independent tracer of origin with respect to the vortex. This index is used to identify the origin of the observed air masses and to diagnose recent transport of air between distinct regions. Irreversible mixing of air masses, typically following such transport, is diagnosed from the evolution of the CFC-11/N2O correlation. Simulations with the Chemical Lagrangian Model of the Stratosphere (CLaMS) are used for comparison and to better understand the meteorological context of the observed transport and mixing. Intrusions of extra-vortex air into the vortex are evident already during January, however much stronger effects are observed after the vortex split in late February and its reformation in early March. The N2O-derived "vortex index" suggests strong transport of subtropical air into the polar region above 470 K and a corresponding shift of the CFC-11/N2O correlation indicates that this air has already mixed irreversibly with high-latitude air. A further partial shift of the correlation is evidence for irreversible mixing of mid-latitude air inside the newly formed vortex. The CLa

  4. Design method for heat exchanger of stirling cycle machines; Sutaringu saikuru kikan ni okeru netsu kokanki no sekkei shuho

    Energy Technology Data Exchange (ETDEWEB)

    Sekiya, H. [Sanyo Electric Co., Ltd., Tokyo (Japan)

    1999-11-10

    Recently, the Stirling cycle organization attracts the attention as 1 of the countermeasure to the global environmental problem, and the tendency of various application equipment developments heightens. The main factor is in constructing CFC elimination refrigeration air conditioner, and the development example as an engine for power source of refrigerating machine used in the ultra-low-temperature region and equipment variously is reported. In this paper, practical design tool and design examination case are introduced, while design technique of heat exchanger, which is the most important in design development of these, ST refrigerating machine and ST engines is described. (NEDO)

  5. Avaliação do comportamento experimental do sistema de refrigeração de um tunel de congelamento com R-502 e R-408A

    OpenAIRE

    Flavio Vasconcelos da Silva

    1998-01-01

    Resumo: Com a implantação das restrições adotadas a partir do Protocolo de Montreal, torna-se importante a avaliação experimental do desempenho de novos fluidos refrigerantes. O R-502 (mistura azeotrópica HCFC-22 / CFC-115; 48,8% / 51,2%) é extensivamente utilizado como fluido refrigerante em equipamentos de refrigeração a baixas temperaturas. Já o R-408A (mistura quase azeotrópica composta de HCFC-22 / HFC-125 / HFC-143a; 47% / 7% / 46%) pode apresentar vantagens como substituto do R-502 em ...

  6. Influence of tube's diameter on boiling heat transfer performance in small diameter tubes

    Science.gov (United States)

    Gan, Chengjun; Wang, Weicheng; Zhang, Lining

    1998-03-01

    This paper reports the experiments of evaporation study in 6 mm inner copper diameter tubes using HFC-134a, HCFC-22 and CFC-12 as working fluid. The results show that the evaporation heat transfer coefficient increases with the decreasing of inner diameter of tubes. A new concept of non-dimensional tube diameter U is proposed in this paper for correction of the influence of the tube diameter on the evaporation heat transfer coefficient. And further, a convenient empirical correction method is presented.

  7. Individual phases of contextual fear conditioning differentially modulate dorsal and ventral hippocampal GluA1-3, GluN1-containing receptor complexes and subunits.

    Science.gov (United States)

    Sase, Sunetra; Sase, Ajinkya; Sialana, Fernando J; Gröger, Marion; Bennett, Keiryn L; Stork, Oliver; Lubec, Gert; Li, Lin

    2015-12-01

    In contextual fear conditioning (CFC), the use of pharmacological and lesion approaches has helped to understand that there are differential roles for the dorsal hippocampus (DH) and the ventral hippocampus (VH) in the acquisition, consolidation and retrieval phases. Concomitant analysis of the DH and the VH in individual phases with respect to α-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptors and N-methyl-D-aspartate receptor subtype N1 (GluN1)-containing complexes (RCC) and subunits has not been reported so far. Herein, CFC was performed in mice that were euthanized at different time points. DH and VH samples were taken for the determination of RCC and subunit levels using BN- and SDS-PAGE, respectively, with subsequent Western blotting. Evaluation of spine densities, morphology, and immunohistochemistry of GluA1 and GluA2 was performed. In the acquisition phase levels of GluA1-RCC and subunits in VH were increased. In the consolidation phase GluA1- and GluA2-RCC levels were increased in DH and VH, while both receptor subunit levels were increased in the VH only. In the retrieval phase GluA1-RCC, subunits thereof and GluA2-RCC were increased in DH and VH, whereas GluA2 subunits were increased in the VH only. GluN1-RCC levels were increased in acquisition and consolidation phase, while subunit levels in the acquisition phase were increased only in the DH. The immunohistochemical studies in the individual phases in subareas of hippocampus supported immunochemical changes of GluA1 and GluA2 RCC's. Dendritic spine densities and the prevalence of thin spines in the acquisition phase of VH and mushroom spines in the retrieval phase of the VH and DH were increased. The findings from the current study suggest different receptor and receptor complex patterns in the individual phases in CFC and in DH and VH. The results propose that different RCCs are formed in the individual phases and that VH and DH may be involved in CFC.

  8. The president speaks: prevention is best: lessons from protecting the ozone layer.

    Science.gov (United States)

    Woodcock, Ashley

    2012-12-01

    The Montreal Protocol was signed 25 years ago. As a result, the irreversible destruction of the ozone layer was prevented. However, stratospheric ozone will not recover completely until 2060 and the consequent epidemic in skin cancer cases will persist until 2100. Many millions of patients with asthma and chronic obstructive pulmonary disease have safely switched from chlorofluorocarbon (CFC)-powered metered-dose inhalers (MDIs) to either hydrofluorocarbon (HFC) or DPIs. China will be the last country to phase out CFCs by 2016. HFCs are global warming gases which will be controlled in the near future. HFCs in MDIs may be phased out over the next 10-20 years.

  9. 汽车空调制冷剂回收与再生方法%Principle and Ways for Recycling and Regeneration of the Automotive Air Conditioning Refrigerant

    Institute of Scientific and Technical Information of China (English)

    王启祥; 郑就

    2009-01-01

    本文阐述了汽车空调CFCs-12制冷剂回收与再生的工艺流程、设备装置和操作方法,提出了减少制冷剂排放和保护臭氧层的建议.%This paper introduces the mechanism of the CFC-12 refrigerant to ozone layer destruction.It elaborates the refrigerant recycling and the technical process of regeneration,equipment installment and operating procedure,and puts forward the suggestion of reduced refrigerant emissions and the protection of ozone layer.

  10. Obtención y caracterización de nuevos cementos óseos de fosfatos de calcio en el sistema CaHPO4--- -Ca3 (PO4)2

    OpenAIRE

    Fernández Aguado, Enrique

    1996-01-01

    La presente Tesis Doctoral se titula "Obtención y caracterización de nuevos cementos óseos de fosfatos de calcio en el sistema DCP―alfa-TCP". Los cementos de fosfatos de calcio (CFC) son materiales biocompatibles que tienen la propiedad de endurecer en condiciones fisiológicas formando una estructura porosa de cristales interconectados de hidroxiapatita, i.e. la fase mineral de los tejidos óseos. Estos materiales pueden ser diseñados para que sean inyectables y tengan distintos porcenta...

  11. Development of a transcritical two-stage supermarket refrigerator for deep freezing and normal chilling (2); Entwicklung einer transkritischen zweistufigen Supermarktkaelteanlage fuer Tief- und Normalkuehlung (2)

    Energy Technology Data Exchange (ETDEWEB)

    Gebhardt, D.; Kruse, H. [FKW, Hannover (Germany); Schiesaro, P. [Arneg S.p.a., Campo S.Martinoa (Italy)

    2003-10-01

    Investigations (Schiesaro und Kruse 1999; TEWI-3 AFEAS/DOE 1997) showed that centralized supermarket systems with H-CFC refrigerations cannot be a solution for the future unless measures are taken to reduce leakages and gaseous emissions of such fluids. (orig.) [German] Aufgrund einer frueheren Studie (Schiesaro und Kruse 1999) ueber zukuenftige Supermarktsysteme unter Beruecksichtigung der umwelttechnischen Anforderungen, die auf den TEWI-3 AFEAS/DOE Resultaten (1997) basierte, wurde festgestellt, dass zentrale Supermarktsysteme mit H-FKW Kaeltemitteln nicht die Loesung fuer die Zukunft sein koennen, wenn nicht spezielle Massnahmen getroffen werden, um die Leckage zum Zweck der Begrenzung von direkten Treibhausgasemissionen dieser Fluide zu verringern. (orig.)

  12. Role of mesoscale eddies in the global ocean uptake of anthropogenic CO{sub 2}; Role des tourbillons de meso-echelle oceaniques dans la distribution et les flux air-mer de CO{sub 2} anthropique a l'echelle globale

    Energy Technology Data Exchange (ETDEWEB)

    Zouhair, Lachkar

    2007-02-15

    Mesoscale eddies play a fundamental role in ocean dynamics particularly in the Southern Ocean. Global-scale tracer simulations are typically made at coarse resolution without explicitly modeling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of anthropogenic CO{sub 2}, CFC-11 and bomb {delta}{sup 14}C. We made global anthropogenic transient tracer simulations in coarse-resolution, ORCA2, and eddy-permitting, ORCA05 and ORCA025, versions of the ocean modelling system NEMO. We focus on the Southern Ocean where tracer air-sea fluxes are largest. Eddies have little effect on bomb {delta}{sup 14}C uptake and storage. Yet for CFC-11 and anthropogenic CO{sub 2}, increased eddy activity reduces southern extra-tropical uptake by 28% and 25% respectively, thereby providing better agreement with observations. It is shown that the discrepancies in the equilibration times between the three tracers determine their respective sensitivities to the model horizontal resolution. Applying Gent and McWilliams (1990) (GM) parameterization of eddies in the non-eddying version of the model does improve results, but not enough. An in-depth investigation of the mechanisms by which eddies affect the uptake of the transient tracers shows that including mesoscale eddies leads to an overall reduction in the Antarctic Intermediate Water (AAIW) ventilation, and modifies substantially the spatial distribution of their source regions. This investigation reveals also that the GM parameterization still overestimates the ventilation and the subduction of AAIW in the Indian Ocean where the simulated mixed layer is particularly deep during the winter. This work suggests that most current coarse-resolution models may overestimate the ventilation of AAIW in the Indian sector of the Southern Ocean. This study shows also that the use of the GM parameterization may be of limited utility where mixed layer is relatively deep and confirms the general need for a

  13. Research Progress on Cryptic Female Choice of Insects%昆虫隐性雌性选择的研究进展

    Institute of Scientific and Technical Information of China (English)

    戴仁怀

    2010-01-01

    隐性雌性选择(CFC)作为配后性选择,是近年来引起生物学家重视的新领域.隐性雌性选择自提出以来就一直引起广泛争议.介绍了隐性雌性选择的定义、检验以及隐性雌性选择的可能机制;并就隐性雌性选择研究需要深入的问题进行了讨论.

  14. 戊烷发泡体系在冰箱聚氨酯泡沫中的应用%Application of Pentane Foaming System in Polyurethane Foam of the Refrigerators

    Institute of Scientific and Technical Information of China (English)

    商玉香; 房公彬

    2004-01-01

    概述了冰箱用聚氨酯泡沫发泡剂CFC-11的主要替代路线,重点论述了纯环戊烷、环戊烷-异戊烷和正戊烷-异戊烷等3种戊烷发泡体系的泡沫体物性和工艺特点,同时对3种戊烷发泡技术进行了综合比较.

  15. Investigations on a Thermoacoustic Refrigerator

    CERN Document Server

    Dhuley, Ram C

    2016-01-01

    Thermoacoustic Refrigerators use acoustic power for generating cold temperatures. Development of refrigerators based on the thermoacoustic technology is a novel solution to the present day need of cooling, without causing environmental hazards. With added advantages such as minimal moving parts and absence of CFC refrigerants, these devices can attain low temperatures maintaining a compact size. The present work describes an in-depth theoretical analysis of standing wave thermoacoustic refrigerators. This consists of detailed parametric studies, transient state analysis, and a design using an available simulation software. Design and construction of a thermoacoustic refrigerator using a commercially available electro-dynamic motor is also presented.

  16. Infrared absorption cross section, radiative forcing, and GWP of four hydrofluoro(poly)ethers

    Science.gov (United States)

    Myhre, G.; Nielsen, C. J.; Powell, D. L.; Stordal, F.

    Quantitative infrared cross-sections of the unbranched hydrofluoro(poly)ethers CHF 2OCHF 2, CHF 2OCF 2OCHF 2 and CHF 2OCF 2CF 2OCHF 2 have been obtained at 298 K in the region 25-4000 cm -1. Radiative forcing calculations have been performed for these compounds and for CHF 2OCF 2OCF 2CF 2OCHF 2, and the values found per molecule are high compared to those of other CFCs and CFC replacements. Atmospheric lifetimes, calculated on the basis of experimental reaction rates with OH radicals, and global warming potentials are presented for all four compounds.

  17. Refrigerating fluids. Options. A manufacturer selects three HFC fluids; Fluides Frigorigenes. Options. Un fabricant retient trois fluides HFC

    Energy Technology Data Exchange (ETDEWEB)

    Haentjens, H.

    1999-12-01

    Because of the scheduled replacement of CFC and HCFC fluids in refrigerating systems, the Carrier company, number one in the manufacturing of air conditioning systems, has retained 3 hydro-fluorocarbon refrigerants: R 134a, R 407C and R 410A. Each fluid has different thermodynamical properties and is specifically used for a given range of powers: above 300 kW for R 134a, between 15 and 300 kW for R 407C and below 15 kW for R 410A. The choices made by other manufacturers are given as a comparison. (J.S.)

  18. Hydrogen-plasticity interactions in austenitic alloys; Interactions hydrogene-plasticite dans les alliages austenitiques

    Energy Technology Data Exchange (ETDEWEB)

    Delafosse, D.; Girardin, G. [Ecole Nationale Superieure des Mines de Saint-Etienne, Centre SMS, PECM-CNRS, 42 - Saint-Etienne (France)

    2007-07-01

    The aim of this work is to validate and to experimentally characterize the potential and limits of an approach based on an elastic theory of crystal defects. At first, is macroscopically characterized the dynamic interactions of hydrogen-dislocations by aging tests. Then, the hydrogen influence on plasticity mechanisms is estimated while being supported by classical analytical models of the elastic theory of dislocations. At last, is experimentally analyzed the hydrogen influence on the gliding stress of CFC materials with model materials. (O.M.)

  19. Performance of the AMS-02 Transition Radiation Detector

    CERN Document Server

    Doetinchem, P; Karpinski, W; Kirn, T; Lübelsmeyer, K; Orboeck, J; Schael, S; Schultz von Dratzig, A; Schwering, G; Siedenburg, T; Siedling, R; Wallraff, W; Becker, U; Bürger, J; Henning, R; Kounine, A; Koutsenko, V F; Wyatt, J

    2006-01-01

    For cosmic particle spectroscopy on the International Space Station the AMS experiment will be equipped with a Transition Radiation Detector (TRD) to improve particle identification. The TRD has 20 layers of fleece radiator with Xe/CO2 proportional mode straw tube chambers. They are supported in a conically shaped octagon structure made of CFC-Al-honeycomb. For low power consumption VA analog multiplexers are used as front-end readout. A 20 layer prototype built from final design components has achieved proton rejections from 100 to 2000 at 90% electron efficiency for proton beam energies up to 250 GeV with cluster counting, likelihood and neural net selection algorithms.

  20. Diffusive transport and evaporation to the atmosphere from a NAPL source in the vadose zone

    DEFF Research Database (Denmark)

    Holtegaard, L.E.; Bjerre, T.; Christophersen, Mette;

    2002-01-01

    To evaluate the risks concerned with the presence of volatile organic compounds in the unsaturated zone it is important to know how the compounds are transported in the soil. In this project the effective diffusion coefficient of 3-methylpentane, hexane, methyl-cyclopentane, iso-octane and methyl......-cyclo-hexane has been measured in-situ using a diffusive tracer test (DTT). Furthermore the flux from a NAPL source has been measured in flux chambers. From these results the effective diffusion coefficient has been calculated for CFC113, methyl-cyclo-pentane, benzene, iso-octane, and methyl...

  1. System design and analysis of the trans-critical carbon-dioxide automotive air-conditioning system

    Institute of Scientific and Technical Information of China (English)

    穆景阳; 陈江平; 陈芝久

    2003-01-01

    As an environmentally harmless and feasible alternate refrigerant, CO2 has attracted worldwide attention, especially in the area of automobile air-conditioning (AAC). The thermal property of CO2 and its trans-critical refrigeration cycle is very different from that of the traditional CFC or HCFC system. The detailed process of CO2 system thermal cycle design and optimization is described in this paper. System prototype and performance test bench were developed to analyze the performance of the CO2 AAC system.

  2. System design and analysis of the trans-critical carbon-dioxide automotive air-conditioning system

    Institute of Scientific and Technical Information of China (English)

    穆景阳; 陈江平; 陈芝久

    2003-01-01

    As an environmentally harmless and feasible alternate refrigerant, CO2 has attracted worldwide attention, especially in the area of automobile air-conditioning (AAC). The thermal property of CO2 and its trans-eritical refrigeration cycle is very different from that of the traditional CFC or HCFC system. The detailed process of CO2 system thermal cycle design and optimization is described in this paper. System prototype and performance test bench were developed to analyze the performance of the CO2 AAC system.

  3. PROPOSTA FORMATIVA VERSUS DESEMPENHO: UM ESTUDO COMPARATIVO ENTRE OS CURSOS DE GRADUAÇÃO EM CIÊNCIAS CONTÁBEIS DAS IFES BRASILEIRAS

    Directory of Open Access Journals (Sweden)

    Emanuela Cristine Oliveira Silva

    2014-12-01

    Full Text Available O presente estudo objetiva analisar qual a relação entre o nível de aderência das propostas formativas, dos cursos de graduação em Ciências Contábeis (presencial das IFES, e o desempenho dos discentes no ENADE. O recorte institucional observou as informações disponibilizadas no Portal do e-MEC, em termos de tipo de instituição, modalidade de curso, conceitos obtidos e carga-horária, bem como a divulgação do PPC no Portal de cada universidade, o que resultou em 31 IFES. O processo de coleta observou a análise dos PPC’s, quanto ao nível de aderência às propostas formativas do MEC (19 itens, CFC (50 itens e ONU (24 itens, considerando a presença (1 e ausência (0 de informação. Os indicadores referentes aos conceitos dos cursos e das IFES, bem como a carga-horária e aderência às propostas foram organizados e empilhados para a análise emcross section/em, com o auxílio do emGretl®/em. Os dados apontam que as IFES atendem pelo menos 60% da proposta do CFC e 63,16% da proposta do MEC. A UFU é à única instituição que atendeu a 100% a proposta do MEC e a UFMT – Cuiabá é a que menos adere às propostas formativas. No que diz respeito à carga-horária, destaca-se que a UFMT – Rondonópolis é a IFES que possui maior carga-horária total, com 3.500 horas, atendendo prioritariamente as propostas do MEC (84% e do CFC (80%. Quanto aos conceitos recebidos pelo curso, a UFSC e a UFRGS são as únicas analisadas, que detém conceito 5 no ENADE, IGC e CPC. Outro ponto que chamou a atenção é que quatro instituições não seguem a indicação do CNE/CSE quanto à carga-horária, a UNIR, a UFES, a UFCG e a UFPB. Além disso, o estudo aponta que o desempenho do ENADE é explicado mais pela aderência a proposta formativa do CFC, do que as demais propostas e a carga-horária.

  4. Stratospheric cooling and polar ozone loss due to H2 emissions of a global hydrogen economy

    Science.gov (United States)

    Feck, T.; Grooß, J.-U.; Riese, M.; Vogel, B.

    2009-04-01

    "Green" hydrogen is seen as a major element of the future energy supply to reduce greenhouse gas emissions substantially. However, due to the possible interactions of hydrogen (H2) with other atmospheric constituents there is a need to analyse the implications of additional atmospheric H2 that could result from hydrogen leakage of a global hydrogen infrastructure. Emissions of molecular H2 can occur along the whole hydrogen process chain which increase the tropospheric H2 burden. Across the tropical tropopause H2 reaches the stratosphere where it is oxidised and forms water vapour (H2O). This causes increased IR-emissions into space and hence a cooling of the stratosphere. Both effects, the increase of stratospheric H2O and the cooling, enhances the potential of chlorine activation on liquid sulfate aerosol and polar stratospheric clouds (PSCs), which increase polar ozone destruction. Hence a global hydrogen economy could provoke polar ozone loss and could lead to a substantial delay of the current projected recovery of the stratospheric ozone layer. Our investigations show that even if 90% of the current global fossil primary energy input could be replaced by hydrogen and approximately 9.5% of the product gas would leak to the atmosphere, the ozone loss would be increased between 15 to 26 Dobson Units (DU) if the stratospheric CFC loading would retain unchanged. A consistency check of the used approximation methods with the Chemical Lagrangian Model of the Stratosphere (CLaMS) shows that this additional ozone loss can probably be treated as an upper limit. Towards more realistic future H2 leakage rate assumptions (< 3%) the additional ozone loss would be rather small (? 10 DU). However, in all cases the full damage would only occur if stratospheric CFC-levels would retain unchanged. Due to the CFC-prohibition as a result of the Montreal Protocol the forecasts suggest a decline of the stratospheric CFC loading about 50% until 2050. In this case our calculations

  5. NSFR Seminar 2014 – National Report for Sweden

    Directory of Open Access Journals (Sweden)

    Kleist David

    2014-11-01

    Full Text Available This article aims to give an overview of the rules concerning taxation of companies in Sweden and of trends in the taxation of companies that have been evident in the last few years. It focuses in particular on issues that are connected with the so-called BEPS discussion, for instance interest deduction limitations, CFC rules, general anti-avoidance rules and other rules intended to protect the national tax base. It also sets out to describe other important features of the Swedish tax legislation in regard to companies, such as the rules on taxation of inbound and outbound dividends, interest and royalty.

  6. Spatial distribution of seepage at a flow-through lake: Lake Hampen, Western Denmark

    DEFF Research Database (Denmark)

    Kidmose, Jacob Baarstrøm; Engesgaard, Peter Knudegaard; Nilsson, Bertel;

    2011-01-01

    The spatial distribution of seepage at a flow-through lake in western Denmark was investigated at multiple scales with integrated use of a seepage meter, lake–groundwater gradients, stable isotope fractionation (d18O), chlorofl uorocarbon (CFC) apparent ages, land-based and off -shore geophysical...... that corroborates the interpretation of lake water recharging off shore and moving down gradient. Inclusion of lake bed heterogeneity in the model improved the comparison of simulated and observed discharge to the lake. The apparent age of the discharging groundwater to the lake was determined by CFCs, resulting...

  7. Cogeneration and beyond: The need and opportunity for high efficiency, renewable community energy systems

    Energy Technology Data Exchange (ETDEWEB)

    Gleason, T.C.J.

    1992-06-01

    The justification, strategies, and technology options for implementing advanced district heating and cooling systems in the United States are presented. The need for such systems is discussed in terms of global warming, ozone depletion, and the need for a sustainable energy policy. Strategies for implementation are presented in the context of the Public Utilities Regulatory Policies Act and proposed new institutional arrangements. Technology opportunities are highlighted in the areas of advanced block-scale cogeneration, CFC-free chiller technologies, and renewable sources of heating and cooling that are particularly applicable to district systems.

  8. Non-Thermal Removal of Gaseous Pollutants

    Science.gov (United States)

    Srivastava, S.; McGowan, J. William; Chiu, K. C. Ray

    1995-01-01

    The removal of fluorine based exhaust gases such as CFC's, PFC's, NF3, and SF6 used for plasma etching of and deposition on semi-conductors is a subject of increasing interest because of safety, air pollution, and global warming issues. Conventional treatment methods for removing exhaust gas pollutants are wet scrubbing, carbon and resin adsorption, catalytic oxidation, and thermal incineration. However, there are drawbacks associated with each of these methods which include difficulties in implementation, problems with the disposal of solid and liquid pollutant waste, large water and fuel consumption, and additional pollutants such as NOx emissions which are generated in thermal incineration processes.

  9. Evaluation of Parameter Uncertainty Reduction in Groundwater Flow Modeling Using Multiple Environmental Tracers

    Science.gov (United States)

    Arnold, B. W.; Gardner, P.

    2013-12-01

    Calibration of groundwater flow models for the purpose of evaluating flow and aquifer heterogeneity typically uses observations of hydraulic head in wells and appropriate boundary conditions. Environmental tracers have a wide variety of decay rates and input signals in recharge, resulting in a potentially broad source of additional information to constrain flow rates and heterogeneity. A numerical study was conducted to evaluate the reduction in uncertainty during model calibration using observations of various environmental tracers and combinations of tracers. A synthetic data set was constructed by simulating steady groundwater flow and transient tracer transport in a high-resolution, 2-D aquifer with heterogeneous permeability and porosity using the PFLOTRAN software code. Data on pressure and tracer concentration were extracted at well locations and then used as observations for automated calibration of a flow and transport model using the pilot point method and the PEST code. Optimization runs were performed to estimate parameter values of permeability at 30 pilot points in the model domain for cases using 42 observations of: 1) pressure, 2) pressure and CFC11 concentrations, 3) pressure and Ar-39 concentrations, and 4) pressure, CFC11, Ar-39, tritium, and He-3 concentrations. Results show significantly lower uncertainty, as indicated by the 95% linear confidence intervals, in permeability values at the pilot points for cases including observations of environmental tracer concentrations. The average linear uncertainty range for permeability at the pilot points using pressure observations alone is 4.6 orders of magnitude, using pressure and CFC11 concentrations is 1.6 orders of magnitude, using pressure and Ar-39 concentrations is 0.9 order of magnitude, and using pressure, CFC11, Ar-39, tritium, and He-3 concentrations is 1.0 order of magnitude. Data on Ar-39 concentrations result in the greatest parameter uncertainty reduction because its half-life of 269

  10. Assessment of Halon-1301 as a groundwater age tracer

    Directory of Open Access Journals (Sweden)

    M. Beyer

    2015-01-01

    Full Text Available Groundwater dating is an important tool to assess groundwater resources in regards to their dynamics, i.e. direction and time scale of groundwater flow and recharge, to assess contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However, ambiguous age interpretations are often faced, due to a limited set of available tracers and their individual restricted application ranges. For more robust groundwater dating multiple tracers need to be applied complementarily and it is vital that additional, groundwater age tracers are found to ensure robust groundwater dating in future. We recently suggested that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate, but its behaviour in water and suitability as a groundwater age tracer had not yet been assessed in detail. In this study, we determine Halon-1301 and infer age information in 17 New Zealand groundwaters and various modern (river water samples. The samples are simultaneously analysed for Halon-1301 and SF6, which allows identification of issues such as contamination of the water with modern air during sampling. Water at all analysed groundwater sites have also been previously dated with tritium, CFC-12, CFC-11 and SF6, and exhibit mean residence times ranging from modern (close to 0 years to over 100 years. The investigated groundwater ranged from oxic to highly anoxic, and some showed evidence of CFC contamination or degradation. This allowed us to make a first attempt of assessing the conservativeness of Halon-1301 in water, in terms of presence of local sources and its sensitivity towards degradation etc., which could affect the suitability of Halon-1301 as groundwater age tracer. Overall we found Halon-1301 reliably inferred the mean residence time of groundwater recharged between 1980 and 2014. Where direct age comparison

  11. Confocal microscopy: A new tool for erosion measurements on large scale plasma facing components in tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Gauthier, E., E-mail: eric.gauthier@cea.fr [CEA/DSM/IRFM, CEA Cadarache, Saint-Paul-lez-Durance (France); Brosset, C.; Roche, H.; Tsitrone, E.; Pégourié, B.; Martinez, A. [CEA/DSM/IRFM, CEA Cadarache, Saint-Paul-lez-Durance (France); Languille, P. [PIIM, CNRS-Université de Provence, Centre de St Jérôme, 13397 Marseille, Cedex 20 (France); Courtois, X.; Lallier, Y. [CEA/DSM/IRFM, CEA Cadarache, Saint-Paul-lez-Durance (France); Salami, M. [AVANTIS CONCEPT, 75 Rue Marcelin Berthelot, 13858 Aix en Provence (France)

    2013-07-15

    A diagnostic based on confocal microscopy was developed at CEA Cadarache in order to measure erosion on large plasma facing components during shutdown in situ in Tore Supra. This paper describes the diagnostic and presents results obtained on Beryllium and Carbon Fibre Composite (CFC) materials. Erosion in the range of 800 μm was found on one sector of the Toroidal Pumped Limiter (TPL) which provides, by integration to the full limiter a net carbon erosion of about 900 g over the period 2002–2007.

  12. 应力腐蚀

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    STRESS CORROSION CRACKING OF 304L STAINLESS STEEL IN SODIUM SULFIDE-CONTAINING CAUSTIC SOLUTIONS,STRESS CORROSION CRACKING OF H.C.P.METALS AND ALLOYS IN IODINE-METHANOL SOLUTIONS,STRESS CORROSION CRACKING (SCC) AND CORROSION FATIGUE CRACKING (CFC) OF A DUPLEX STAINLESS STEEL IN WHITE WATER ENVIRONMENTS,EFFECT OF PROTECTIVE COATINGS ON THE STRESS CORROSION CRACKING OF API 5L-X52 LOW CARBON STEEL IN SOIL AND NS4 SOLUTIONS,CORROSION FATIGUE AND NEAR-NEUTRAL pH STRESS CORROSION CRACKING OF PIPELINE STEEL IN VERY DILUTE CARBONATE/BICARBONATE WITH AND WITHOUT THE PRESENCE OF HYDROGEN SULFIDE USING THE COMPLIANCE TECHNIQUE.

  13. Evaluation of the greenhouse effect. Climate changes: from models to negotiations; Le point sur l`effet de serre. Changement de climat: des modeles aux negociations

    Energy Technology Data Exchange (ETDEWEB)

    Cointe, R. [Ministere de l`Environnement, 75 - Paris (France). Mission interministerielle de l`effet de serre

    1997-01-01

    This paper takes stock of scientific works and negotiations in progress about climatic changes linked with greenhouse effect. The scientists opinion about the noxiousness of greenhouse gases (CO{sub 2}, CH{sub 4}, N{sub 2}O, tropospheric O{sub 3}, CFC and their substitutes) inducing climate warming (0,5 deg. C as an average during the 20. Century) is reported. The forecasting about the evolution and organisation of the international effort (United Nations Climate Convention, Berlin`s Commission), and the French contribution on this topic is analyzed. (N.K.).

  14. Sumitomo Electric Technical Review, No. 40, June 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-06-01

    ;Partial Contents: Development of Optical Switching Equipment for Japan Telecom; Erbium-Doped Fiber Amplifier for Analog Transmission of FTTH; Development of an Optical Amplifier for Japan Telecom; Development of an InGaAs-PIN-Photodiode Module for Fiber-Optic CATV; Bending Induced Polarization Mode Dispersion with Random Mode Coupling; Development of SUMINET-3500M Series; Study on Deterioration Mechanism of XLPE Cables (Part 1); Evaluating an Alternative Refrigerant Magnet Wire for Compliance with CFC Restrictions; High Emissivity AIN/W with Gradient Structure; Japanese OCR Software Package OKREADER; New products and Techniques.

  15. Effects of Humic Acid and Solution pH on Dispersion of Na—and Ca—Soil Clays

    Institute of Scientific and Technical Information of China (English)

    LANYEQING; HUQIONGYING; 等

    1996-01-01

    Dispersed soil clays have a negative impact on soil structure and contribute to soil erosion and contaminant movement.In this study,two typical soils from the south of China were chosen for investigating roles of pH and humic acid(HA) on dispersion of soil clays.Critical flocculation concentration (CFC) of the soil clay suspension was determined by using light transmission at a wavelength of 600 nm.The results indicated that effects of pH and HA on dispersion of the soil clays were closely related to the type of the major minerals makin up the soil and to the valence of the exchangeable cations as well.At four rates of pH(4,6,8and 10),the CFC for the Na-yellow-brown soil treated with H2O2 was increased from 0.32 to 0.56,6.0 to 14.0,10.0 to 24.6 and 26.0 to 52.0mmol L-1 NaCl,respectively when Na-HA was added at the rate of from 0 to 40mgL-1,With the same Na-HA addition and three pH(6,8and 10)treatments,the CFC for the Na-red soil was incresed from 0.5 to 20.0,1.0 to 40.0 and 6.0 to 141.0mmol L-1 NaCl,respectively.Obviously,pH and HA has greater effects on clay dispersion of the red soil(dominated by 1:1 minerals and oxides) than on that of the yellow-brown soil(dominated by 2:1minerals).However,at three rates of pH(6,8and 10) and with the addition of Ca-HA from 0 to 40mg L-1,the CFC of the Ca-yellow-brown soil and Ca-red soil treated with H2O2 was increased from 0.55 to 0.81,0.75 to 1.28,0.55 to 1.45and 0.038 to 0.266.0.25 to 0.62,0.7to 1.6mmol CaCl2 L-1,respectively.So,Na-soil claye are more sensitive to pH and HA than Ca-soil clays.

  16. Laser lock-in thermography for thermal contact characterisation of surface layer

    Energy Technology Data Exchange (ETDEWEB)

    Semerok, A., E-mail: alexandre.semerok@cea.fr [CEA, DEN, DPC/SEARS/LISL, F-91191, Gif-sur-Yvette (France); Jaubert, F.; Fomichev, S.V.; Thro, P.-Y. [CEA, DEN, DPC/SEARS/LISL, F-91191, Gif-sur-Yvette (France); Courtois, X.; Grisolia, C. [CEA, IRFM, F-13108, Saint-Paul-lez-Durance (France)

    2012-11-21

    Lock-in thermography was applied to determine the thermal contact conductance of a W-layer (140 {mu}m) on a CFC-substrate. A lock-in thermography system together with a pulse repetition rate Nd:YAG laser (1064 nm, 1-500 Hz pulse repetition rate) for layer heating was applied for phase shift measurements on the W-layer. A numerical model for direct phase shift calculations was developed and applied to rapid determination of the Fourier amplitudes and phases of the temperature. Thermal conductance coefficients were obtained by comparing the experimental and simulation phase shifts. -- Highlights: Black-Right-Pointing-Pointer Lock-in thermography determines a layer/substrate thermal conductance. Black-Right-Pointing-Pointer Thermal conductance coefficient of W-layer on a CFC-substrate. Black-Right-Pointing-Pointer Model for direct phase shift calculations was developed and applied. Black-Right-Pointing-Pointer Rapid determination of the Fourier amplitudes and phases of the temperature. Black-Right-Pointing-Pointer Comparing the experimental and simulation phase shifts.

  17. Infrared thermography inspection for monoblock divertor target in JT-60SA

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Shigetoshi, E-mail: nakamura.shigetoshi@jaea.go.jp; Sakurai, Shinji; Ozaki, Hidetsugu; Seki, Yohji; Yokoyama, Kenji; Sakasai, Akira; Tsuru, Daigo

    2014-10-15

    Highlights: • Infrared thermography inspection is modified to inspect JT-60SA divertor targets. • Infrared thermography inspection is effective to detect joining defects of targets. • Numerical analysis is in good agreement with inspection results of mock-up targets. • Database for setting screening criteria has been constructed by numerical analysis. - Abstract: Carbon fiber composite (CFC) monoblock divertor target is required for power handling in JT-60SA. Quality of the targets depends on a joining technology in manufacturing process. To inspect the quality of more than 900 target pieces, efficient non-destructive inspection is needed. An infrared thermography inspection (IR inspection), has been proposed by ITER and IRFM, where the quality between CFC and a cooling tube is examined by a use of transient thermal response at a rapid switch from hot to cold water flow. In JT-60SA divertor target, a screw tube will be employed to obtain high heat transfer efficiency with simple structure. Since the time response of the screw tube is much faster than that of smooth tube, it is required to confirm the feasibility of this IR inspection. Thus, the effect of joining defects on transient thermal response of the targets has been investigated experimentally by using the mock-up targets containing defects which are artificially made. It was found that the IR inspection can detect the defects. Moreover, screening criteria of IR inspection for acceptable monoblock target is discussed.

  18. Comparison of filters for concentrating microbial indicators and pathogens in lake-water samples

    Science.gov (United States)

    Francy, Donna S.; Stelzer, Erin A.; Brady, Amie M.G.; Huitger, Carrie; Bushon, Rebecca N.; Ip, Hon S.; Ware, Michael W.; Villegas, Eric N.; Gallardo, Vincent; Lindquist, H.D. Alan

    2013-01-01

    Bacterial indicators are used to indicate increased health risk from pathogens and to make beach closure and advisory decisions; however, beaches are seldom monitored for the pathogens themselves. Studies of sources and types of pathogens at beaches are needed to improve estimates of swimming-associated health risks. It would be advantageous and cost-effective, especially for studies conducted on a regional scale, to use a method that can simultaneously filter and concentrate all classes of pathogens from the large volumes of water needed to detect pathogens. In seven recovery experiments, stock cultures of viruses and protozoa were seeded into 10-liter lake water samples, and concentrations of naturally occurring bacterial indicators were used to determine recoveries. For the five filtration methods tested, the highest median recoveries were as follows: glass wool for adenovirus (4.7%); NanoCeram for enterovirus (14.5%) and MS2 coliphage (84%); continuous-flow centrifugation (CFC) plus Virocap (CFC+ViroCap) for Escherichia coli (68.3%) and Cryptosporidium (54%); automatic ultrafiltration (UF) for norovirus GII (2.4%); and dead-end UF for Enterococcus faecalis (80.5%), avian influenza virus (0.02%), and Giardia (57%). In evaluating filter performance in terms of both recovery and variability, the automatic UF resulted in the highest recovery while maintaining low variability for all nine microorganisms. The automatic UF was used to demonstrate that filtration can be scaled up to field deployment and the collection of 200-liter lake water samples.

  19. Comparison of filters for concentrating microbial indicators and pathogens in lake water samples.

    Science.gov (United States)

    Francy, Donna S; Stelzer, Erin A; Brady, Amie M G; Huitger, Carrie; Bushon, Rebecca N; Ip, Hon S; Ware, Michael W; Villegas, Eric N; Gallardo, Vicente; Lindquist, H D Alan

    2013-02-01

    Bacterial indicators are used to indicate increased health risk from pathogens and to make beach closure and advisory decisions; however, beaches are seldom monitored for the pathogens themselves. Studies of sources and types of pathogens at beaches are needed to improve estimates of swimming-associated health risks. It would be advantageous and cost-effective, especially for studies conducted on a regional scale, to use a method that can simultaneously filter and concentrate all classes of pathogens from the large volumes of water needed to detect pathogens. In seven recovery experiments, stock cultures of viruses and protozoa were seeded into 10-liter lake water samples, and concentrations of naturally occurring bacterial indicators were used to determine recoveries. For the five filtration methods tested, the highest median recoveries were as follows: glass wool for adenovirus (4.7%); NanoCeram for enterovirus (14.5%) and MS2 coliphage (84%); continuous-flow centrifugation (CFC) plus Virocap (CFC+ViroCap) for Escherichia coli (68.3%) and Cryptosporidium (54%); automatic ultrafiltration (UF) for norovirus GII (2.4%); and dead-end UF for Enterococcus faecalis (80.5%), avian influenza virus (0.02%), and Giardia (57%). In evaluating filter performance in terms of both recovery and variability, the automatic UF resulted in the highest recovery while maintaining low variability for all nine microorganisms. The automatic UF was used to demonstrate that filtration can be scaled up to field deployment and the collection of 200-liter lake water samples.

  20. Carbon dioxide, hydrographic, and chemical data obtained in the South Pacific Ocean (WOCE Sections P16A/P17A, P17E/P19S, and P19C, R/V Knorr, October 1992--April 1993)

    Energy Technology Data Exchange (ETDEWEB)

    Rubin, S.; Goddard, J.G.; Chipman, D.W.; Takahashi, Taro; Sutherland, S.C. [Columbia Univ., Palisades, NY (United States). Lamont-Doherty Earth Observatory; Reid, J.L.; Swift, J.H.; Talley, L.D. [Univ. of California, San Diego, La Jolla, CA (United States). Scripps Institution of Oceanography

    1998-06-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide concentration (TCO{sub 2}) and partial pressure of CO{sub 2} (pCO{sub 2}) in discrete water samples collected during three expeditions of the Research Vessel (R/V) Knorr in the South Pacific Ocean. Conducted as part of the World Ocean Circulation Experiment (WOCE), the first cruise (WOCE Section P16A/P17A) began in Papeete, Tahiti, French Polynesia, on October 6, 1992, and returned to Papeete on November 25, 1992. The second cruise (WOCE Section P17E/P19S) began in Papeete on December 4, 1992, and finished in Punta Arenas, Chile, on January 22, 1993. The third expedition (WOCE Section P19C) started in Punta Arenas, on February 22 and finished in Panama City, Panama, on April 13, 1993. During the three expeditions, 422 hydrographic stations were occupied. Hydrographic and chemical measurements made along WOCE Sections P16A/P17A, P17E/P19S, and P19C included pressure, temperature, salinity, and oxygen [measured by conductivity, temperature, and depth (CTD) sensor], as well as discrete measurements of salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO{sub 2}, and pCO{sub 2} measured at 4 and 20 C. In addition, potential temperatures were calculated from the measured variables.

  1. An Equilibrium-Based Model of Gas Reaction and Detonation

    Energy Technology Data Exchange (ETDEWEB)

    Trowbridge, L.D.

    2000-04-01

    During gaseous diffusion plant operations, conditions leading to the formation of flammable gas mixtures may occasionally arise. Currently, these could consist of the evaporative coolant CFC-114 and fluorinating agents such as F2 and ClF3. Replacement of CFC-114 with a non-ozone-depleting substitute is planned. Consequently, in the future, the substitute coolant must also be considered as a potential fuel in flammable gas mixtures. Two questions of practical interest arise: (1) can a particular mixture sustain and propagate a flame if ignited, and (2) what is the maximum pressure that can be generated by the burning (and possibly exploding) gas mixture, should it ignite? Experimental data on these systems, particularly for the newer coolant candidates, are limited. To assist in answering these questions, a mathematical model was developed to serve as a tool for predicting the potential detonation pressures and for estimating the composition limits of flammability for these systems based on empirical correlations between gas mixture thermodynamics and flammability for known systems. The present model uses the thermodynamic equilibrium to determine the reaction endpoint of a reactive gas mixture and uses detonation theory to estimate an upper bound to the pressure that could be generated upon ignition. The model described and documented in this report is an extended version of related models developed in 1992 and 1999.

  2. Carbon dioxide, hydrographic, and chemical data obtained during the Thomas Washington Cruise TUNES-3 in the equatorial Pacific Ocean (WOCE Section P16C)

    Energy Technology Data Exchange (ETDEWEB)

    Goyet, C. [Woods Hole Oceanographic Institution, MA (United States); Guenther, P.R.; Keeling, C.D.; Talley, L.D. [Scripps Institution of Oceanography, La Jolla, CA (United States); Kozyr, A. [Oak Ridge National Lab., TN (United States). Carbon Dioxide Information Analysis Center

    1996-12-01

    This data documentation discusses the procedures and methods used to obtain total carbon dioxide (TCO{sub 2}), total alkalinity (TALK), hydrographic, and chemical data during the Research Vessel Thomas Washington Expedition TUNES-3 in the Equatorial Pacific Ocean (Section P16C). Conducted as a part of the World Ocean Circulation Experiment (WOCE), the cruise began in Papeete, Tahiti, on August 31, 1991, and finished in Honolulu, Hawaii, on October 1, 1991. WOCE Meridional Section P16C along 150{degree}W and between 18{degree}S and 19{degree}N was completed during the 31-day expedition. All 105 hydrographic and 8 large-volume stations were completed to the full water column depth. Station spacing was 30 nautical miles (nm), except between 3{degree}N and 3{degree}S where it was 10 nm. Twenty-five bio-optics stations were sampled for the Joint Global Ocean Flux Study, and at 21 stations carbon dioxide measurements were provided for the US Department of Energy`s CO{sub 2} program. Hydrographic and chemical measurements made along WOCE Section P16C included pressure, temperature, salinity, and oxygen measured by conductivity, temperature, and depth sensor; and bottle salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbon (CFC)-11, CFC-12, TCO{sub 2}, and TALK. In addition, potential temperatures were calculated from the measured variables.

  3. Carbon dioxide, hydrographic, and chemical data obtained during the R/V Thomas Washington TUNES-1 in the equatorial Pacific Ocean (WOCE Section P17C)

    Energy Technology Data Exchange (ETDEWEB)

    Goyet, C. [Woods Hole Oceanographic Institution, MA (United States); Key, R.M. [Princeton Univ., NJ (United States); Sullivan, K.F. [Univ. of Miami, FL (United States). Rosensteil School of Marine and Atmospheric Sciences; Tsuchiya, M. [Univ. of California, San Diego, CA (United States). Scripps Institution of Oceanography; Kozyr, A. [Oak Ridge National Lab., TN (United States). Carbon Dioxide Information Analysis Center]|[Univ. of Tennessee, Knoxville, TN (United States). Energy, Environment, and Resources Center

    1997-06-01

    This report discusses the procedures and methods used to obtain measurements of total carbon dioxide (TCO{sub 2}), total alkalinity (TALK), and radiocarbon ({Delta} {sup 14}C), as well as hydrographic and chemical data, during the Research Vessel Thomas Washington Expedition TUNES-1 in the Equatorial Pacific Ocean (Section P17C). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in San Diego, California, on May 31, 1991, and ended in Papeete, Tahiti, on July 11, 1991. WOCE Meridional Section P17C, along 135{degree}W and between {approximately}5{degree}S and 36{degree}N, was completed during the 42-day expedition. All 123 hydrographic stations (including 9 large-volume stations) were completed to the full water-column depth. Spacing between stations was 30 nautical miles, except between 3{degree}N and 3{degree}S, where it was 10 nautical miles. At 30 stations, CO{sub 2} measurements were provided for the US Department of Energy`s Carbon Dioxide Program. Hydrographic and chemical measurements made along WOCE Section P17C included pressure, temperature, salinity, and oxygen (measured by conductivity, temperature, and depth sensor), as well as bottle measurements of salinity, oxygen, phosphate, nitrate, nitrite, silicate, chlorofluorocarbon (CFC)-11, CFC-12, {Delta} {sup 14}C, TCO{sub 2}, and TALK. In addition, potential temperatures were calculated from the measured variables.

  4. Comparison the physicochemical properties of bunch press fibre cellulose and cyclone fibre cellulose of waste from industry Crude Palm Oil (CPO

    Directory of Open Access Journals (Sweden)

    Irfan Gustian

    2013-10-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE Study on comparison the physicochemical properties of bunch press fibre cellulose (Bpfc and cyclone fibre cellulose (Cfc wastes from industry Crude Palm oil (CPO have been performed. The physicochemical properties both of celluloses have been done such as the average degree of polymerization (DP, solubility properties, functional group analysis, thermal properties and X-ray diffraction patterns. The average degrees of polymerization (DP have been obtained 2195 and 567 for Bpfc and Cfc. Bunch press fibre cellulose and cyclone fibre cellulose were soluble in cupriethylenediamine (CED. FT-IR analysis showed the same pattern of spectrum but different intensities. Thermal stability of bunch press fibre cellulose and cyclone fibre cellulose remains stable up to a temperature of 250 °C. Glass transition bunch press fibre cellulose greater than the glass transition cyclone fibre cellulose and X-ray diffraction pattern shows the same pattern and intensity varies.

  5. The structure of the tungsten coatings deposited by Combined Magnetron Sputtering and Ion Implantation for nuclear fusion applications

    Energy Technology Data Exchange (ETDEWEB)

    Grigore, E., E-mail: edigrig@infim.ro [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association (Romania); Ruset, C. [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association (Romania); Rasinski, M. [Faculty of Materials Science and Engineering, Warsaw University of Technology, Warsaw (Poland); Gherendi, M. [National Institute for Laser, Plasma and Radiation Physics, Bucharest, Euratom-MEdC Association (Romania); Matthews, G.F. [Culham Centre for Fusion Energy, Euratom Association, Abingdon (United Kingdom)

    2015-10-15

    Combined Magnetron Sputtering and Ion Implantation (CMSII) technology was used for W coating of about 1800 CFC tiles for ITER-like Wall (ILW) at JET and more than 1300 fine grain graphite tiles for ASDEX Upgrade tokamak. Thermal fatigue and carbidization due to the diffusion of the carbon from the substrate were found as main phenomena limiting the service lifetime of the W coatings. Detailed investigation of these coatings using SEM and STEM (scanning transmission electron microscopy) together with the FIB (focused ion beam) cutting technique revealed two fine networks of nano-pores with the size of 10–20 nm for zones of 250–350 nm at CFC-Mo and Mo-W interfaces. Formation of these nano-pores is associated with the energy of the ions striking the coating during the deposition process. By optimizing this energy the nano-pores disappeared. The structure and the performances of the W coatings produced by the new modified technology (CMSII-M) were compared with those deposited by standard benchmark technology. The HHF (high heat flux) tests carried out with an electron beam at a temperature of 1450 °C indicated a decrease of the defects affected area by a factor of about 1.7.

  6. Experience gained with the 3D machining of the W7-X HHF divertor target elements

    Energy Technology Data Exchange (ETDEWEB)

    Junghanns, P. [Max Planck Institute for Plasma Physics, Greifswald (Germany); Boscary, J., E-mail: jean.boscary@ipp.mpg.de [Max Planck Institute for Plasma Physics, Garching (Germany); Peacock, A. [Max Planck Institute for Plasma Physics, Garching (Germany)

    2015-10-15

    Highlights: • The Wendelstein 7-X surface of the actively cooled divertor is built up of 890 individually 3D machined target elements. • To date 300 target elements have been 3D machined with an accuracy of ±0.015 mm. • Copper discovered on the surface of few elements is no risk to operation. - Abstract: The high heat flux (HHF) divertor of W7-X consists of 100 target modules assembled from 890 actively water-cooled target elements protected with CFC tiles. The divertor surface will be built up of individually 3D machined target elements with 89 individual element types. To date 300 of the 890 target elements have been 3D machined with a very good accuracy. To achieve this successful result, a prototyping phase has been conducted to qualify the manufacturing route and to define the acceptance criteria with measures taken to minimize the risk of unacceptable damage during the manufacturing. After the 3D-machining, during the incoming inspection, copper infiltration from the interface between the CFC tiles and the CuCrZr heat sink to the plasma facing surface was detected in a small number of elements.

  7. High energy flux thermo-mechanical test of 1D-carbon-carbon fibre composite prototypes for the SPIDER diagnostic calorimeter.

    Science.gov (United States)

    De Muri, M; Cavallin, T; Pasqualotto, R; Dalla Palma, M; Cervaro, V; Fasolo, D; Franchin, L; Tollin, M; Greuner, H; Böswirth, B; Serianni, G

    2014-02-01

    Operation of the thermonuclear fusion experiment ITER requires additional heating via injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction in Padova, the production of negative ions will be studied and optimised. STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) is a diagnostic used to characterise the SPIDER beam during short pulse operation (several seconds) to verify if the beam meets the ITER requirements about the maximum allowed beam non-uniformity (below ±10%). The major components of STRIKE are 16 1D-CFC (Carbon-Carbon Fibre Composite) tiles, observed at the rear side by a thermal camera. This contribution gives an overview of some tests under high energy particle flux, aimed at verifying the thermo-mechanical behaviour of several CFC prototype tiles. The tests were performed in the GLADIS facility at IPP (Max-Plank-Institut für Plasmaphysik), Garching. Dedicated linear and nonlinear simulations were carried out to interpret the experiments and a comparison of the experimental data with the simulation results is presented. The results of some morphological and structural studies on the material after exposure to the GLADIS beam are also given.

  8. Infrared imaging diagnostics for INTF ion beam

    Science.gov (United States)

    Sudhir, D.; Bandyopadhyay, M.; Pandey, R.; Joshi, J.; Yadav, A.; Rotti, C.; Bhuyan, M.; Bansal, G.; Soni, J.; Tyagi, H.; Pandya, K.; Chakraborty, A.

    2015-04-01

    In India, testing facility named INTF [1] (Indian test facility) is being built in Institute for Plasma Research to characterize ITER-Diagnostic Neutral Beam (DNB). INTF is expected to deliver 60A negative hydrogen ion beam current of energy 100keV. The beam will be operated with 5Hz modulation having 3s ON/20s OFF duty cycle. To characterize the beam parameters several diagnostics are at different stages of design and development. One of them will be a beam dump, made of carbon fiber composite (CFC) plates placed perpendicular to the beam direction at a distance lm approximately. The beam dump needs to handle ˜ 6MW of beam power with peak power density ˜ 38.5MW/m2. The diagnostic is based on thermal (infra-red - IR) imaging of the footprint of the 1280 beamlets falling on the beam dump using four IR cameras from the rear side of the dump. The beam dump will be able to measure beam uniformity, beamlet divergence. It may give information on relative variation of negative ion stripping losses for different beam pulses. The design of this CFC based beam dump needs to address several physics and engineering issues, including some specific inputs from manufacturers. The manuscript will describe an overview of the diagnostic system and its design methodology highlighting those issues and the present status of its development.

  9. Development of W coatings for fusion applications

    Energy Technology Data Exchange (ETDEWEB)

    Ruset, C., E-mail: ruset@infim.ro [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); National Institute for Laser, Plasma and Radiation Physics, Euratom-MEdC Association, Bucharest (Romania); Grigore, E. [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); National Institute for Laser, Plasma and Radiation Physics, Euratom-MEdC Association, Bucharest (Romania); Maier, H.; Neu, R.; Greuner, H.; Mayer, M. [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Max-Plank Institut fuer Plasma Physik, Euratom Association, 85748 Garching (Germany); Matthews, G. [JET-EFDA, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Culham Centre for Fusion Energy, Euratom Association, Abingdon (United Kingdom)

    2011-10-15

    The paper gives a short overview on tungsten (W) coatings deposited by various methods on carbon materials (carbon fibre composite - CFC and fine grain graphite - FGG). Vacuum Plasma Spray (VPS), Chemical Vapor Deposition (CVD) and Physical Vapor Deposition (PVD) techniques are analyzed in respect with the characteristics and performances of the W coatings. A particular attention is paid to the Combined Magnetron Sputtering and Ion Implantation (CMSII) technique, which was developed during the last 4 years from laboratory to industrial scale and it is successfully applied for W coating (10-15 {mu}m and 20-25 {mu}m) of more than 2500 tiles for the ITER-like Wall project at JET and ASDEX Upgrade. This technique involves simultaneously magnetron sputtering and high energy (tens of keV) ion implantation. Due to the ion bombardment a stress relief occurs within the coating enabling its growth without delamination to a relatively large thickness. In addition, in order to adjust the thermal expansion mismatch between CFC and W, a Mo interlayer of 2-3 {mu}m is currently used. Experimentally, W/Mo coatings with a thickness up to 50 {mu}m were produced and successfully tested in the GLADIS ion beam facility up to 23 MW/m{sup 2}.

  10. Estimation of Flammability Limits of Selected Fluorocarbons with F(sub 2) and CIF(sub3)

    Energy Technology Data Exchange (ETDEWEB)

    Trowbridge, L.D.

    1999-09-01

    During gaseous diffusion plant operations, conditions leading to the formation of flammable gas mixtures may occasionally arise. Currently, these could consist of the evaporative coolant CFC-114 and fluorinating agents such as F(sub 2) and CIF(sub 3). Replacement of CFC-114 with non-ozone-depleting substitutes such as c-C(sub 4)F(sub 8) and C(sub 4)F(sub 10) is planned. Consequently, in the future, these too must be considered potential ''fuels'' in flammable gas mixtures. Two questions of practical interest arise: (1) can a particular mixture sustain and propagate a flame if ignited, and (2) what is the maximum pressure that can be generated by the burning (and possibly exploding) gas mixture, should ignite? Experimental data on these systems are limited. To assist in answering these questions, a literature search for relevant data was conducted, and mathematical models were developed to serve as tools for predicting potential detonation pressures and estimating (based on empirical correlations between gas mixture thermodynamics and flammability for known systems) the composition limits of flammability for these systems. The models described and documented in this report are enhanced versions of similar models developed in 1992.

  11. Étude par la méthode de Monte Carlo de la phase plastique de la quinuclidine à différentes températures

    Science.gov (United States)

    Jumeau, Daniel; André, Daniel

    La phase plastique (c.f.c.) de la quinuclidine est étudiée à différentes températures par la méthode de Monte Carlo utilisant la technique des matrices de compatibilité. Afin de ne pas modifier la symétrie moyenne du réseau, les centres de masse de molécules sont supposés fixes. Les orientations moléculaires sont choisies de façon aléatoire parmi les 48 orientations équivalentes et discernables du groupe c.f.c. Cela permet une mémorisation préalable des énergies d'interaction entre molécules voisines et un gain de temps de calcul considérable. Nous observons alors un blocage des réorientations moléculaires à basse température, tandis que la symétrie cristalline devient monoclinique. Ceci est interprété en termes de transition de phase dont la température (215 K) et la variation d'énergie (5 kJ mol-1) sont très proches des valeurs expérimentales.

  12. Effects of intra-prelimbic prefrontal cortex injection of cannabidiol on anxiety-like behavior: involvement of 5HT1A receptors and previous stressful experience.

    Science.gov (United States)

    Fogaça, M V; Reis, F M C V; Campos, A C; Guimarães, F S

    2014-03-01

    The prelimbic medial prefrontal cortex (PL) is an important encephalic structure involved in the expression of emotional states. In a previous study, intra-PL injection of cannabidiol (CBD), a major non-psychotomimetic cannabinoid present in the Cannabis sativa plant, reduced the expression of fear conditioning response. Although its mechanism remains unclear, CBD can facilitate 5HT1A receptor-mediated neurotransmission when injected into several brain structures. This study was aimed at verifying if intra-PL CBD could also induce anxiolytic-like effect in a conceptually distinct animal model, the elevated plus maze (EPM). We also verified if CBD effects in the EPM and contextual fear conditioning test (CFC) depend on 5HT1A receptors and previous stressful experience. CBD induced opposite effects in the CFC and EPM, being anxiolytic and anxiogenic, respectively. Both responses were prevented by WAY100,635, a 5HT1A receptor antagonist. In animals that had been previously (24h) submitted to a stressful event (2h-restraint) CBD caused an anxiolytic, rather than anxiogenic, effect in the EPM. This anxiolytic response was abolished by previous injection of metyrapone, a glucocorticoid synthesis blocker. Moreover, restraint stress increased 5HT1A receptors expression in the dorsal raphe nucleus, an effect that was attenuated by injection of metyrapone before the restraint procedure. Taken together, these results suggest that CBD modulation of anxiety in the PL depend on 5HT1A-mediated neurotransmission and previous stressful experience.

  13. 4- to 6-week-old adult-born hippocampal neurons influence novelty-evoked exploration and contextual fear conditioning.

    Science.gov (United States)

    Denny, Christine A; Burghardt, Nesha S; Schachter, Daniel M; Hen, René; Drew, Michael R

    2012-05-01

    To explore the role of adult hippocampal neurogenesis in novelty processing, we assessed novel object recognition (NOR) in mice after neurogenesis was arrested using focal x-irradiation of the hippocampus, or a reversible, genetic method in which glial fibrillary acidic protein-positive neural progenitor cells are ablated with ganciclovir. Arresting neurogenesis did not alter general activity or object investigation during four exposures with two constant objects. However, when a novel object replaced a constant object, mice with neurogenesis arrested by either ablation method showed increased exploration of the novel object when compared with control mice. The increased novel object exploration did not manifest until 4-6 weeks after x-irradiation or 6 weeks following a genetic ablation, indicating that exploration of the novel object is increased specifically by the elimination of 4- to 6-week-old adult born neurons. The increased novel object exploration was also observed in older mice, which exhibited a marked reduction in neurogenesis relative to young mice. Mice with neurogenesis arrested by either ablation method were also impaired in one-trial contextual fear conditioning (CFC) at 6 weeks but not at 4 weeks following ablation, further supporting the idea that 4- to 6-week-old adult born neurons are necessary for specific forms of hippocampal-dependent learning, and suggesting that the NOR and CFC effects have a common underlying mechanism. These data suggest that the transient enhancement of plasticity observed in young adult-born neurons contributes to cognitive functions.

  14. Graphene-coated carbon fiber cloth for flexible electrodes of glucose fuel cells

    Science.gov (United States)

    Hoshi, Kazuki; Muramatsu, Kazuo; Sumi, Hisato; Nishioka, Yasushiro

    2016-02-01

    In this work, we fabricated flexible electrodes for a miniaturized, simple structured, and flexible glucose biofuel cell (BFC) using a graphene-coated carbon fiber cloth (GCFC). The areas of the anode and cathode electrodes were 3 × 10 mm2. The anode area was coated with the enzyme glucose oxidase, and the cathode area was coated with the enzyme bilirubin oxidase. No ion-exchange film was needed because glucose oxidase selectively oxidizes glucose and bilirubin oxidase selectively reduces oxygen. The power density of the BFC with GCFC electrodes in a phosphate buffer solution of 200 mM glucose solution at room temperature was 34.3 µW/cm2 at 0.43 V. The power density of a BFC using carbon fiber cloth (CFC) without graphene modification was 18.5 µW/cm2 at 0.13 V. The BFC with the GCFC electrode continued to function longer than 24 h with a power density higher than 5 µW/cm2. These effects were attributed to the much larger effective surface areas of the GCFC electrodes that maintain more enzymes than those of the CFC electrodes.

  15. Erosion and Modifications of Tungsten-Coated Carbon and Copper Under High Heat Flux

    Institute of Scientific and Technical Information of China (English)

    Liu Xiang(刘翔); S.Tamura; K.Tokunaga; N.Yoshida; Zhang Fu(张斧); Xu Zeng-yu(许增裕); Ge Chang-chun(葛昌纯); N.Noda

    2003-01-01

    Tungsten-coated carbon and copper was prepared by vacuum plasma spraying (VPS)and inert gas plasma spraying (IPS), respectively. W/CFC (Tungsten /Carbon Fiber-Enhancedmaterial) coating has a diffusion barrier that consists of W and Re multi-layers pre-deposited byphysical vapor deposition on carbon fiber-enhanced materials, while W/Cu coating has a gradedtransition interface. Different grain growth processes of tungsten coatings under stable and tran-sient heat loads were observed, their experimental results indicated that the recrystallizing tem-perature of VPS-W coating was about 1400 ℃ and a recrystallized columnar layer of about 30μmthickness was formed by cyclic heat loads of 4 ms pulse duration. Erosion and modifications ofW/CFC and W/Cu coatings under high heat load, such as microstructure changes of interface,surface plastic deformations and cracks, were investigated, and the erosion mechanism erosionproducts) of these two kinds of tungsten coatings under high heat flux was also studied.

  16. Methods of Boron-carbon Deposited Film Removal

    Science.gov (United States)

    Airapetov, A.; Terentiev, V.; Voituk, A.; Zakharov, A.

    Boron carbide was proposed as a material for in-situ renewable protecting coating for tungsten tiles of the ITER divertor. It is necessary to develop a method of gasification of boron-carbon film which deposits during B4C sputtering. In this paper the results of the first stage investigation of gasification methods of boron-carbon films are presented. Two gasification methods of films are investigated: interaction with the ozone-oxygen mixture and irradiation in plasma with the working gas composed of oxygen, ethanol, and, in some cases, helium. The gasification rate in the ozone-oxygen mixture at 250 °C for B/C films with different B/C ratio and carbon fiber composite (CFC), was measured. For B/C films the gasification rate decreased with increasing B/C ratio (from 45 nm/h at B/C=0.7 to 4 nm/h at B/C=2.1; for CFC - 15 μm/h). Films gasification rates were measured under ion irradiation from ethanol-oxygen-helium plasma at different temperatures, with different ion energies and different gas mixtures. The maximum obtained removal rate was near 230 nm/h in case of ethanol-oxygen plasma and at 150°C of the sample temperature.

  17. Validation of first chemistry mode retrieval results from new limb-imaging FTS GLORIA with correlative MIPAS-STR observations

    Science.gov (United States)

    Woiwode, W.; Suminska-Ebersoldt, O.; Oelhaf, H.; Höpfner, M.; Belyaev, G. V.; Ebersoldt, A.; Friedl-Vallon, F.; Grooß, J.-U.; Gulde, T.; Kaufmann, M.; Kleinert, A.; Krämer, M.; Kretschmer, E.; Kulessa, T.; Maucher, G.; Neubert, T.; Piesch, C.; Preusse, P.; Riese, M.; Rongen, H.; Sartorius, C.; Schardt, G.; Schönfeld, A.; Schuettemeyer, D.; Sha, M. K.; Stroh, F.; Ungermann, J.; Volk, C. M.; Orphal, J.

    2014-12-01

    We report first chemistry mode retrieval results from the new airborne limb-imaging infrared FTS (Fourier transform spectrometer) GLORIA and comparisons with observations by the conventional airborne limb-scanning infrared FTS MIPAS-STR. For GLORIA, the flights aboard the high-altitude research aircraft M55 Geophysica during the ESSenCe campaign (ESa Sounder Campaign 2011) were the very first in field deployment after several years of development. The simultaneous observations of GLORIA and MIPAS-STR during the flight on 16 December 2011 inside the polar vortex and under the conditions of optically partially transparent polar stratospheric clouds (PSCs) provided us the unique opportunity to compare the observations by two different infrared FTS generations directly. The retrieval results of temperature, HNO3, O3, H2O, CFC-11 and CFC-12 show reasonable agreement of GLORIA with MIPAS-STR and collocated in-situ observations. For the horizontally binned hyperspectral limb-images, the GLORIA sampling outnumbered the horizontal cross-track sampling of MIPAS-STR by up to one order of magnitude. Depending on the target parameter, typical vertical resolutions of 0.5 to 2.0 km were obtained for GLORIA and are typically by factors of 2 to 4 better compared to MIPAS-STR. While the improvement of the performance, characterisation and data processing of GLORIA are subject of ongoing work, the presented first results already demonstrate the considerable gain in sampling and vertical resolution achieved with GLORIA.

  18. Results of the JET real-time disruption predictor in the ITER-like wall campaigns

    Energy Technology Data Exchange (ETDEWEB)

    Vega, Jesús, E-mail: jesus.vega@ciemat.es [Asociación EURATOM/CIEMAT para Fusión, Madrid (Spain); Dormido-Canto, Sebastián [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); López, Juan M. [Universidad Politécnica de Madrid, CAEND UPM-CSIC, Madrid (Spain); Murari, Andrea [Consorzio RFX, Associazione EURATOM/ENEA per la Fusione, Padua (Italy); Ramírez, Jesús M. [Universidad Nacional de Educación a Distancia (UNED), Madrid (Spain); Moreno, Raúl [Asociación EURATOM/CIEMAT para Fusión, Madrid (Spain); Ruiz, Mariano [Universidad Politécnica de Madrid, CAEND UPM-CSIC, Madrid (Spain); Alves, Diogo [Associação EURATOM/IST, Instituto de Plasmas e Fusão Nuclear – Laboratório Associado, Instituto Superior Técnico, P-1049-001 Lisboa (Portugal); Felton, Robert [EURATOM/CCFE Fusion Association, Culham Science Center, Abingdon, Oxon OX14 3DB (United Kingdom)

    2013-10-15

    Highlights: •JET real-time disruption predictor with metallic wall 991 discharges analyzed. •Predictor training has been carried out with JET C wall data. •Success, false alarm and missed alarm rates are 98.4%, 0.9% and 1.6%, respectively. •Alarms are triggered in average 426 ms before the disruption. -- Abstract: The impact of disruptions in JET became even more important with the replacement of the previous Carbon Fiber Composite (CFC) wall with a more fragile full metal ITER-like wall (ILW). The development of robust disruption mitigation systems is crucial for JET (and also for ITER). Moreover, a reliable real-time (RT) disruption predictor is a pre-requisite to any mitigation method. The Advance Predictor Of DISruptions (APODIS) has been installed in the JET Real-Time Data Network (RTDN) for the RT recognition of disruptions. The predictor operates with the new ILW but it has been trained only with discharges belonging to campaigns with the CFC wall. 7 real-time signals are used to characterize the plasma status (disruptive or non-disruptive) at regular intervals of 32 ms. After the first 3 JET ILW campaigns (991 discharges), the success rate of the predictor is 98.36% (alarms are triggered in average 426 ms before the disruptions). The false alarm and missed alarm rates are 0.92% and 1.64%.

  19. UV-VIS Spectroscopy Applied to Stratospheric Chemistry, Methods and Results

    Energy Technology Data Exchange (ETDEWEB)

    Karlsen, K.

    1996-03-01

    This paper was read at the workshop ``The Norwegian Climate and Ozone Research Programme`` held on 11-12 March 1996. Numerous observations and modeling have shown with a very high degree of certainty that the man-made emissions of chlorofluorocarbons (CFC) and halons are responsible for the Antarctica ozone hole. It is also evident that the ozone layer of the Northern Hemisphere has suffered a certain decline over the last 10-15 years, possibly because of CFC and halons. 20-30% of the observed reduction is ascribed to coupled chlorine and bromine chemistry via a catalytic cycle resulting in the net conversion of 2O{sub 3} to 3O{sub 2}. But the details are not fully understood. The author plans to assemble a UV-VIS spectrometer for measuring the species OClO and BrO and to compare and discuss measured diurnal variations of OClO and BrO with model calculations. The use of Differential Optical Absorption Spectroscopy (DOAS) is discussed and some results from late 1995 presented. 6 refs., 2 figs.

  20. Alternative refrigerants for supermarket refrigerators; Alternative Kaeltemittel fuer Supermarkt-Kaelteanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Haaf, S.; Heinbokel, B. [Linde AG, Geschaeftsbereich Kaeltetechnik, Koeln (Germany)

    2003-07-01

    Most supermarket refrigerators are still equipped with H-CFC (R404A and R134a), which contribute to global warming. Natural refrigerants were tested as substitutes, i.e. NH{sub 3}, propene and CO{sub 2}, but H-CFC systems are still the best solution. Attempts are now made to reduce refrigerant filling levels and prevent leakage. [German] Die in Supermarkt-Kaelteanlagen ueberwiegend eingesetzten HFKW-Kaeltemittel R404A und R134a weisen betraechtliche Treibhauspotentiale auf. Im Zusammenhang mit auftretenden Kaeltemittel-Leckagen wirkt sich dies auf die Hoehe des gesamten Treibhauseffekts TEWI derartiger Anlagen aus. Im Laufe der letzten Jahre wurde von Linde eine grosse Anzahl von Anlagen mit den natuerlichen Kaeltemitteln NH{sub 3}, Propen und fuer die Tiefkuehlung auch mit CO{sub 2} installiert. Waehrend die Betriebssicherheit dieser Anlagen als gut bezeichnet werden kann, weisen die Anlagen mit NH{sub 3} und Propen, bei denen die Kuehlung der Verbraucher ueber Kaeltetraegerkreislaeufe erfolgt, deutlich hoehere Energieverbraeuche und Investitionskosten auf. Gute Chancen fuer eine wirtschaftliche Betriebsweise bieten hingegen CO{sub 2}-Kaskadenanlagen fuer die Tiefkuehlung. Da fuer den Bereich der Normalkuehlung kurzfristig keine akzeptable Loesung mit CO{sub 2} als Kaeltemittel zur Verfuegung stehen wird, bilden Anlagen mit HFKW-Kaeltemitteln weiterhin die beste Loesung, wobei weitere Reduzierung der Kaeltemittel-Fuellmengen und Leckagen zur Steigerung der Umweltfreundlichkeit notwendig und moeglich sind. (orig.)

  1. Foaming characteristics of refigerant/lubricant mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Goswami, D.Y.; Shah, D.O.; Jotshi, C.K.; Bhagwat, S.; Leung, M.; Gregory, A.

    1997-04-01

    The air-conditioning and refrigeration industry has moved to HFC refrigerants which have zero ozone depletion and low global warming potential due to regulations on CFC and HCFC refrigerants and concerns for the environment. The change in refrigerants has prompted the switch from mineral oil and alkylbenzene lubricants to polyolester-based lubricants. This change has also brought about a desire for lubricant, refrigerant and compressor manufacturers to understand the foaming properties of alternative refrigerant/ lubricant mixtures, as well as the mechanisms which affect these properties. The objectives of this investigation are to experimentally determine the foaming absorption and desorption rates of HFC and blended refrigerants in polyolester lubricant and to define the characteristics of the foam formed when the refrigerant leaves the refrigerant/ lubricant mixture after being exposed to a pressure drop. The refrigerants being examined include baseline refrigerants: CFC-12 (R-12) and HCFC-22 (R-22); alternative refrigerants: HFC-32 (R-32), R-125, R-134a, and R-143a; and blended refrigerants: R-404A, R-407C, and R-410A. The baseline refrigerants are tested with ISO 32 (Witco 3GS) and ISO 68 (4GS) mineral oils while the alternative and blended refrigerants are tested with two ISO 68 polyolesters (Witco SL68 and ICI RL68H).

  2. Anti-Avoidance Rules di Indonesia Pasca Amandemen UU Pajak Penghasilan

    Directory of Open Access Journals (Sweden)

    Adrianto Dwi Nugroho

    2012-02-01

    Full Text Available The fourth amendment to the Indonesian Income Tax Act (UU PPh has inserted three new provisions encountering three newly-identified tax avoidance schemes. However, the previous regulations in respect of thin capitalization, CFC and interest stripping were not carefully be given attention and be made in conformity with their newest developments. As an illustration, the term “company” has never been defined in the Act. Instead, the Act introduces the same term in the conduit company rules. Another example involves the CFC rule which does not put additional provisions to define “control”. Another interesting development is the regulation of the International-hiring out of labor which instead of making it in conformity with the OECD MC, the rule empowers the country to increase the taxable income of an employee in respect of employment excercised abroad. This article attempts to demonstrate how the Indonesian anti-avoidance rules work out and prove how taxpayers may well, ironically, abuse those rules.

  3. Evolutionary genetic analyses of MEF2C gene: implications for learning and memory in Homo sapiens.

    Science.gov (United States)

    Kalmady, Sunil V; Venkatasubramanian, Ganesan; Arasappa, Rashmi; Rao, Naren P

    2013-02-01

    MEF2C facilitates context-dependent fear conditioning (CFC) which is a salient aspect of hippocampus-dependent learning and memory. CFC might have played a crucial role in human evolution because of its advantageous influence on survival of species. In this study, we analyzed 23 orthologous mammalian gene sequences of MEF2C gene to examine the evidence for positive selection on this gene in Homo sapiens using Phylogenetic Analysis by Maximum Likelihood (PAML) and HyPhy software. Both PAML Bayes Empirical Bayes (BEB) and HyPhy Fixed Effects Likelihood (FEL) analyses supported significant positive selection on 4 codon sites in H. sapiens. Also, haplotter analysis revealed significant ongoing positive selection on this gene in Central European population. The study findings suggest that adaptive selective pressure on this gene might have influenced human evolution. Further research on this gene might unravel the potential role of this gene in learning and memory as well as its pathogenetic effect in certain hippocampal disorders with evolutionary basis like schizophrenia.

  4. Polymeric foaming in the new century; Atarashii jidai no happo seikei gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    Oshima, M. [Kyoto Univ., Kyoto (Japan). Dept. of Chemical Engineering

    2000-10-20

    Industrial polymeric foams were developed near the middle of the twentieth century. A chemical blowing agent or a physical blowing agent was used to liberate a gas for expanding polymers by foams. Before the 1980, CFC was used because of its high solubility, volatility and nontoxic nature. However, its stability and reactivity with ozone raised substantial concern about ozone depletion. Since the late 1980s, responding the Montreal Protocol, polymeric foam producers started researches and made big efforts to switch CFC to friendly alternative blowing agents. In mid 1980s, the microcellular foaming created by super critical CO{sub 2} was presented in the United State. The central idea of microcellular foams was to create a large number of bubbles, smaller than the pre-existing flaws in a polymer product. Since then, a large number of innovative applications have been imagined and taken people's attentions because of the unique properties of microcellular foams. This article addresses the sate of the art of the foaming and discusses what we could elucidate so far and what we should know in the future to assure more success in foaming technology in the 21 century. (author)

  5. A new design of groundwater sampling device and its application

    Institute of Scientific and Technical Information of China (English)

    Yih-Jin Tsai; Ming-Ching T.Kuo

    2005-01-01

    Compounds in the atmosphere contaminate samples of groundwater. An inexpensive and simple method for collecting groundwater samples is developed to prevent contamination when the background concentration of contaminants is high. This new design of groundwater sampling device involves a glass sampling bottle with a Teflon-lined valve at each end. A cleaned and dried sampling bottle was connected to a low flow-rate peristaltic pump with Teflon tubing and was filled with water. No headspace volume was remained in the sampling bottle. The sample bottle was then packed in a PVC bag to prevent the target component from infiltrating into the water sample through the valves. In this study, groundwater was sampled at six wells using both the conventional method and the improved method.The analysis of trichlorofluoromethane(CFC-11 ) concentrations at these six wells indicates that all the groundwater samples obtained by the conventional sampling method were contaminated by CFC-11 from the atmosphere. The improved sampling method greatly eliminated theproblems of contamination, preservation and quantitative analysis of natural water.

  6. High energy flux thermo-mechanical test of 1D-carbon-carbon fibre composite prototypes for the SPIDER diagnostic calorimeter

    Science.gov (United States)

    De Muri, M.; Cavallin, T.; Pasqualotto, R.; Dalla Palma, M.; Cervaro, V.; Fasolo, D.; Franchin, L.; Tollin, M.; Greuner, H.; Böswirth, B.; Serianni, G.

    2014-02-01

    Operation of the thermonuclear fusion experiment ITER requires additional heating via injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction in Padova, the production of negative ions will be studied and optimised. STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) is a diagnostic used to characterise the SPIDER beam during short pulse operation (several seconds) to verify if the beam meets the ITER requirements about the maximum allowed beam non-uniformity (below ±10%). The major components of STRIKE are 16 1D-CFC (Carbon-Carbon Fibre Composite) tiles, observed at the rear side by a thermal camera. This contribution gives an overview of some tests under high energy particle flux, aimed at verifying the thermo-mechanical behaviour of several CFC prototype tiles. The tests were performed in the GLADIS facility at IPP (Max-Plank-Institut für Plasmaphysik), Garching. Dedicated linear and nonlinear simulations were carried out to interpret the experiments and a comparison of the experimental data with the simulation results is presented. The results of some morphological and structural studies on the material after exposure to the GLADIS beam are also given.

  7. High energy flux thermo-mechanical test of 1D-carbon-carbon fibre composite prototypes for the SPIDER diagnostic calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    De Muri, M., E-mail: michela.demuri@igi.cnr.it; Pasqualotto, R.; Dalla Palma, M.; Cervaro, V.; Fasolo, D.; Franchin, L.; Tollin, M.; Serianni, G. [Consorzio RFX, Euratom-ENEA association, Corso Stati Uniti 4, 35127 Padova (Italy); Cavallin, T. [Istituto per l’Energetica e le Interfasi, Corso Stati Uniti 4, 35127 Padova (Italy); Greuner, H.; Böswirth, B. [Max-Planck-Institut für Plasmaphysik, D-85748 Garching bei München (Germany)

    2014-02-15

    Operation of the thermonuclear fusion experiment ITER requires additional heating via injection of neutral beams from accelerated negative ions. In the SPIDER test facility, under construction in Padova, the production of negative ions will be studied and optimised. STRIKE (Short-Time Retractable Instrumented Kalorimeter Experiment) is a diagnostic used to characterise the SPIDER beam during short pulse operation (several seconds) to verify if the beam meets the ITER requirements about the maximum allowed beam non-uniformity (below ±10%). The major components of STRIKE are 16 1D-CFC (Carbon-Carbon Fibre Composite) tiles, observed at the rear side by a thermal camera. This contribution gives an overview of some tests under high energy particle flux, aimed at verifying the thermo-mechanical behaviour of several CFC prototype tiles. The tests were performed in the GLADIS facility at IPP (Max-Plank-Institut für Plasmaphysik), Garching. Dedicated linear and nonlinear simulations were carried out to interpret the experiments and a comparison of the experimental data with the simulation results is presented. The results of some morphological and structural studies on the material after exposure to the GLADIS beam are also given.

  8. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Ronald H. Brown Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Section A16S_2005 (11 January - 24 February, 2005)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Laboratory (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2006-08-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb 14C system parameters performed during the A16S_2005 cruise, which took place from January 11 to February 24, 2005, aboard research vessel (R/V) Ronald H. Brown under the auspices of the National Oceanic and Atmospheric Administration (NOAA). The R/V Ronald H. Brown departed Punta Arenas, Chile, on January 11, 2005, and ended its cruise in Fortaleza, Brazil, on February 24, 2005. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and the National Science Foundation as part of the CLIVAR/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 121 stations. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), fugacity of CO2 (fCO2), total alkalinity (TALK), pH, dissolved organic carbon (DOC), CFC, 14C, hydrographic, and other chemical measurements. The R/V Ronald H. Brown A16S_2005 data set is available free of charge as a numeric data package (NDP) from the Carbon Dioxide Information Analysis Center (CDIAC). The NDP consists of the oceanographic data files and this printed documentation, which describes the procedures and methods used to obtain the data.

  9. Thermal design of lithium bromide-water solution vapor absorption cooling system for indirect evaporative cooling for IT pod

    Science.gov (United States)

    Sawant, Digvijay Ramkrishna

    Nowadays with increase use of internet, mobile there is increase in heat which ultimately increases the efficient cooling system of server room or IT POD. Use of traditional ways of cooling system has ultimately increased CO2 emission and depletion of CFC's are serious environmental issues which led scientific people to improve cooling techniques and eliminate use of CFC's. To reduce dependency on fossil fuels and 4environmental friendly system needed to be design. For being utilizing low grade energy source such as solar collector and reducing dependency on fossil fuel vapour absorption cooling system has shown a great driving force in today's refrigeration systems. This LiBr-water aabsorption cooling consists of five heat exchanger namely: Evaporator, Absorber, Solution Heat Exchanger, Generator, Condenser. The thermal design was done for a load of 23 kW and the procedure was described in the thesis. There are 120 servers in the IT POD emitting 196 W of heat each on full load and some of the heat was generated by the computer placed inside the IT POD. A detailed procedure has been discussed. A excel spreadsheet was to prepared with varying tube sizes to see the effect on flows and ultimately overall heat transfer coefficient.

  10. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Knorr Repeat Hydrography Cruise in the Atlantic Ocean: CLIVAR CO2 Sections A20_2003 (22 September-20 October 2003) and A22_2003 (23 October-13 November, 2003)

    Energy Technology Data Exchange (ETDEWEB)

    Kozyr, Alex [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Carbon Dioxide Information Analysis Center

    2008-09-30

    This report presents methods, and analytical and quality control procedures for salinity, oxygen, nutrient, inorganic carbon, organic carbon, chlorofluorocarbon (CFC), and bomb carbon-14 system parameters performed during the A20_2003 and A22_2003 cruises, which took place between September 22 and November 13, 2003, aboard research vessel (R/V) Knorr under the auspices of the National Oceanic and Atmospheric Administration (NOAA) and National Science Foundation (NSF). The R/V Knorr departed Woods Hole, Massachusetts, on September 22 for the Repeat Section A20, and ended this line in Port of Spain, Trinidad, on October 20. The Repeat Section A22 started on October 23 in Port of Spain, Trinidad, and finished on November 13, 2003, in Woods Hole, Massachusetts. The research conducted was one of a series of repeat hydrography sections jointly funded by NOAA and NSF as part of the Climate Variability Program (CLIVAR)/CO2/repeat hydrography/tracer program. Samples were taken from 36 depths at 88 stations on section A20 and 82 stations on section A22. The data presented in this report include the analyses of water samples for total inorganic carbon (TCO2), total alkalinity (TALK), dissolved organic carbon (DOC), CFC, carbon-14, hydrographic, and other chemical measurements.

  11. 老年慢性功能性便秘患者结肠和肛管直肠动力学的改变%The study on the colon and anorectal motility in the elderly patients with chronic functional constipation

    Institute of Scientific and Technical Information of China (English)

    罗庆锋; 许乐; 石蕾

    2009-01-01

    目的 探讨功能性便秘患者结肠和肛管直肠动力学改变及其对便秘分型、临床治疗的指导意义.方法 对我院42例老年功能性便秘患者(CFC)及20例健康对照者,采用不透X线标记物法测定结肠通过时间(CTT),同时应用8通道水灌注式下消化道压力检测系统进行直肠、肛管动力学测定.结果 (1)老年CFC组全结肠通过时间及乙状结肠通过时间分别为(49.0±16.4)h和(20.1±13.5)h,较对照组(25.2±7.7)h和(7.8±4.1)h明显延长(t=6.16和t=3.97,均P<0.05);(2)老年CFC患者模拟排便时肛管压力为(39.6±15.7)mmHg,对照组为(17.6±9.3)mmHg,两组比较差异有统计学意义(t=5.79,P<0.05),老年CFC组13例患者模拟排便时出现肛管压力反常升高;老年CFC组直肠初始感觉阈和最大耐受容量分别为(49.2±10.5)ml和(175.2±52.6)ml,高于对照组的(33.6±8.5)ml和(123.4±39.1)ml,差异均有统计学意义(t=5.79和t=3.91,均P<0.05);直肠肛门抑制反射松弛率两组分别为59.5%和85.0%(x2=4.03,PCFC). Methods Forty-two elderly patients with CFC and twenty elderly healthy controls were selected. Total and segmental colonic transit time(CTT) were assessed radiographically by using oral radiopaque markers. Eight-lead water perfusion pressure measurement system and balloon were used to test the pressure and the perception threshold values of anus and rectum. Results (1) Total colonic transit time (TCTT) and sigmoid-rectum transit time (SRTT) were (49.0±16.4) h and

  12. CERN apprenticeship scheme honoured

    CERN Multimedia

    2008-01-01

    Prestigious awards for two apprentices who did their practical training at CERN. Sylvain Heinzen, apprentice physics lab technician at CERN, receiving his award from Pierre-François UNGER, State Councillor responsible for the Federal Department of the Economy and Health. The other award-winner, Cédric Gerber, is on the right of the photo.Among Geneva’s top apprentices who were honoured by the Fondation sociale de l’Union industrielle genevoise (UIG) on 28 October this year, were two CERN apprentices. Electronics technician Cédric Gerber and physics lab technician Sylvain Heinzen both did their four-year sandwich course at CERN, obtaining their professional qualification, the Certificat fédéral de capacité (CFC), in June. On top of that, Cédric Gerber, who had been a particularly outstanding apprentice, received two further distinctions at the CFC awards ceremony - the State Council prize for achieving one of the top-ten o...

  13. Methane oxidation and degradation of organic compounds in landfill soil covers

    DEFF Research Database (Denmark)

    Scheutz, Charlotte; Kjeldsen, Peter

    2002-01-01

    High rates of methane oxidation and degradation of the lowed halogenated methanes (TCM and DCM) and HCFCs (HCFC-21 and HCFC-22) were found in an investigation of the oxidation of methane and halogenated organic compunds (HOCs) in landfill gas affected soil. The degradation followed zero-order kin......High rates of methane oxidation and degradation of the lowed halogenated methanes (TCM and DCM) and HCFCs (HCFC-21 and HCFC-22) were found in an investigation of the oxidation of methane and halogenated organic compunds (HOCs) in landfill gas affected soil. The degradation followed zero......-order kinetics and occurred in parallel with the oxidation of methane. TeCM, CFC-11, and CFC-12 were not degradable in presence of oxygen and degradation of these compounds in the oxidative zone in landfill top covers is therefore expected to be limited. However these compounds were found degradable...... in the anaerobic zone in the lower part of soil columns permeated with artificial landfill gas. The lesser-chlorinated compounds were degraded in the upper oxic zone with overlapping gradients of methane and oxygen. Methane oxidation and degradation of HOCs in the top-soils may play a very important role...

  14. A protocol to quantify mammary early common progenitors from long-term mammosphere culture.

    Science.gov (United States)

    Bachelard-Cascales, Elodie; Chapellier, Marion; Delay, Emmanuel; Maguer-Satta, Véronique

    2012-03-01

    Here we describe a protocol established in our laboratory to quantify early common progenitors/stem cells grown as spheres in non-adherent culture conditions. This protocol is based on the combination of two functional tests: the mammosphere assay to maintain and enrich early mammary progenitors/stem cells, and the epithelial colony-forming cells (E-CFC) assay to identify and quantify further differentiated epithelial progenitors. Primary spheres mainly contain progenitors and rare stem/early common progenitor cells while secondary and tertiary spheres contain progenitor cells derived from the early common progenitor/stem cell population maintained through passages and partially differentiated. Spheres are enzymatically and mechanically dissociated; the derived cells are subsequently plated on irradiated NIH-3T3 fibroblasts for further processing, as in the E-CFC assay. The principle of this assay is to quantify the number of epithelial colonies generated by cells present in the different sequential spheres. This assay has therefore been named ECP-DC, standing for Early Common Progenitor-Derived Colonies assay.

  15. Quantifying Epithelial Early Common Progenitors from Long-Term Primary or Cell Line Sphere Culture.

    Science.gov (United States)

    Clément, Flora; Zhu, Helen He; Gao, Wei-Qiang; Delay, Emmanuel; Maguer-Satta, Véronique

    2015-11-04

    Here, a protocol to quantify epithelial early common progenitor/stem cells grown as spheres in non-adherent culture conditions is described. This protocol is based on the combination of two functional tests: the sphere assay to maintain and enrich early progenitor/stem cells, and the epithelial colony-forming cells (E-CFC) assay to identify and quantify further differentiated epithelial progenitors. Primary spheres mainly contain progenitors and rare stem/early common progenitor cells while secondary and tertiary spheres contain progenitor cells derived from the early common progenitor/stem cell population maintained through passages and partially differentiated. Spheres are enzymatically and mechanically dissociated; the derived cells are subsequently plated on irradiated NIH-3T3 fibroblasts for further processing, as in the E-CFC assay. The principle of this assay is to quantify the number of epithelial colonies generated by cells present in the different sequential spheres. This assay has therefore been named the early common progenitor-derived colonies assay (ECP-DC).

  16. Changes in the ventilation of the southern oceans.

    Science.gov (United States)

    Waugh, Darryn W

    2014-07-13

    Changes in the ventilation of the southern oceans over the past few decades are examined using ocean measurements of CFC-12 and model simulations. Analysis of CFC-12 measurements made between the late 1980s and late 2000s reveal large-scale coherent changes in the ventilation, with a decrease in the age of subtropical Subantarctic Mode Waters (SAMW) and an increase in the age of Circumpolar Deep Waters. The decrease in SAMW age is consistent with the observed increase in wind stress curl and strength of the subtropical gyres over the same period. A decrease in the age of SAMW is also found in Community Climate System Model version 4 perturbation experiments where the zonal wind stress is increased. This decrease is due to both more rapid transport along isopycnals and the movement of the isopycnals. These results indicate that the intensification of surface winds in the Southern Hemisphere has caused large-scale coherent changes in the ventilation of the southern oceans.

  17. Overview of the JET ITER-like Wall, First Results and Scientific Programme

    Science.gov (United States)

    Matthews, Guy; JET-EFDA Collaboration

    2011-10-01

    The ITER-like Wall (ILW) is the first integrated tokamak experiment with a beryllium main chamber wall and tungsten divertor as foreseen for the activated operational phase of ITER: The ILW will study plasma-wall interaction (PWI) processes (material erosion, material mixing etc.), and the compatibility of the ITER materials with low fuel retention and high power operation. Replacement of the JET CFC first wall by solid Be limiters, and a combination of bulk W and W-coated CFC divertor tiles was performed by remote handling and completed in May 2011 in parallel with a neutral beam heating upgrade to 35 MW and enhancement of diagnostic capabilities. Mitigation of the power and energy loads in the divertor to acceptable levels at high power plasma performance will require high-density plasmas and radiative cooling via impurity seeding. Experiments were carried out with the carbon wall in preparation for the ILW to operate plasmas within ILW limits and provide reference plasmas for key physics studies. Although first plasma is scheduled for mid-August, the scientific programme in support of ITER will start earlier with machine conditioning. In this paper, an overview of the ILW, first results and the outlook for the scientific programme will be presented.

  18. Drawing from memory in focal epilepsy: a cognitive and neural perspective.

    Science.gov (United States)

    Giovagnoli, Anna R; Bell, Brian

    2011-03-01

    This study provides evidence of non-verbal cognitive functioning in temporal (TLE) and frontal lobe epilepsy (FLE) patients by exploring the mechanisms and neural correlates of drawing abilities. Sixty-six patients with left (n=32) or right TLE (n=34), 30 patients with left (n=18) or right FLE (n=12), and 30 healthy subjects were compared. The Drawing from Memory (DfM) test required participants to design 16 living or non-living items; the total score was the sum of all scores blindly provided by three judges who had to identify the drawings. The verbal and visual Pyramid and Palm Trees Test (PPTT), Raven Colored Progressive Matrices (Raven CPM), Cube Analysis, Token Test, Word Fluency, Card Classification, and Rey Complex Figure Test Copy trial (Rey CFC) assessed different verbal and non-verbal functions. Non-parametric statistics indicated that, with respect to controls, both TLE groups and the left FLE patients had significantly lower DfM scores. In the TLE group, hierarchical regression analyses revealed that the DfM score was predicted by the Raven CPM and PPTT scores, while, in the FLE group, it was predicted by the Rey CFC. Thus, drawing abilities may be impaired by TLE or FLE owing to different mechanisms that involve semantic or executive abilities. Implying cooperation between temporal and frontal areas that support these functions, DfM may be a sensitive index of integrity of cortical areas or neural pathways damaged by focal epilepsy.

  19. Report of the results of the fiscal 1997 regional consortium R and D project. Regional consortium energy field / Development of an environmentally friendly industrial cleaning system using near-critical and supercritical carbon dioxide (first fiscal year); 1997 nendo chiiki consortium kenkyu kaihatsu jigyo. Chiiki consortium energy bun`ya / chorinkai ryutai wo mochiita kankyo chowagata kogyo senjo sochi no kaihatsu (daiichi nendo) seika hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-01

    In the manufacturing process of semiconductors and in the high tech industry, cleaning is indispensable. At present, when regulation of the use of CFC which used to be much used has been decided on, the conversion to the use of substitutes for CFC cleaning is urgently needed. Transfer to cleaning by water/alcohol/hydrocarbon has been proceeded with, but there are a lot of problems. Out of the development of the cleaning method using supercritical fluid, the paper described the fiscal 1997 result. As to enhancement of efficiency and decrease in size of equipment, a cleaning experiment by high pressure CO2 around the critical point was conducted by integrating nozzle, ultrasonic generator and cavitation generator and adding solvent circulating system. Multi-purpose and energy saving of the equipment were also studied. To establish an analysis method for the cleaning degree, the contaminated component film of trace organic matter with a specified thickness was formed on the silicon wafer, and using the Fourier transform ultrared spectroscopy, a method to determine the film thickness was studied. For the function evaluation for precision machine parts and determination of optimum cleaning conditions, the cleaning/degreasing process of valves were compared with the conventional method. For the product manufacturing, the paper investigated and prepared the data in Japan and from abroad. 55 refs., 79 figs., 18 tabs.

  20. Preliminary estimates of residence times and apparent ages of ground water in the Chesapeake Bay watershed, and water-quality data from a survey of springs

    Science.gov (United States)

    Focazio, Michael J.; Plummer, L. Neil; Bohlke, John K.; Busenberg, Eurybiades; Bachman, L. Joseph; Powars, David S.

    1998-01-01

    Knowledge of the residence times of the ground-water systems in Chesapeake Bay watershed helps resource managers anticipate potential delays between implementation of land-management practices and any improve-ments in river and estuary water quality. This report presents preliminary estimates of ground-water residence times and apparent ages of water in the shallow aquifers of the Chesapeake Bay watershed. A simple reservoir model, published data, and analyses of spring water were used to estimate residence times and apparent ages of ground-water discharge. Ranges of aquifer hydraulic characteristics throughout the Bay watershed were derived from published literature and were used to estimate ground-water residence times on the basis of a simple reservoir model. Simple combinations of rock type and physiographic province were used to delineate hydrogeomorphic regions (HGMR?s) for the study area. The HGMR?s are used to facilitate organization and display of the data and analyses. Illustrations depicting the relation of aquifer characteristics and associated residence times as a continuum for each HGMR were developed. In this way, the natural variation of aquifer characteristics can be seen graphically by use of data from selected representative studies. Water samples collected in September and November 1996, from 46 springs throughout the watershed were analyzed for chlorofluorocarbons (CFC?s) to estimate the apparent age of ground water. For comparison purposes, apparent ages of water from springs were calculated assuming piston flow. Additi-onal data are given to estimate apparent ages assuming an exponential distribution of ages in spring discharge. Additionally, results from previous studies of CFC-dating of ground water from other springs and wells in the watershed were compiled. The CFC data, and the data on major ions, nutrients, and nitrogen isotopes in the water collected from the 46 springs are included in this report. The apparent ages of water