WorldWideScience

Sample records for cfc

  1. Chlorofluorocarbons: CFC-11, CFC-12, CFC-113, HCFC-21, HCFC-31, HCFC-133a

    DEFF Research Database (Denmark)

    Bredsdorff, Lea; Nielsen, Else

    The Danish EPA has requested documentation for health-based quality criteria in air and groundwater for the following six chlorofluorocarbons: CFC-11, CFC-12, HCFC-21, HCFC-31, CFC-113 (1,1,2-trichloro-1,2,2-trifluoroethane) and HCFC-133a (1-chloro-2,2,2-trifluoroethane). A concern for toxic...

  2. Atlantic CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    R. Steinfeldt

    2010-01-01

    Full Text Available Water column data of carbon and carbon-relevant parameters have been collected and merged into a new database called CARINA (CARbon IN the Atlantic. In order to provide a consistent data set, all data have been examined for systematic biases and adjusted if necessary (secondary quality control (QC. The CARINA data set is divided into three regions: the Arctic/Nordic Seas, the Atlantic region and the Southern Ocean. Here we present the CFC data for the Atlantic region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113 as well as carbon tetrachloride (CCl4. The methods applied for the secondary quality control, a crossover analyses, the investigation of CFC ratios in the ocean and the CFC surface saturation are presented. Based on the results, the CFC data of some cruises are adjusted by a certain factor or given a "poor'' quality flag.

  3. CFC Outdoor Tournament 2011

    CERN Multimedia

    2011-01-01

    Regardless of whether you’re a fan of the "beautiful game", you’ve probably heard that the CFC Outdoor Tournament 2011 is the sporting event of the year for the CERN Football Club. This unmissable social, cultural and sporting event will be a chance for CERNois to mingle with external visitors. In the 2011 edition of this legendary tournament, which is over 45 years old, the principle of “fair play” is once again on display. Ten teams – 8 from CERN – are competing for the CFC title. The tournament concludes with a final on 7 July final. Along with a thrilling match, there will also be a host of festivities for the final, including an exhibition game, the final awards ceremony, surprise gifts, a barbeque, musical performances, and more! Make sure to highlight 7 July (after 18.00) on your agenda, and take advantage of what will surely be an unforgettable day! The final tournament matches have been in progress since April and are ...

  4. Study of groundwater mixing using CFC data

    Institute of Scientific and Technical Information of China (English)

    韩良丰; 庞忠和

    2001-01-01

    CFCs (Chlorofluorocarbons) are sensitive tools in the study of groundwater mixing. Based on results of CFC concentrations, the extent of mixing can be identified by three methods: 1. discrepancy between apparent ages determined by individual CFC compounds; 2. inconsistency between CFC concentration ratios and their respective apparent ages; and 3. correlation between the concentrations of two CFC compounds for a group of samples. The principle of determination of mixing ratios and apparent CFC water age in the case of a two component mixing of CFC-containing water with CFC-free water is described.

  5. Simplified CFC sampling method and spreadsheet based CFC data evaluation

    International Nuclear Information System (INIS)

    Several sampling methods exist to collect groundwater samples for CFC analysis. The established methods like sealing water samples in glass ampoules, using field-crimped copper tubes or taking large volume samples in glass bottles have some drawbacks when intended to be applied worldwide at remote locations without special trained staff. After establishment of a CFC analysis facility at IAEA, efforts were undertaken to develop a more robust and simple technique for CFC sampling. The method developed at IAEA uses commercial 50 ml glass bottles with plastic caps. In order to prevent the sample contamination via CFCs absorbed in the plastic cap, a round metal foil liner of laboratory grade aluminum is placed into the inside of the plastic cap. After extensive flushing of both bottle and cap with sample water in a metal container, the bottle is sealed under water with the cap. The glass bottle and the metal-foil liner provide a gas-tight sealing suitable for sample storage of more than one year. Essential for a successful sampling is the absence of any visible air bubble in the bottle directly after sampling, which of course can be easily checked. The method facilitates the strongly recommended custom to take multiple samples at each sampling site, being cheap and using small sized samples. Altogether five different sampling techniques with several variations were tested during a field experiment at a remote site at the Reichenkar glacier mound in the Oetztal region, Western Alps, Austria. The suitability of the sampling method described above was verified by those results and was further on extensively tested with CFC free water stored for extended time periods before analysis. For easy evaluation of measured CFC data it was desired to have available a suitable spreadsheet program. QCFC ('Quick-CFC') is an easy-to-use interactive Excel spreadsheet program for carrying out quick calculations in hydrologic studies using chlorofluorocarbons as time-dependent tracers

  6. Detected CFCs: UV Absorption Spectra, Atmospheric Lifetimes, Global Warming and Ozone Depletion Potentials for CFC-112, CFC-112a, CFC-113a and CFC-114a

    Science.gov (United States)

    Bernard, F.; Davis, M. E.; McGillen, M.; Fleming, E. L.; Burkholder, J. B.

    2015-12-01

    Chlorofluorocarbons (CFCs) are ozone depleting substances (ODSs) and potent greenhouse gases. Measurements have observed CFC-112 (CFCl2CFCl2), CFC-112a (CF2ClCCl3), and CFC-113a (CCl3CF3) in the atmosphere (Laube et al., 2014). The current atmospheric abundances of CFC-112 and CFC-112a are ~0.4 and ~0.06 ppt, respectively, with decreasing abundance since 1995. In contrast, CFC-113a was found to show continuous growth over the past 50 years with a current atmospheric abundance of ~0.5 ppt. The major atmospheric removal process for these compounds is expected to be UV photolysis in the stratosphere. To date there is, however, no UV absorption spectra for these compounds available in the literature. To better determine the atmospheric lifetimes and environmental impact of these CFCs, laboratory measurements of the UV absorption spectra of CFC-112, CFC-112a, CFC-113a, and CFC-114a (Cl2FCF3) between 195 and 235 nm and over the temperature range 207 to 323 K were performed. Spectrum parametrizations were developed for use in atmospheric models. Atmospheric lifetimes and ozone depletion potentials (ODPs) were calculated using the Goddard Space Flight Center 2-D atmospheric chemistry model. Infrared absorption spectra of these compounds were also measured and used to calculate their global warming potentials. The results of the laboratory measurements and model calculations will be presented. J. C. Laube et al., Newly detected ozone-depleting substances in the atmosphere, Nature Geoscience, 7, 266-269, 2014

  7. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2014-06-01

    Full Text Available Chlorofluorocarbons (CFCs play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their global loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer-tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11 and CF2Cl2 (CFC-12. We present estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 yr for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS, the HIgh Resolution Dynamics Limb Sounder (HIRDLS, and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. We found a CFC-11/CFC-12 lifetime ratio of 0.47±0.08 and a CFC-12 lifetime of 111(96–132 yr for ACE-FTS, a ratio of 0.46±0.07 and a lifetime of 112(97–133 yr for HIRDLS, and a ratio of 0.46±0.08 and a lifetime of 112(96–135 yr for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.47±0.04 and the CFC-12 lifetime estimate is 112(102–123 yr. These results agree with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC reassessment, which recommends lifetimes of 52(43–67 yr and 102(88–122 yr, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled model we found a CFC-11/CFC-12 lifetime ratio of 0.48±0.07 and a CFC-12 lifetime of 110(95–129 yr, based on

  8. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2014-11-01

    Full Text Available Chlorofluorocarbons (CFCs play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their stratospheric loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer–tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11 and CF2Cl2 (CFC-12. We present estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 years for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS, the HIgh Resolution Dynamics Limb Sounder (HIRDLS, and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS. We found a CFC-11/CFC-12 lifetime ratio of 0.47±0.08 and a CFC-12 lifetime of 112(96–133 years for ACE-FTS, a ratio of 0.46±0.07 and a lifetime of 113(97–134 years for HIRDLS, and a ratio of 0.46±0.08 and a lifetime of 114(98–136 years for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.46±0.04 and the CFC-12 lifetime estimate is 113(103–124 years. These results agree with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC reassessment, which recommends lifetimes of 52(43–67 years and 102(88–122 years, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled model we found a CFC-11/CFC-12 lifetime ratio of 0.48±0.07 and a CFC-12 lifetime

  9. Dicty_cDB: CFC502 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nlffycfkyff*neknniifnsttciiiw*n*itfiyemcglgfwfkfmc sipkkl*il*ttrrwflipkr*ihktipn*igsim*pstkkkffnyqsl*fktsng...qrnii*hvli**fpvevhiitmnhkdhleknthkdhlvknfkekkdkei kknkp*eerdkmmsilnckekkkenkcnvi*reklqqkspeninqpfsnil*emvnwken...5 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116982 |AC116982.2 Dictyostelium di...ive seq. ID CFC502P (Link to Original site) Representative DNA sequence >CFC502 (CFC502Q) /CSM/CF/CFC5-A/CFC...kfps wskdlptmaskkpcdcikswyr*flpfskndigcsrrsksrcilpkfnpfkpiwklykil *kyk*cnmycmf*ftngy--- ---ssiflgv*skgilfnmc

  10. Atmospheric Abundances, Trends and Emissions of CFC-216ba, CFC-216ca and HCFC-225ca

    Directory of Open Access Journals (Sweden)

    Corinna Kloss

    2014-06-01

    Full Text Available The first observations of the feedstocks, CFC-216ba (1,2-dichlorohexafluoropropane and CFC-216ca (1,3-dichlorohexafluoropropane, as well as the CFC substitute HCFC-225ca (3,3-dichloro-1,1,1,2,2-pentafluoropropane, are reported in air samples collected between 1978 and 2012 at Cape Grim, Tasmania. Present day (2012 mixing ratios are 37.8 ± 0.08 ppq (parts per quadrillion; 1015 and 20.2 ± 0.3 ppq for CFC-216ba and CFC-216ca, respectively. The abundance of CFC-216ba has been approximately constant for the past 20 years, whilst that of CFC-216ca is increasing, at a current rate of 0.2 ppq/year. Upper tropospheric air samples collected in 2013 suggest a further continuation of this trend. Inferred annual emissions peaked 421 at 0.18 Gg/year (CFC-216ba and 0.05 Gg/year (CFC-216ca in the mid-1980s and then decreased sharply as expected from the Montreal Protocol phase-out schedule for CFCs. The atmospheric trend of CFC-216ca and CFC-216ba translates into continuing emissions of around 0.01 Gg/year in 2011, indicating that significant banks still exist or that they are still being used. HCFC-225ca was not detected in air samples collected before 1992. The highest mixing ratio of 52 ± 1 ppq was observed in 2001. Increasing annual emissions were found in the 1990s (i.e., when HCFC-225ca was being introduced as a replacement for CFCs. Emissions peaked around 1999 at about 1.51 Gg/year. In accordance with the Montreal Protocol, restrictions on HCFC consumption and the short lifetime of HCFC-225ca, mixing ratios declined after 2001 to 23.3 ± 0.7 ppq by 2012.

  11. Stratospheric lifetime ratio of CFC-11 and CFC-12 from satellite and model climatologies

    Science.gov (United States)

    Hoffmann, Lars; Hoppe, Charlotte; Müller, Rolf; Dutton, Geoffrey S.; Gille, John C.; Griessbach, Sabine; Jones, Ashley; Meyer, Catrin I.; Spang, Reinhold; Volk, C. Michael; Walker, Kaley A.

    2015-04-01

    Chlorofluorocarbons (CFCs) play a key role in stratospheric ozone loss and are strong infrared absorbers that contribute to global warming. The stratospheric lifetimes of CFCs are a measure of their stratospheric loss rates that are needed to determine global warming and ozone depletion potentials. We applied the tracer-tracer correlation approach to zonal mean climatologies from satellite measurements and model data to assess the lifetimes of CFCl3 (CFC-11) and CF2Cl2 (CFC-12). We present new estimates of the CFC-11/CFC-12 lifetime ratio and the absolute lifetime of CFC-12, based on a reference lifetime of 52 yr for CFC-11. We analyzed climatologies from three satellite missions, the Atmospheric Chemistry Experiment-Fourier Transform Spectrometer (ACE-FTS), the HIgh Resolution Dynamics Limb Sounder (HIRDLS), and the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS). We found a CFC-11/CFC-12 lifetime ratio of 0.47 ± 0.08 and a CFC-12 lifetime of 112(96 - 133) yr for ACE-FTS, a ratio of 0.46 ± 0.07 and a lifetime of 113(97 - 134) yr for HIRDLS, and a ratio of 0.46 ± 0.08 and a lifetime of 114(98 - 136) yr for MIPAS. The error-weighted, combined CFC-11/CFC-12 lifetime ratio is 0.46 ± 0.04 and the CFC-12 lifetime estimate is 113(103 - 124) yr. These results are in excellent agreement with the recent Stratosphere-troposphere Processes And their Role in Climate (SPARC) reassessment, which recommends lifetimes of 52(43 - 67) yr for CFC-11 and 102(88 - 122) yr for CFC-12, respectively. Having smaller uncertainties than the results from other recent studies, our estimates can help to better constrain CFC-11 and CFC-12 lifetime recommendations in future scientific studies and assessments. Furthermore, the satellite observations were used to validate first simulation results from a new coupled model system, which integrates a Lagrangian chemistry transport model into a climate model. For the coupled EMAC/CLaMS model we found a CFC-11/CFC-12 lifetime ratio

  12. Chlorine isotope composition in chlorofluorocarbons CFC-11, CFC-12 and CFC-113 in firn, stratospheric and tropospheric air

    Directory of Open Access Journals (Sweden)

    S. J. Allin

    2014-12-01

    Full Text Available The stratospheric degradation of chlorofluorocarbons (CFCs releases chlorine, which is a major contributor to the destruction of stratospheric ozone (O3. A recent study reported strong chlorine isotope fractionation during the breakdown of the most abundant CFC (CFC-12, CCl2F2, similar to effects seen in nitrous oxide (N2O. Using air archives to obtain a long-term record of chlorine isotope ratios in CFCs could help to identify and quantify their sources and sinks. We analyse the three most abundant CFCs and show that CFC-11 (CCl3F and CFC-113 (CClF2CCl2F exhibit significant stratospheric chlorine isotope fractionation, in common with CFC-12. The apparent isotope fractionation (ϵapp for mid- and high-latitude stratospheric samples are (−2.4 ± 0.5 and (−2.3 ± 0.4‰ for CFC-11, (−12.2 ± 1.6 and (−6.8 ± 0.8‰ for CFC-12 and (−3.5 ± 1.5 and (−3.3 ± 1.2‰ for CFC-113, respectively. Assuming a constant source isotope composition, we estimate the expected trends in the tropospheric isotope signature of these gases due to their stratospheric 37Cl enrichment and stratosphere–troposphere exchange. We compare these model results to the long-term δ(37Cl trends of all three CFCs, measured on background tropospheric samples from the Cape Grim air archive (Tasmania, 1978–2010 and tropospheric firn air samples from Greenland (NEEM site and Antarctica (Fletcher Promontory site. Model trends agree with tropospheric measurements within analytical uncertainties. From 1970 to the present-day, we find no evidence for variations in chlorine isotope ratios associated with changes in CFC manufacturing processes. Our study increases the suite of trace gases amenable to direct isotope ratio measurements in small air volumes, using a single-detector gas chromatography-mass spectrometry system.

  13. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC INCINERATION

    Science.gov (United States)

    The report gives results of the collection of combustion emission characterization data from chlorofluorocarbon (CFC) incineration. A bench scale test program to provide emission characterization data from CFC incineration was developed and performed, with emphasis on the format...

  14. Dicty_cDB: CFC290 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC290 (Link to dictyBase) - - - Contig-U16382-1 CFC290E (Link to Original ... ctnlrrlcittcyftfrfsws*sy*lhdenln*twllihnnc*krnr*ry*reis ... ircigf*s*nancsliicireii*itrwssyynw**tfplsrstfptiil ...

  15. Dicty_cDB: CFC279 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC279 (Link to dictyBase) - - - Contig-U16477-1 CFC279P (Link to Original ... sirerffigfgtwhwwctsfsqss*ti*lcisitllvatyss*yv*tlvl crn *sfmrtqisiikhwsrsksystmskrw*nya*ystsnskksw**lgwffry ...

  16. Dicty_cDB: CFC658 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC658 (Link to dictyBase) - - - Contig-U16291-1 CFC658P (Link to Original ... mino Acid sequence KIWVLTGDKQETAINIGFSCHLLTSDMRIIILNGS NQEDVHNQIQGAIDAYFSDDAENHQ NSGFALVVEGSCLNFALEGELKSVF ... klwlcigcrrfmsklclgrrieigfp*igcql*icyllsyhstsksssc*ngs *yitcry ignwxwckrcfydsssshwywy*ws*gyassygirlfdcti*f ... xxexnx*xg Frame B: KIWVLTGDKQETAINIGFSCHLLTSDMRIIILNGS NQEDVHNQIQGAIDAYFSDDAENHQ NSGFALVVEGSCLNFALEGELKSVF ... XLTW Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CFC658 (CFC658 ...

  17. 76 FR 72452 - CFC-50 Commission

    Science.gov (United States)

    2011-11-23

    ... MANAGEMENT CFC-50 Commission AGENCY: Office of Personnel Management. ACTION: Establishment of advisory.... Please contact the Office of Personnel Management at the address shown below if you wish to present..., 2011 at 2 p.m. Location: U.S. Office of Personnel Management, Theodore Roosevelt Executive...

  18. Stratospheric loss and atmospheric lifetimes of CFC-11 and CFC-12 derived from satellite observations

    Directory of Open Access Journals (Sweden)

    K. Minschwaner

    2012-11-01

    Full Text Available The lifetimes of CFC-11 and CFC-12 have been evaluated using global observations of their stratospheric distributions from satellite-based instruments between the period 1992 and 2010. The CFC data sets are from the Cryogen Limb Array Etalon Spectrometer (CLAES, the Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA-1 and CRISTA-2, the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS, and the Atmospheric Chemistry Experiment (ACE. Stratospheric loss rates were calculated using an ultraviolet radiative transfer code with updated cross section and solar irradiance data. Mean steady state lifetimes based on these observations are 50.3 ± 16.8 yr for CFC-11 and 106.9 ± 21.7 yr for CFC-12, which are in reasonable agreement with the most recent WMO Ozone Assessment recommendations but are somewhat longer by 12% and 7%, respectively. There are two major sources of error in calculating lifetimes using this method. One error source is due to uncertainties in tropical stratospheric measurements, particularly for CFC-11. Another large contribution to the error arises from uncertainties in the penetration of solar ultraviolet radiation at wavelengths between 185 and 220 nm, primarily in the tropical stratosphere between 20 and 35 km altitude.

  19. Stratospheric loss and atmospheric lifetimes of CFC-11 and CFC-12 derived from satellite observations

    Directory of Open Access Journals (Sweden)

    K. Minschwaner

    2013-04-01

    Full Text Available The lifetimes of CFC-11 and CFC-12 have been evaluated using global observations of their stratospheric distributions from satellite-based instruments over the time period from 1992 to 2010. The chlorofluorocarbon (CFC datasets are from the Cryogen Limb Array Etalon Spectrometer (CLAES, the Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA-1 and CRISTA-2, the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS, and the Atmospheric Chemistry Experiment (ACE. Stratospheric loss rates were calculated using an ultraviolet radiative transfer code with updated cross section and solar irradiance data. Mean steady-state lifetimes based on these observations are 44.7 (36–58 yr for CFC-11 and 106.6 (90–130 yr for CFC-12, which are in good agreement with the most recent WMO ozone assessment. There are two major sources of error in calculating lifetimes using this method. The first important error arises from uncertainties in tropical stratospheric observations, particularly for CFC-11. Another large contribution to the error is due to uncertainties in the penetration of solar ultraviolet radiation at wavelengths between 185 and 220 nm, primarily in the tropical stratosphere between 20 and 35 km altitude.

  20. International research into chlorofluorocarbon (CFC) alternatives

    Energy Technology Data Exchange (ETDEWEB)

    Marseille, T.J.; Shankle, D.L.; Thurman, A.G.

    1992-05-01

    Selected researchers from 21 countries were queried through questionnaires about their current and planned research activities. The results of the survey show that the majority of research being conducted by the respondents is devoted to investigating the hydrogenated fluorocarbon HFC-134a as a replacement for CFC-12 in refrigeration applications. The main issue with this alternative is identifying compatible lubricants that do not reduce its effectiveness.

  1. "Annan finansiell verksamhet" - En tolkning i ljuset av CFC-lagstiftningen : En tolkning i ljuset av CFC-lagstiftningen

    OpenAIRE

    Kiryo, Josef

    2010-01-01

    The initial provisions concerning CFC-legislation were introduced 1990 and has since been subject to several revisions and adaptations. The fundamental purpose of the CFC-legislation is to prohibit and prevent tax evasion undertaken by such companies that own other foreign companies where generated income is subject to low rates of taxation. The CFC-legislation aims to provide the Swedish government with an op-portunity to tax this income. This is important in order to prevent tax avoidance a...

  2. CFC concentrations in fresh groundwater in Latvia

    Science.gov (United States)

    Bikše, J.; DÄ`liĆa, A.; Babre, A.; RetiÄ·e, I.; Raga, B.; PÄ`rkone, E.

    2012-04-01

    One of the main issues in groundwater studies is groundwater age, also known as residence time. This is important for investigating the groundwater filtration rate and to solve variety issues of groundwater use, management and protection. Groundwater age studies in Latvia have been rare, and the latest study, which defined the new results of age of groundwater using CFC dating method, was during years 2002 - 2006 and it was carried out by Denmark and Greenland Geological Survey (GEUS) and the Latvian State Geological Survey as a joint study on the impact of agriculture on groundwater quality in Latvia. Within the project "Interdisciplinary research groups and model system for groundwater studies" (PUMA) the studies of groundwater age by CFCs and 3H methods is continued. The concentration of tritium will be determined in about 60 samples, but the CFC concentration is now analyzed in 39 samples because previous studies have shown that Latvian CFC method is appropriate for aquifers to an average depth of 30-50 m. CFCs concentrations were analyzed in the laboratory at GEUS after Busenberg and Plummer described method by gas chromatography equipped with an EDC detector. Interpretation of the results was carried out by laboratory expert Troels Laier. Samples are taken on both from the unconfined aquifer and the first confined aquifer, the sampling interval varies from 5-10 m up to 120-130 m for tritium analysis and up to 80 m depth for most CFC analysis except one sample that comes from 128 m depth. It is stated that most of determined groundwater from both - confined and unconfined aquifer - has residence time of 35-55 years. So far, the results suggest that groundwater movement is fairly rapid in places where fractured dolomite forms the aquifer as the water residence time at 60-70 m depth is only 35-55 years. On the other hand, the composition of overlying Quaternary deposits (clay, glacial till loam or sand, sand - gravel sediments) has great importance on variations

  3. Dicty_cDB: CFC301 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC301 (Link to dictyBase) - - - Contig-U12859-1 | Contig-U16301-1 CFC301P ... kg*kycickw*qyyy* kckesngsryll*tsmsnhcckvctkw*lyckw*csr *ftylgyitkgtylksnlqsiew cnp*ycmdir*stfscsw*w*reiwcs ...

  4. Dicty_cDB: CFC347 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC347 (Link to dictyBase) - - - Contig-U12859-1 | Contig-U16301-1 CFC347P ... kg*kycickw*qyyy *kckesngsryll*tsmsnhcckvctkw*lyckw*csr *ftylgyitkgtylksnlqsie wcnp*ycmdir*stfscsw*w*reiwcs ...

  5. Dicty_cDB: CFC325 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC325 (Link to dictyBase) - - - Contig-U16240-1 CFC325P (Link to Original ... il**mvq***slfklffkls irsrslg*f*ynrwwwtictn*wcwiw*p*sip *vck*siqsvslf*assliystr*i*- -- ---vhmk*fqivnvtlqlvs ...

  6. Dicty_cDB: CFC602 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC602 (Link to dictyBase) - - - Contig-U16240-1 CFC602P (Link to Original ... sfnkwfnsddlcsnyflsyq ldldlwdkf*ynrwwwtictn*wcwiw*p*sip *vck*siqsvslf*assliystr*i** lfpffnyg*nlgflq*yfns*ss ...

  7. Release of CFC-11 from disposal of polyurethane foam waste

    DEFF Research Database (Denmark)

    Kjeldsen, Peter; Jensen, M.H.

    2001-01-01

    The halocarbon CFC-11 has extensively been used as a blowing agent for polyurethane (PUR) insulation foams in home appliances and for residential and industrial construction. Release of CFCs is an important factor in the depletion of the ozone layer. For CFC-11 the future atmospheric concentrations...

  8. Dicty_cDB: CFC537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC537 (Link to dictyBase) - - - Contig-U16463-1 CFC537P (Link to Original ... d process for preparing catalase using the genetic engineering ... technology. 86 1e-32 4 AP004595 |AP004595.1 Oceano ...

  9. Dicty_cDB: CFC557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC557 (Link to dictyBase) - - - Contig-U16243-1 CFC557P (Link to Original ... o... 403 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 243 e-113 AM474896_9( AM4 ...

  10. Dicty_cDB: CFC614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC614 (Link to dictyBase) - - - Contig-U16243-1 CFC614P (Link to Original ... o... 753 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 411 e-113 AM474896_9( AM4 ...

  11. Dicty_cDB: CFC892 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC892 (Link to dictyBase) - - - Contig-U16243-1 CFC892P (Link to Original ... o... 694 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 385 e-105 AM474896_9( AM4 ...

  12. Dicty_cDB: CFC445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC445 (Link to dictyBase) - - - Contig-U16243-1 CFC445E (Link to Original ... o... 760 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 419 e-116 AM474896_9( AM4 ...

  13. Dicty_cDB: CFC529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC529 (Link to dictyBase) - - - Contig-U16243-1 CFC529E (Link to Original ... o... 758 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 416 e-115 AM474896_9( AM4 ...

  14. Dicty_cDB: CFC254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce kylflflfffiifqhnni*l*FGINSVIFVFFFFXKGGXWVX--- Translated Amino Acid sequence (All Frames) Frame A: iniyfyfyffl*fsnit...s) Value N L16578 |L16578.1 Dictyostelium discoideum HIV1 TAT-binding protein homologous protein mRNA, complete...CF (Link to library) CFC254 (Link to dictyBase) - - - Contig-U15589-1 CFC254F (Link to Original site...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL http://dict...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-C/CFC254Q.Seq.d/ Representative seq. ID CFC254F (Link to Original site

  15. Alternative non-CFC mobile air conditioning

    Energy Technology Data Exchange (ETDEWEB)

    Mei, V.C.; Chen, F.C.; Kyle, D.M.

    1992-09-01

    Concern about the destruction of the global environment by chlorofluorocarbon (CFC) fluids has become an impetus in the search for alternative, non-CFC refrigerants and cooling methods for mobile air conditioning (MAC). While some alternative refrigerants have been identified, they are not considered a lasting solution because of their high global warming potential, which could result in their eventual phaseout. In view of this dilemma, environmentally acceptable alternative cooling methods have become important. This report, therefore, is aimed mainly at the study of alternative automotive cooling methodologies, although it briefly discusses the current status of alternative refrigerants. The alternative MACs can be divided into work-actuated and heat-actuated systems. Work-actuated systems include conventional MAC, reversed Brayton air cycle, rotary vane compressor air cycle, Stirling cycle, thermoelectric (TE) cooling, etc. Heat-actuated MACs include metal hydride cooling, adsorption cooling, ejector cooling, absorption cycle, etc. While we are better experienced with some work-actuated cycle systems, heat-actuated cycle systems have a high potential for energy savings with possible waste heat applications. In this study, each altemative cooling method is discussed for its advantages and its limits.

  16. CFC elimination and replacement in China; Elimination et remplacement des CFC en Chine

    Energy Technology Data Exchange (ETDEWEB)

    Bingfeng, Y.; Yezheng, W.; Zhigang, W. [School of Energy and Power Engineering, Xi' an Jiaotong University (China)

    2002-07-01

    This paper describes the position, policy and goals of the Chinese government with respect to the protection of the ozone layer and to the suppression of ozone-damaging compounds. It presents the implementation of the programs and the realizations relative to the elimination of CFCs and other ozone-damaging substances in domestic refrigerating appliances, in air conditioners for cars and in the solvent cleaning industry. It suggests some measures to answer the challenge of CFC replacement. (J.S.)

  17. CFC and HFC recycling equipments: Test performances

    International Nuclear Information System (INIS)

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid

  18. Dicty_cDB: CFC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC263 (Link to dictyBase) - - - Contig-U16068-1 CFC263P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 2e-07 3 BD365137 |BD365137.1 Newly fou ...

  19. Dicty_cDB: CFC364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC364 (Link to dictyBase) - - - Contig-U16068-1 CFC364P (Link to Original ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365143 |BD365143.1 Newly fou ... ingle nucleotide polymorphisms (SNPs) on genes and use ... thereof. 44 3e-07 3 BD365137 |BD365137.1 Newly fou ...

  20. UV and infrared absorption spectra, atmospheric lifetimes, and ozone depletion and global warming potentials for CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), CCl3CF3 (CFC-113a), and CCl2FCF3 (CFC-114a)

    Science.gov (United States)

    Davis, Maxine E.; Bernard, François; McGillen, Max R.; Fleming, Eric L.; Burkholder, James B.

    2016-07-01

    The potential impact of CCl2FCF3 (CFC-114a) and the recently observed CCl2FCCl2F (CFC-112), CCl3CClF2 (CFC-112a), and CCl3CF3 (CFC-113a) chlorofluorocarbons (CFCs) on stratospheric ozone and climate is presently not well characterized. In this study, the UV absorption spectra of these CFCs were measured between 192.5 and 235 nm over the temperature range 207-323 K. Precise parameterizations of the UV absorption spectra are presented. A 2-D atmospheric model was used to evaluate the CFC atmospheric loss processes, lifetimes, ozone depletion potentials (ODPs), and the associated uncertainty ranges in these metrics due to the kinetic and photochemical uncertainty. The CFCs are primarily removed in the stratosphere by short-wavelength UV photolysis with calculated global annually averaged steady-state lifetimes (years) of 63.6 (61.9-64.7), 51.5 (50.0-52.6), 55.4 (54.3-56.3), and 105.3 (102.9-107.4) for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. The range of lifetimes given in parentheses is due to the 2σ uncertainty in the UV absorption spectra and O(1D) rate coefficients included in the model calculations. The 2-D model was also used to calculate the CFC ozone depletion potentials (ODPs) with values of 0.98, 0.86, 0.73, and 0.72 obtained for CFC-112, CFC-112a, CFC-113a, and CFC-114a, respectively. Using the infrared absorption spectra and lifetimes determined in this work, the CFC global warming potentials (GWPs) were estimated to be 4260 (CFC-112), 3330 (CFC-112a), 3650 (CFC-113a), and 6510 (CFC-114a) for the 100-year time horizon.

  1. CFC environmental problems and cooling technology

    International Nuclear Information System (INIS)

    The aim of the report is to provide a broad survey of the technological problems imposed on the production of cooling systems by the demands for reduction in the use of chlorofluorocarbons as refrigerants. With regard to industrial research in this area the present situation is clarified and possible future developments are discussed. The influence of CFC gasses on the global environment and international and national legislation within this field are explained. Alternative refrigerants and cooling processes, and ways of reducing refrigerant leakage, are described. It is concluded that currently the use of alternative refrigerants is the policy which is generally accepted, and intensive research is being carried out in this field. R134a should substitute R12 in the cases of household refrigerators and air conditioning, and will soon be commercially available. The use of R22 and ammonia will be extended. This is a practical policy to follow up commercially, whereas the policy of alternative processes presents more problems because they are not so developed and there is less available know-how in this area. The possibilities for hermetic sealing of cooling systems are unrealistic and should anyway be regarded only as a supplement to alternative refrigerants. Within the European Community it is intended to provide standards and regulations in relation to air pollution from refrigerants. (AB) (58 refs.)

  2. Envisat MIPAS measurements of CFC-11: retrieval, validation, and climatology

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2008-03-01

    Full Text Available From July 2002 to March 2004 the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS aboard the European Space Agency's Environmental Satellite (Envisat measured nearly continuously mid infrared limb radiance spectra. These measurements are utilised to retrieve the global distribution of the chlorofluorocarbon CFC-11 by applying a new fast forward model for Envisat MIPAS and an accompanying optimal estimation retrieval processor. A detailed analysis shows that the total retrieval errors of the individual CFC-11 volume mixing ratios are typically below 10% and that the systematic components are dominating. Contribution of a priori information to the retrieval results are less than 5 to 10%. The vertical resolution of the observations is about 3 to 4 km. The data are successfully validated by comparison with several other space experiments, an air-borne in-situ instrument, measurements from ground-based networks, and independent Envisat MIPAS analyses. The retrieval results from 425 000 Envisat MIPAS limb scans are compiled to provide a new climatological data set of CFC-11. The climatology shows significantly lower CFC-11 abundances in the lower stratosphere compared with the Reference Atmospheres for MIPAS (RAMstan V3.1 climatology. Depending on the atmospheric conditions the differences between the climatologies are up to 30 to 110 ppt (45 to 150% at 19 to 27 km altitude. Additionally, time series of CFC-11 mean abundance and variability for five latitudinal bands are presented. The observed CFC-11 distributions can be explained by the residual mean circulation and large-scale eddy-transports in the upper troposphere and lower stratosphere. The new CFC-11 data set is well suited for further scientific studies.

  3. Envisat MIPAS measurements of CFC-11: retrieval, validation, and climatology

    Directory of Open Access Journals (Sweden)

    L. Hoffmann

    2008-07-01

    Full Text Available From July 2002 to March 2004 the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS aboard the European Space Agency's Environmental Satellite (Envisat measured nearly continuously mid infrared limb radiance spectra. These measurements are utilised to retrieve the global distribution of the chlorofluorocarbon CFC-11 by applying a new fast forward model for Envisat MIPAS and an accompanying optimal estimation retrieval processor. A detailed analysis shows that the total retrieval errors of the individual CFC-11 volume mixing ratios are typically below 10% in the altitude range 10 to 25 km and that the systematic components dominate. Contribution of a priori information to the retrieval results are less than 5 to 10% and the vertical resolution of the observations is about 3 to 4 km in the same vertical range. The data are successfully validated by comparison with several other space experiments, an air-borne in-situ instrument, measurements from ground-based networks, and independent Envisat MIPAS analyses. The retrieval results from 425 000 Envisat MIPAS limb scans are compiled to provide a new climatological data set of CFC-11. The climatology shows significantly lower CFC-11 abundances in the lower stratosphere compared with the Reference Atmospheres for MIPAS (RAMstan V3.1 climatology. Depending on the atmospheric conditions the differences between the climatologies are up to 30 to 110 ppt (45 to 150% at 19 to 27 km altitude. Additionally, time series of CFC-11 mean abundance and variability for five latitudinal bands are presented. The observed CFC-11 distributions can be explained by the residual mean circulation and large-scale eddy-transports in the upper troposphere and lower stratosphere. The new CFC-11 data set is well suited for further scientific studies.

  4. Validation of ACE-FTS measurements of CFC-11, CFC-12, and HCFC-22 using ground-based FTIR spectrometers

    Science.gov (United States)

    Kolonjari, F.; Walker, K. A.; Mahieu, E.; Batchelor, R. L.; Bernath, P. F.; Boone, C.; Conway, S. A.; Dan, L.; Griffin, D.; Harrett, A.; Kasai, Y.; Kagawa, A.; Lindenmaier, R.; Strong, K.; Whaley, C.

    2013-12-01

    Satellite datasets can be an effective global monitoring tool for long-lived compounds in the atmosphere. The Atmospheric Chemistry Experiment (ACE) is a mission on-board the Canadian satellite SCISAT-1. The primary instrument on SCISAT-1 is a high-resolution infrared Fourier transform spectrometer (ACE-FTS) which is capable of measuring a range of gases including key chlorofluorocarbon (CFC) and hydrochlorofluorocarbon (HCFC) species. These families of species are of interest because of their significant contribution to anthropogenic ozone depletion and to global warming. To assess the quality of data derived from satellite measurements, validation using other data sources is essential. Ground-based Fourier transform infrared (FTIR) spectrometers are particularly useful for this purpose. In this study, five FTIR spectrometers located at four sites around the world are used to validate the CFC-11 (CCl3F), CFC-12 (CCl2F2), and HCFC-22 (CHClF2) retrieved profiles from ACE-FTS measurements. These species are related because HCFC-22 was the primary replacement for CFC-11 and CFC-12 in refrigerant and propellant applications. The FTIR spectrometers used in this study record solar absorption spectra at Eureka (Canada), Jungfraujoch (Switzerland), Poker Flat (USA), and Toronto (Canada). The retrieval of CFC-11, CFC-12, and HCFC-22 are not standard products for many of these instruments, and as such, a harmonization of retrieval parameters between the sites has been conducted. The retrievals of these species from the FTIR spectra are sensitive from the surface to approximately 20 km, while the ACE-FTS profiles extend from approximately 6 to 30 km. For each site, partial column comparisons between coincident measurements of the three species and a validation of the observed trends will be discussed.

  5. CONTROL TECHNOLOGY OVERVIEW REPORT: CFC-11 EMISSIONS FROM FLEXIBLE POLYURETHANE FOAM MANUFACTURING

    Science.gov (United States)

    The report gives results of an engineering evaluation of technical options to reduce chlorofluorocarbon (CFC) emissions from flexible slabstock and molded polyurethane foam manufacturing plants. Among the technical options studied were recovery and recycle of CFC-11, alternative ...

  6. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    OpenAIRE

    S. Tegtmeier; Hegglin, M. I.; Anderson, J; Funke, B.; Gille, J.; Jones, A; Smith, L; von Clarmann, T.; K. A. Walker

    2016-01-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991–2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal stru...

  7. EXPERIMENTAL INVESTIGATION OF PIC FORMATION IN CFC-12 INCINERATION

    Science.gov (United States)

    The report gives results of experiments to determine the effect of flame zone temperature on gas-phase flame formation and destruction of products of incomplete combustion (PICS) during dichlorodi-fluoromethane (CFC-12) incineration. The effect of water injection into the flame ...

  8. Nordic Seas and Arctic Ocean CFC data in CARINA

    Directory of Open Access Journals (Sweden)

    E. Jeansson

    2010-02-01

    Full Text Available Water column data of carbon and carbon relevant hydrographic and hydrochemical parameters have been retrieved from a large number of cruises and collected into a new database called CARINA (CARbon IN the Atlantic. These data have been merged into three sets of files, one for each of the three CARINA regions; the Arctic Mediterranean Seas (AMS, the Atlantic (ATL and the Southern Ocean (SO. The first part of the CARINA database consists of three files, one for each CARINA region, containing the original, non-adjusted cruise data sets, including data quality flags for each measurement. These data have then been subject to rigorous quality control (QC in order to ensure highest possible quality and consistency. The data for most of the parameters included were examined in order to quantify systematic biases in the reported values, i.e. secondary quality control. Significant biases have been corrected for in the second part of the CARINA data product. This consists of three files, one for each CARINA region, which contain adjustments to the original data values based on recommendations from the CARINA QC procedures, along with calculated and interpolated values for some missing parameters.

    Here we present an overview of the QC of the CFC data for the AMS region, including the chlorofluorocarbons CFC-11, CFC-12 and CFC-113, as well as carbon tetrachloride (CCl4. The Arctic Mediterranean Seas is comprised of the Arctic Ocean and the Nordic Seas, and the quality control was carried out separately in these two areas. For the secondary QC of the CFCs we used a combination of tools, including the evaluation of depth profiles and CFC ratios, surface saturations and a crossover analysis. This resulted in a multiplicative adjustment of data from some cruises, while other data were flagged to be of questionable quality, which excluded them from the final data product.

  9. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    Science.gov (United States)

    Tegtmeier, S.; Hegglin, M. I.; Anderson, J.; Funke, B.; Gille, J.; Jones, A.; Smith, L.; von Clarmann, T.; Walker, K. A.

    2016-02-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed intercomparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991-2010. The intercomparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudinal and temporal structure. The CFC evaluations (based on MIPAS, ACE-FTS and HIRDLS) reveal that the uncertainty in our knowledge of the atmospheric CFC-11 and CFC-12 mean state, as given by satellite data sets, is smallest in the tropics and mid-latitudes at altitudes below 50 and 20 hPa, respectively, with a 1σ multi-instrument spread of up to ±5 %. For HF, the situation is reversed. The two available data sets (HALOE and ACE-FTS) agree well above 100 hPa, with a spread in this region of ±5 to ±10 %, while at altitudes below 100 hPa the HF annual mean state is less well known, with a spread ±30 % and larger. The atmospheric SF6 annual mean states derived from two satellite data sets (MIPAS and ACE-FTS) show only very small differences with a spread of less than ±5 % and often below ±2.5 %. While the overall agreement among the climatological data sets is very good for large parts of the upper troposphere and lower stratosphere (CFCs, SF6) or middle stratosphere (HF), individual discrepancies have been identified. Pronounced deviations between the instrument climatologies exist for particular atmospheric regions which differ from gas to gas. Notable features are differently shaped isopleths in the subtropics, deviations in the vertical gradients in the lower stratosphere and in the meridional gradients in the upper troposphere, and inconsistencies in the seasonal cycle. Additionally, long-term drifts between the instruments have been identified for the CFC-11 and CFC-12 time series. The evaluations as a

  10. CHARACTERIZATION OF H-Y AND CR-Y ZEOLITE CATALYSTS DURING THE OXIDATIVE DESTRUCTION OF CFC11 AND CFC12

    Science.gov (United States)

    The long term stability-deactivation characteristics of two Y zeolite catalysts, namely H-Y and cation exchanged Cr-Y, were studied during the oxidative destruction of CFC11 and CFC12 feeds. Experiments were carried out at 300 degrees C and 500 h-1 space velocity. Properties of...

  11. Characterisation of Churn Flow Coalescers (CFC) in vertical pipes

    OpenAIRE

    Kanu, Aimé Uzochukwu

    2013-01-01

    The Gas-Liquid Cylindrical Cyclone (GLCC) separator is commonly used for the separation of oil and gas mixtures flowing from the well head. Similar to the design used by other separators, it has an inlet and two outlets for gas and liquid respectively. However, the inlet to the separator can either be single or dual type. The pipeline connection from the upstream preconditioning equipment (CFC) is inclined downwards and has a tangential inlet slot. The essence of having a downward inclination...

  12. Overview of CFC replacement issues for household refrigeration

    Science.gov (United States)

    Vineyard, E. A.; Roke, L.; Hallett, F.

    In 1974, the famous ozone depletion theory of Rowland and Molina claimed that chlorofluorocarbons (CFCs) diffuse into the stratosphere where they are broken down by photolysis to release chlorine atoms that catalytically destroy ozone. Although the understanding of the science is still imperfect, there is little doubt that CFCs play a major role in the Antarctic ozone hole phenomenon and the decline in ozone observed in the rest of the world. Another issue that has become increasingly important is the potential of CFCs to change the earth's temperature and to modify the climate. While the main impact in global warming is made by increased concentrations of carbon dioxide, CFCs and other trace gases also contribute to this effect. In an effort to respond to the global environmental threat, a CFC protocol was adopted during a diplomatic conference in Montreal. This document, known as the Montreal Protocol, was ratified in 1988 and put into effect on January 1, 1989. In accordance with Article 6 of the Montreal Protocol, the countries that signed the agreement shall periodically assess the control measures provided for in the Protocol. As part of that assessment process, household refrigeration was investigated to determine the status of CFC-12 replacements. The conclusion was that much progress has been made towards finding a suitable replacement. Compressors designed for HFC-134a have efficiencies comparable to those for CFC-12 and acceptable reliability tests have been obtained with ester lubricants. In addition, other replacements such as R-152a and refrigerant mixtures exist, but will require more study. Cycle options, such as the Stirling cycle, may be viable, but are further out in the future. The impact of new refrigerants is expected to result in elimination of CFC-12 consumption in developed countries by 1997 and in developing countries by 2005.

  13. Stratospheric ozone in the post-CFC era

    Directory of Open Access Journals (Sweden)

    F. Li

    2009-03-01

    Full Text Available Vertical and latitudinal changes in the stratospheric ozone in the post-chlorofluorocarbon (CFC era are investigated using simulations of the recent past and the 21st century with a coupled chemistry-climate model. Model results reveal that, in the 2060s when the stratospheric halogen loading is projected to return to its 1980 values, the extratropical column ozone is significantly higher than that in 1975–1984, but the tropical column ozone does not recover to 1980 values. Upper and lower stratospheric ozone changes in the post-CFC era have very different patterns. Above 15 hPa ozone increases almost latitudinally uniformly by 6 Dobson Unit (DU, whereas below 15 hPa ozone decreases in the tropics by 8 DU and increases in the extratropics by up to 16 DU. The upper stratospheric ozone increase is a photochemical response to greenhouse gas induced strong cooling, and the lower stratospheric ozone changes are consistent with enhanced mean advective transport due to a stronger Brewer-Dobson circulation. The model results suggest that the strengthening of the Brewer-Dobson circulation plays a crucial role in ozone recovery and ozone distributions in the post-CFC era.

  14. Stratospheric ozone in the post-CFC era

    Directory of Open Access Journals (Sweden)

    F. Li

    2008-12-01

    Full Text Available Vertical and latitudinal changes in the stratospheric ozone in the post-chlorofluorocarbon (CFC era are investigated using simulations of the recent past and the 21st century with a coupled chemistry-climate model. Model results reveal that, in the 2060s when the stratospheric halogen loading is projected to return to its 1980 values, the extratropical column ozone is significantly higher than that in 1975–1984, but the tropical column ozone does not recover to 1980 values. Upper and lower stratospheric ozone changes in the post-CFC era have very different patterns. Above 15 hPa ozone increases almost latitudinally uniformly by 6 Dobson Unit (DU, whereas below 15 hPa ozone decreases in the tropics by 8 DU and increases in the extratropics by up to 16 DU. The upper stratospheric ozone increase is a photochemical response to greenhouse gas induced strong cooling, and the lower stratospheric ozone changes are consistent with enhanced mean advective transport due to a stronger Brewer-Dobson circulation. The model results suggest that the strengthening of the Brewer-Dobson circulation plays a crucial role in ozone recovery and ozone distributions in the post-CFC era.

  15. Non-CFC air conditioning for transit buses

    Energy Technology Data Exchange (ETDEWEB)

    Pesaran, A.A.; Parent, Y.O.; Bharathan, D.

    1992-11-01

    In the United Sates, more than 80% of transit city buses are air conditioned. Vapor compression refrigeration systems are standard for air conditioning buses and account for up to 25% of fuel consumption in the cooling season. Vapor compression devices use chlorofluorocarbons (CFCs), chemicals that contributes to Earths`s ozone depletion and to global warming. Currently, evaporative cooling is an economical alternative to CFC vapor compression refrigeration for air conditioning buses. It does not use CFCs but is restricted in use to arid climates. This limitation can be eliminated by dehumidifying the supply air using desiccants. We studied desiccant systems for cooling transit buses and found that the use of a desiccant-assisted evaporative cooling system is feasible and can deliver the required cooling. The weight and the size of the desiccant system though larger than vapor compression systems, can be easily accommodated within a bus. Fuel consumption for naming desiccant systems was about 70% less than CFC refrigeration system, resulting in payback periods of less than 2.5 years under most circumstances. This preliminary study indicated that desiccant systems combined with evaporative cooling is a CFC-free option to vapor compression refrigeration for air conditioning of transit buses. The concept is ready to be tested in a fun prototype scale in a commercial bus.

  16. Non-CFC air conditioning for transit buses

    Energy Technology Data Exchange (ETDEWEB)

    Pesaran, A.A.; Parent, Y.O.; Bharathan, D.

    1992-11-01

    In the United Sates, more than 80% of transit city buses are air conditioned. Vapor compression refrigeration systems are standard for air conditioning buses and account for up to 25% of fuel consumption in the cooling season. Vapor compression devices use chlorofluorocarbons (CFCs), chemicals that contributes to Earths's ozone depletion and to global warming. Currently, evaporative cooling is an economical alternative to CFC vapor compression refrigeration for air conditioning buses. It does not use CFCs but is restricted in use to arid climates. This limitation can be eliminated by dehumidifying the supply air using desiccants. We studied desiccant systems for cooling transit buses and found that the use of a desiccant-assisted evaporative cooling system is feasible and can deliver the required cooling. The weight and the size of the desiccant system though larger than vapor compression systems, can be easily accommodated within a bus. Fuel consumption for naming desiccant systems was about 70% less than CFC refrigeration system, resulting in payback periods of less than 2.5 years under most circumstances. This preliminary study indicated that desiccant systems combined with evaporative cooling is a CFC-free option to vapor compression refrigeration for air conditioning of transit buses. The concept is ready to be tested in a fun prototype scale in a commercial bus.

  17. Interannual variability of CFC-11 absorption by the ocean: an offline model study

    Energy Technology Data Exchange (ETDEWEB)

    Valsala, Vinu; Maksyutov, Shamil [CGER, National Institute for Environmental Studies, Tsukuba (Japan); Alsibai, Hayyan M. [Tsukuba University, Graduate School of System and Information Engineering, Tsukuba (Japan); Ikeda, Motoyoshi [Hokkaido University, Graduate School of Earth System Sciences, Sapporo (Japan)

    2011-04-15

    The global ocean Chlorofluorocarbon (CFC-11) was simulated in an offline model driven by re-analysis ocean currents in order to identify the mechanisms of interannual to interdecadal variability of air-sea CFC fluxes. The model was forced with the observed anthropogenic perturbations of atmospheric CFC-11 from the post industrial period (1938) following the OCMIP-II flux protocols along with the observed winds from 1960 to 1999 in the formulation of surface gas exchanges. The model ocean CFC-11 inventories, at the end of 1990s, accounted approximately 1% of the total atmospheric CFC-11, which is consistent with the corresponding observations. The mid-to-high latitude oceans were venue for strong (weak) oceanic sinks (sources) of CFC-11 during the winter (summer) months. The Southern Ocean (south of 40 S) and the North Atlantic (north of 35 N) provided two largest sinks of CFC-11, through which 31.4 and 14.6% of the global ocean CFC-11 entered, respectively. The eastern tropical Pacific Ocean exhibited large interannual variability of CFC-11 flux with a strong (weak) sink during La Nina (El Nino) years and represented 36% of the global CFC-11 flux variability. The North Atlantic and Southern Ocean were found as regions of large sink efficiency: a capacity to sink more CFC than outsource, although it reduced by 80 and 70%, respectively, in the last 40 years compared to 1960. The sink to source ratio of global ocean CFC-11 fluxes were reduced from 90 to 50% in the last 40 years. This indicates a saturation of CFC in the above-thermocline subsurface that makes the upper ocean less efficient in absorbing CFC in recent decades. A positive trend in CFC sink is now limited to the Southern Ocean, central tropical Pacific and western boundary current regions which possess active upwelling of old water with long time since last atmospheric contact. However, a globally averaged trend was a reduced CFC-11 sink, by emitting 30% of the total ocean CFC-11 that was absorbed during

  18. Thermal response for divertor mock-up using surface-modified CFC tile

    International Nuclear Information System (INIS)

    It is necessary for the divertor plate to be actively cooled in order to remove the extremely high heat load from the fusion plasma. CFC material has been considered as one of the candidate plasma-facing materials because of its high thermal shock resistance. However, CFC causes several problems, such as the enhancement of hydrogen recycling, large erosion due to oxygen and radiation enhanced sublimation where the temperature exceeds about 1000 C. In this study the surface of CFC, CX-3002U, was converted to B4C and SiC by using a chemical vapor reaction, CVR. The thermal response properties of divertor mock-ups made by these materials and CFC were examined. These mock-ups were irradiated by electron beams with heat flux up to 15 MW/m2. The surface temperature rise of B4C-converted CFC tile was the highest and that of CFC the lowest. This difference was consistent with the value of the thermal conductivity e.g. B4C-converted CFC has the lowest thermal conductivity, 200 W/m K and CFC has the highest one, 450 W/m K. The heat flux that increases the surface temperature to 1000 C was approximately 8, 10 or 11 MW/m2 for B4C-converted CFC, SiC-converted CFC or CFC, respectively. Thermal cycling tests with more than 2000 shots were also conducted for these mock-ups. No deterioration in the heat transfer for each mock-up was found for the heat flux which increased the surface temperature to 1000 C. (orig.)

  19. EPA proposes CFC alternatives policy, ozone levels drop

    International Nuclear Information System (INIS)

    The Environmental Protection Agency has proposed its Significant New Alternatives Policy (SNAP), under which EPA will manage use of chlorofluorocarbon (CFC) substitutes. EPA also proposed a preliminary list of acceptable and unacceptable uses of CFC substitutes. Under SNAP, manufacturers or importers must notify EPA of the intent to sell, use, or distribute substitutes 90 days before introducing them into interstate commerce, and provide EPA with health and safety studies. EPA will determine eligibility for specific uses based on flammability, chemical toxicity, costs, global warming potential, and environmental and occupational exposures. Hydrochlorofluorocarbon (HCFC)-141b was targeted by EPA for restrictions in some applications involving polyurethane foams and solvent systems. Acceptable HCFC-141b uses include foams for insulation and flotation rigid polyurethane. HCFC-141b makers say the rule making does not come as a surprise. Elf Atochem says it has been working with EPA on the alternatives policy for the past two years and has steered away from unacceptable uses. Allied-Signal also says it has considered the limitations. Even while EPA plotted the management of CFC substitutes, there was further bad news on the stratospheric ozone layer. Government scientists at the National Aeronautics and Space Administrations's (NASA) Goddard Space Flight Center (Greenbelt, MD) say global ozone levels were 2%-3% lower in the second half of 1992 than at any previous time and that mid-latitudes Northern Hemisphere levels dropped 13%-14% below normal in January. Separately, NASA and Jet Propulsion Laboratory researchers report satellite measurements finding chlorine monoxide-a key villain in ozone destruction-in alarmingly high levels in the Arctic stratosphere. The NSA/JPL measurements-which had not been done before-are open-quote very soberingclose quotes, says Joe Waters, a JPL scientist

  20. Materials compatibility and lubricants research on CFC-refrigerant substitutes

    Science.gov (United States)

    Szymurski, S. R.; Hawley, M.; Hourahan, G. C.; Godwin, D. S.

    1994-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  1. High heat flux testing of CFC composites for the tokamak physics experiment

    Science.gov (United States)

    Valentine, P. G.; Nygren, R. E.; Burns, R. W.; Rocket, P. D.; Colleraine, A. P.; Lederich, R. J.; Bradley, J. T.

    1996-10-01

    High heat flux (HHF) testing of carbon fiber reinforced carbon composites (CFC's) was conducted under the General Atomics program to develop plasma-facing components (PFC's) for Princeton Plasma Physics Laboratory's tokamak physics experiment (TPX). As part of the process of selecting TPX CFC materials, a series of HHF tests were conducted with the 30 kW electron beam test system (EBTS) facility at Sandia National Laboratories, and with the plasma disruption simulator I (PLADIS-I) facility at the University of New Mexico. The purpose of the tests was to make assessments of the thermal performance and erosion behavior of CFC materials. Tests were conducted with 42 different CFC materials. In general, the CFC materials withstood the rapid thermal pulse environments without fracturing, delaminating, or degrading in a non-uniform manner; significant differences in thermal performance, erosion behavior, vapor evolution, etc. were observed and preliminary findings are presented below. The CFC's exposed to the hydrogen plasma pulses in PLADIS-I exhibited greater erosion rates than the CFC materials exposed to the electron-beam pulses in EBTS. The results obtained support the continued consideration of a variety of CFC composites for TPX PFC components.

  2. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING THE INCINERATION OF RECOVERED CFC-11

    Science.gov (United States)

    The report gives results of an investigation of the formation of products of incomplete combustion (PICS) during "recovered" trichlorofluoromethane (CFC-11) incineration. Tests involved burning the recovered CFC-11 in a propane gas flame. combustion gas samples were taken and an...

  3. Prediction of future disposal of end-of-life refrigerators containing CFC-11.

    Science.gov (United States)

    Yazici, Burcu; Can, Zehra S; Calli, Baris

    2014-01-01

    The objective of this study was to predict the number of refrigerators containing CFC-11 blown isolation foam and the amount of CFC-11 banked in these refrigerators. By using a Weibull-based survival function, the number of CFC-11 containing and still-functioning refrigerators was estimated to be approximately 1.6 million in 2013 in Turkey. In order to determine the amount of CFC-11 in the isolation foam of these refrigerators, polyurethane (PU) foam samples were taken from a refrigerator manufactured in 1993 and the quantity of CFC-11 was analyzed by a GC-MS. It was determined that 113-195 mg CFC-11/g PU remains in the PU foam depending on the location such as door, sides, top and bottom. Knowing that a mid-sized refrigerator contains 4 kg PU on average, the total amount of PU foam to be disposed of is 6344 tons when the CFC-11 containing refrigerators in Turkey become obsolete in the near future. Furthermore, 717-1237 tons of CFC-11 are expected to be banked in the PU foam of these refrigerators which will exert an equivalent amount of ozone depleting potential (ODP). In addition, the global warming potential will vary between 3.4 and 5.9 million tons of CO2. PMID:24112854

  4. Energy and global warming impacts of CFC alternative technologies

    International Nuclear Information System (INIS)

    The primary objective of this study is to develop representative indications of the relative energy use, associated CO2 emissions, and total equivalent warming impact (TEWI) of viable options to replace CFCs in their major energy-related application areas. It was motivated, in part, by a concern that most attention to date has focused on the DIRECT global warming effect of CFC's and their alternatives, with adequate attention being paid to the INDIRECT effect of the CO2 emissions arising from the differences in energy consumption by systems using different alternatives. The DIRECT and INDIRECT contributions are combined in this analysis to determine the TEWI of the various technical options. The study is international in scope and takes into account significant differences in present CFC end-use practices, sources of energy, and other societal factors between Europe, Japan, and North America. This study should be considered an overview of key issues. The analysis addressed CFCs as well as alternative chemicals and technology alternatives in uses such as refrigeration, foam insulation, and metal and electronic cleaning and drying processes

  5. Global CFC-11 (CCl3F and CFC-12 (CCl2F2 measurements with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS: retrieval, climatologies and trends

    Directory of Open Access Journals (Sweden)

    A. Linden

    2012-12-01

    Full Text Available Vertical profiles of CFC-11 (CCl3F and CFC-12 (CCl2F2 have been measured with the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS with global coverage under daytime and nighttime conditions. The profile retrieval is based on constrained nonlinear least squares fitting of measured limb spectral radiance to modeled spectra. CFC-11 is measured in its ν4-band at 850 cm−1, and CFC-12 is analyzed in its ν6-band at 922 cm−1. To stabilize the retrievals, a Tikhonov-type smoothing constraint is applied. Main retrieval error sources are measurement noise and elevation pointing uncertainties. The estimated CFC-11 retrieval errors including noise and parameter errors but excluding spectroscopic data uncertainties are below 10 pptv in the middle stratosphere, depending on altitude, the MIPAS measurement mode and the actual atmospheric situation. For CFC-12 the total retrieval errors are below 28 pptv at an altitude resolution varying from 3 to 5 km. Time series of altitude/latitude bins were fitted by a simple parametric approach including constant and linear terms, a quasi-biennial oscillation (QBO proxy and sine and cosine terms of several periods. In the time series from 2002 to 2011, quasi-biennial and annual oscillations are clearly visible. A decrease of stratospheric CFC mixing ratios in response to the Montreal Protocol is observed for most altitudes and latitudes. However, the trends differ from the trends measured in the troposphere, they are even positive at some latitudes and altitudes, and can in some cases only be explained by decadal changes in atmospheric age of air spectra or vertical mixing patterns.

  6. Assessing the applicability of global CFC and SF6 input functions to groundwater dating in Britain

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) and sulphur hexafluoride (SF6) are increasingly being used to date groundwaters. While these trace gases are generally well-mixed in the atmosphere, local atmospheric excesses (LAEs) have been found in some parts of the world, thereby affecting the interpretation of data from groundwater studies. To investigate the possibility of LAEs in Britain, mixing ratios of CFC-11, CFC-12 and SF6 were measured in soil gases from two large conurbations (London and Birmingham) and a smaller urban area, Bristol. Most mixing ratios for CFC-12 and SF6 were 6 input functions based on the NH-AMR curves appears justified for Britain. (author)

  7. MIPAS IMK/IAA CFC-11 (CCl3F) and CFC-12 (CCl2F2) measurements: accuracy, precision and long-term stability

    Science.gov (United States)

    Eckert, E.; Laeng, A.; Lossow, S.; Kellmann, S.; Stiller, G.; von Clarmann, T.; Glatthor, N.; Höpfner, M.; Kiefer, M.; Oelhaf, H.; Orphal, J.; Funke, B.; Grabowski, U.; Haenel, F.; Linden, A.; Wetzel, G.; Woiwode, W.; Bernath, P. F.; Boone, C.; Dutton, G. S.; Elkins, J. W.; Engel, A.; Gille, J. C.; Kolonjari, F.; Sugita, T.; Toon, G. C.; Walker, K. A.

    2015-07-01

    Profiles of CFC-11 (CCl3F) and CFC-12 (CCl2F2) of the Michelson Interferometer for Passive Atmospheric Sounding (MIPAS) abord the European satellite Envisat have been retrieved from versions MIPAS/4.61-MIPAS/4.62 and MIPAS/5.02-MIPAS/5.06 level-1b data using the scientific level-2 processor run by Karlsruhe Institute of Technology (KIT), Institute of Meteorology and Climate Research (IMK) and Consejo Superior de Investigaciones Científicas (CSIC), Instituto de Astrofísica de Andalucía (IAA). These profiles have been compared to measurements taken by the balloon borne Cryosampler, Mark IV (MkIV) and MIPAS-Balloon (MIPAS-B), the airborne MIPAS stratospheric aircraft (MIPAS-STR), the satellite borne Atmospheric Chemistry Experiment Fourier transform spectrometer (ACE-FTS) and the High Resolution Dynamic Limb Sounder (HIRDLS) as well as the ground based Halocarbon and other Atmospheric Trace Species (HATS) network for the reduced spectral resolution period (RR: January 2005-April 2012) of MIPAS Envisat. ACE-FTS, MkIV and HATS also provide measurements during the high spectral resolution period (FR: July 2002-March 2004) and were used to validate MIPAS Envisat CFC-11 and CFC-12 products during that time, as well as ILAS-II profiles. In general, we find that MIPAS Envisat shows slightly higher values for CFC-11 at the lower end of the profiles (below ~ 15 km) and in a comparison of HATS ground-based data and MIPAS Envisat measurements at 3 km below the tropopause. Differences range from approximately 10-50 pptv (~ 5-20 %) during the RR period. In general, differences are slightly smaller for the FR period. An indication of a slight high-bias at the lower end of the profile exists for CFC-12 as well, but this bias is far less pronounced than for CFC-11, so that differences at the lower end of the profile (below ~ 15 km) and in the comparison of HATS and MIPAS Envisat measurements taken at 3 km below the tropopause mainly stay within 10-50 pptv (~ 2-10 %) for the RR and

  8. CFC and HFC recycling equipments: Test performances; Qualificazione di dispositivi per il riciclaggio dei CFC e degli HFC

    Energy Technology Data Exchange (ETDEWEB)

    Picini, P.; Caropreso, G.; Cicoli, G.; Posarelli, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Pallotti, P. [ICF, Industria Componenti Frigoriferi Srl, Bologna (Italy)

    1996-12-01

    Actual regulatory conditions about ozone layer depleting chemicals set problems on their disposal and on the management of plants still using illegal CFCs. Anyway fluids that will replace CFCs (i.e. HFCs) will not be allowed to be spread into the atmosphere, due to their high costs and to the greenhouse effect. A viable solution would be the recovery, purification and recycle of contaminated fluids. ENEA (National Agency for New Technology, Energy and the Environment), in cooperation with ICF (Industria Componenti Frigoriferi) Company leader in the field of air refrigerating and conditioning, patented a device able to extract, to clean and to recycle CFC 12 and HFC 134a in the refrigerating systems. This paper presents experimental data from the qualification tests on a device performing the above mentioned operations regarding systems that use HFC 134a as process fluid.

  9. HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-12 (CFC-12) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC12) contains the entire mission (~3 years) of...

  10. HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients V007

    Data.gov (United States)

    National Aeronautics and Space Administration — The "HIRDLS/Aura Level 3 Chlorofluorocarbon-11 (CFC-11) Zonal Fourier Coefficients" version 7 data product (H3ZFCCFC11) contains the entire mission (~3 years) of...

  11. Metered Dose Inhalation Formulations of Salbutamol Sulphate Using Non-CFC Propellant Tetrafluoroethane

    Directory of Open Access Journals (Sweden)

    S. S. Shrikhande

    2011-10-01

    Full Text Available Salbutamol sulphate metered dose inhaler formulations were developed with chlorine free, non-CFC propellant Tetrafluoroethane. Suspension formulations were prepared with 4 mg of oleic acid as the surfactant and varying proportions of ethanol as the co-solvent. Developed formulations were subjected to various qualitative and quantitative tests to ensure proper stability of the final package. In-vitro drug deposition studies using Twin impinger and Anderson cascade impactor indicated a net respirable fraction of 34-36.7% for the optimized formulation. Stability studies showed that the formulation was stable for a period of three months under all storage conditions. Effects of different adaptors and metering valve designs on the performance of the formulation were also checked. Comparison of optimized formulation with commercial CFC and non-CFC formulations exhibited equivalent performance characteristics. Thus, Tetrafluoroethane proved to be an environment friendly substitute for CFC propellants in metered dose inhalation formulations.

  12. International symposium on environmental impacts of advanced alternative to CFC; CFC shinki daitai busshitsu no kankyo eikyo ni kansuru kokusai symposium hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-07

    The international symposium on environmental effects of new CFC substitutes was held in Tsukuba City, Ibaraki Pref. on February 7-9, 1996, and 19 papers were made public. In Session 1 (Plenary lecture), reports were made on Global warming and climate change: a review of recent studies; Stratospheric ozone, CFCs, and CFC-substitutes: an update, etc. In Session 2, Measurements of OH rate constants for advanced refrigerants as well as HCFCs and HFCs; The reaction rate of CFC alternatives with OH radical; Experimental and estimated rate constants: reactions of hydroxyl radicals with several halocarbons, etc. In Session 3, Measurement of uptake coefficients of some acetyl halides and fluorinated ethers into water; Mass transfer at the air/water interface: removal processes of halocarbonyl compounds; Heterogeneous reactions of fluorinated ethers on allophane or titanium dioxide, etc. In Session 4, papers were reported on model calculations relating to the global warming.

  13. Dating groundwater with trifluoromethyl sulfurpentafluoride (SF 5CF3), sulfur hexafluoride (SF6), CF 3Cl (CFC-13), and CF2Cl2 (CFC-12)

    Science.gov (United States)

    Busenberg, E.; Plummer, L.N.

    2008-01-01

    [1] A new groundwater dating procedure using the transient atmospheric signal of the environmental tracers SF5CF3, CFC-13, SF6, and CFC-12 was developed. The analytical procedure determines concentrations of the four tracers in air and water samples. SF 5CF3 and CFC-13 can be used to date groundwaters in some environments where the CFCs and SF6 have previously failed because these new tracers have increasing atmospheric input functions, no known terrigenic source, and are believed to be stable under reducing conditions. SF5CF3 has a dating range from 1970 to modern; the mixing ratio (mole fraction) in North American air has increased from the detection limit of 0.005 parts per trillion (ppt) to the 2006 mole fraction of about 0.16 ppt. No evidence was found for degradation of SF5CF3 in laboratory anaerobic systems. The solubility of SF5CF3 was measured in water from 1 to 35??C. Groundwater samples that contained large amounts of terrigenic SF6 did not contain terrigenic SF 5CF3. CFC-13 is a trace atmospheric gas with a dating range in groundwater of about 1965 to modem. CFC-13 has been used primarily in very low-temperature refrigeration; thus groundwater environments are less likely to be contaminated with nonatmospheric sources as compared to other widely used CFCs. Because of the low solubility of SF5CF3 and CFC-13 in water, an excess air correction must be applied to the apparent ages. The new dating procedure was tested in water samples from wells and springs from Maryland, Virginia, and West Virginia.

  14. The SPARC Data Initiative: comparisons of CFC-11, CFC-12, HF and SF6 climatologies from international satellite limb sounders

    OpenAIRE

    S. Tegtmeier; Hegglin, M. I.; Anderson, J; Funke, B.; Gille, J.; Jones, A; Smith, L; T. von Clarmann; K. A. Walker

    2015-01-01

    A quality assessment of the CFC-11 (CCl3F), CFC-12 (CCl2F2), HF, and SF6 products from limb-viewing satellite instruments is provided by means of a detailed inter-comparison. The climatologies in the form of monthly zonal mean time series are obtained from HALOE, MIPAS, ACE-FTS, and HIRDLS within the time period 1991–2010. The inter-comparisons focus on the mean biases of the monthly and annual zonal mean fields and aim to identify their vertical, latitudina...

  15. Formulation and evaluation of CFC free inhalers for beclomethasone dipropionate

    Directory of Open Access Journals (Sweden)

    Gopala Krishna Murthy Talasila

    2013-06-01

    Full Text Available Beclomethasone dipropionate CFC free inhalation formulations were developed with a view to treat asthma prophylactically. Dry powder inhalers (DPI for beclomethasone dipropionate were prepared with different grades of lactose monohydrate. The influence of carrier and overages on performance of DPI was studied. Metered dose inhalers (MDI with HFA based propellants were formulated with various doses, overages and different concentrations of alcohol. Formulated DPI and MDI were evaluated for various official and unofficial quality control tests. The influence of over doses on valve delivery, effect of overages on emitted dose and influence of alcohol on spray pattern from MDI were studied. The better fine particle fraction and emitted dose were obtained from the DPI formulated with 10:90 ratio of fine lactose: coarse lactose and with 20% w/w overages. The studies on MDI revealed that the 15% of overdoses are required for effective valve delivery and 20% overages are required for 100% drug delivery. 5-10%v/v alcohol was found to be preferable to get optimum emitted dose and fine particle fraction.

  16. Measurements of the Surface Tension for CFC Alternatives

    Science.gov (United States)

    Higashi, Yukihiro; Ikeda, Tadamitsu; Kuwana, Takeaki; Okada, Masaaki

    Measurements of the surface tension for two kinds of CFC alternatives, i.e., HCFC-123 (2,2-dichloro-1,1,1-trifluoroethane), and HFC-134a (1,1,1,2-tetrafluoroethane), have been made by the differential capillary rise method (DCRM) and the vertical plate method (VPM). For HCFC-123, 15 data have been obtained by DCRM in the temperature range between 273 and 333 K within the uncertainty of ±0.1mN/m, and 21 data have been obtained by VPM in the temperature range between 273 and 290 K within the uncertainty of ±0.2mN/m. For HFC-134a, 17 data have been obtained by DCRM in the temperature range between 276 and 329 K within the uncertainty of ±0.1mN/m. The uncertainty of temperature measurement by DCRM is estimated within ±20mK, whereas that by VPM within ±30mK. New correlations of the surface tension for HCFC-123 and HFC-134a have been also proposed.

  17. National action plan for recovery, recycling and reclamation of chlorofluorocarbons (CFC's); Part 2. Piano operativo nazionale per il recupero, il riciclaggio, il trattamento dei clorofluorocarburi (CFC); Parte 2

    Energy Technology Data Exchange (ETDEWEB)

    Relevant to the development of a plan for the recovery, recycling and reclamation of chlorofluorocarbons (CFC's), this paper tables a list of operating task activities and recommendations. They include: the creation of incentives for CFC recovery and recycling; the setting up of a recovered materials monitoring system; the drafting up of emission limits; information dissemination for greater public awareness; collaboration with owners and builders of plants using CFC's; development of suitable waste management and disposal procedures for CFC residuals.

  18. CFC1 Mutations in Patients with Transposition of the Great Arteries and Double-Outlet Right Ventricle

    OpenAIRE

    Goldmuntz, Elizabeth; Bamford, Richard; Karkera, Jayaprakash D.; dela Cruz, June; Roessler, Erich; Muenke, Maximilian

    2002-01-01

    Recent investigations identified heterozygous CFC1 mutations in subjects with heterotaxy syndrome, all of whom had congenital cardiac malformations, including malposition of the great arteries. We hypothesized that a subset of patients with similar types of congenital heart disease—namely, transposition of the great arteries and double-outlet right ventricle, in the absence of laterality defects—would also have CFC1 mutations. Our analysis of the CFC1 gene in patients with these cardiac disor...

  19. Infrared Absorption Spectra, Radiative Efficiencies, and Global Warming Potentials of Newly-Detected Halogenated Compounds: CFC-113a, CFC-112 and HCFC-133a

    Directory of Open Access Journals (Sweden)

    Maryam Etminan

    2014-07-01

    Full Text Available CFC-113a (CF3CCl3, CFC-112 (CFCl2CFCl2 and HCFC-133a (CF3CH2Cl are three newly detected molecules in the atmosphere that are almost certainly emitted as a result of human activity. It is important to characterise the possible contribution of these gases to radiative forcing of climate change and also to provide information on the CO2-equivalence of their emissions. We report new laboratory measurements of absorption cross-sections of these three compounds at a resolution of 0.01 cm−1 for two temperatures 250 K and 295 K in the spectral range of 600–1730 cm−1. These spectra are then used to calculate the radiative efficiencies and global warming potentials (GWP. The radiative efficiencies are found to be between 0.15 and 0.3 W∙m−2∙ppbv−1. The GWP for a 100 year time horizon, relative to carbon dioxide, ranges from 340 for the relatively short-lived HCFC-133a to 3840 for the longer-lived CFC-112. At current (2012 concentrations, these gases make a trivial contribution to total radiative forcing; however, the concentrations of CFC-113a and HCFC-133a are continuing to increase. The 2012 CO2-equivalent emissions, using the GWP (100, are estimated to be about 4% of the current global CO2-equivalent emissions of HFC-134a.

  20. High-temperature resistant, thermally sprayed diffusion barrier coatings on CFC lightweight materials; Hochtemperaturbestaendige, thermisch gespritzte Diffusionsbarriereschichten auf CFC-Leichtbauchargiergestellen

    Energy Technology Data Exchange (ETDEWEB)

    Drehmann, Rico; Rupprecht, Christian; Wielage, Bernhard; Lampke, Thomas [Technische Univ. Chemnitz (Germany). Inst. fuer Werkstoffwissenschaft und Werkstofftechnik (IWW); Gilbert, Maria; Uhlig, Volker; Trimis, Dimosthenis [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Waermetechnik und Thermodynamik (IWTT); Heuer, Volker [ALD Vacuum Technologies GmbH, Hanau (Germany)

    2013-03-15

    In heat treating processes as well as in high temperature brazing processes, charge carriers enable the positioning and transport of work pieces. Recently, charge carriers consisting of graphite or carbon fibre reinforced carbon (CFC) are used. The main disadvantage of charge carriers based on CFC is the undesirable carburization of the overlying components due to diffusion processes. Under this aspect, thermally sprayed coatings are applied on CFC and tested with respect to their suitability as a high-temperature diffusion barrier. The ceramic powders aluminium oxide, aluminium oxide/chromium oxide, aluminium oxide/titanium oxide and zirconium oxide/yttrium oxide are used as a coating material which is processed by means of the powder flame spraying as well as atmospheric plasma spraying. Molybdenum and silicon carbide are used as an adhesive layer. The coating materials aluminium oxide and aluminium oxide/chromium oxide on siliconized CFC presented excellent results. This supplies a large potential of application for thermally sprayed ceramic coatings on carbon-based lightweight materials.

  1. SIMULATION OF PERFORMANCE OF CHLORINE-FREE FLURORINATED ETHERS AND FLUORINATED HYDROCARBONS TO REPLACE CFC-11 AND CFC-114 IN CHILLERS

    Science.gov (United States)

    The paper discusses simulation of the performance of chlorine-free fluorinated ethers and fluorinated hydrocarbons as potential long-term replacements for CFC-11 and -114. Modeling has been done with in-house refrigeration models based on the Carnahan-Starling-DeSantis Equation o...

  2. Evidence of CFC degradation in groundwater under pyrite-oxidizing conditions

    Science.gov (United States)

    Sebol, L.A.; Robertson, W.D.; Busenberg, E.; Plummer, L.N.; Ryan, M.C.; Schiff, S.L.

    2007-01-01

    A detailed local-scale monitoring network was used to assess CFC distribution in an unconfined sand aquifer in southwestern Ontario where the zone of 1-5-year-old groundwater was known with certainty because of prior use of a bromide tracer. Groundwater ???5 years old was confined to an aerobic zone at ???5 m depth and had CFC concentrations consistent with modern atmospheric mixing ratios at recharge temperatures of 7-11 ??C, as was observed in the 3-m thick vadose zone at the site. At depths below 6 m, the groundwater became progressively more reducing, however, with a denitrifying horizon at 6-7 m depth, and a Mn and Fe reducing zone below 7 m depth. In the anaerobic zone, 3H/3He ratios indicated that groundwater-age continued to increase uniformly with depth, to a maximum value of 27 years at 13 m depth. CFC concentrations, however, decreased abruptly within the denitrifying zone, leading to substantial age overestimation compared to the 3H/3He ages. Noble gas data indicated that the apparent CFC mass loss was not likely the result of gas stripping from possible bubble formation; thus, CFC degradation was indicated in the anoxic zone. The field data are consistent with first-order degradation rates of 0.3 yr-1 for CFC-12, 0.7 yr-1 for CFC-11, and 1.6 yr-1 for CFC-113. CFC attenuation at this site coincides with a zone where reduced S (pyrite) is actively oxidized by NO3 and dissolved oxygen (DO). Similar behavior has been observed at other sites [Tesoriero, A.J., Liebscher, H., Cox, S.E., 2000. Mechanism and rate of denitrification in an agricultural watershed: electron and mass balance along groundwater flow path. Water Resour. Res. 36 (6), 1545-1559; Hinsby, K., Hojberg, A.L., Engesgaard, P., Jensen, K.H., Larsen, F., Plummer, L.N., Busenberg, E., Accepted for publication. Transport and degradation of chlorofluorocarbons (CFCs) in a pyritic aquifer, Rabis Creek, Denmark. Water Resour. Res.], further demonstrating that the use of CFCs for age-dating anaerobic

  3. Behaviour of Molten Beryllium with ITER Reference CFC NB31 (SNECMA) Under Moisture

    International Nuclear Information System (INIS)

    A dramatic exothermic reaction with aluminium, a carbide forming metal, has been observed in Tore Supra. A small rod of 30 mm3, acting as a temperature proof, was enclosed in a blind hole of a thermally loaded low density PAN fiber CFC 1001Z block (SGL), which reached a temperature of about 1300 oC during plasma operation. The molten aluminium had penetrated the carbon matrix through to the block's front surface. After component removal and roughly 2 months of exposure to air in the laboratory, the CFC in front of the blind hole was found to have been locally destroyed over a crater-shaped structure of 2 cm diameter. This was due to an enhanced decomposition of aluminium carbide to aluminium hydroxide. Beryllium (Be), also a carbide forming metal, is used on the ITER first wall. Carbon reinforced carbon (CFC) of type NB31 (Snecma) covers the vertical divertor targets. It is expected that beryllium material will be transported during normal and/or off normal plasma operation to the carbon based divertor targets to form beryllium carbide. During air venting or a supposed accidental in-vessel water leak event, it will react exothermically under moisture to beryllium oxide. In order to investigate to which extent the CFC structure could be modified or eventually destroyed, this reaction process has been simulated with a CFC block NB31 of size 16 x 32 x 20 mm3, where about 40 mm3 of Be S65 C (Brush Wellmann) has been placed in a previously drilled blind hole of 4 mm diameter oriented parallel to the high conductivity pitch fibers. When melted, by heating the CFC block, the Be penetrated in the carbon matrix through to the block's front surface. The front surface of the CFC was then exposed to humidity (tap water) for about 2 weeks and then stored for a further 2 months in a closed vinyl bag under atmospheric pressure after which the sample was analysed. After the exposure of the CFC to humidity, reaction products have been detected at the surface of the carbon fibre

  4. Surface damage characteristics of CFC and tungsten with repetitive ELM-like pulsed plasma irradiation

    Science.gov (United States)

    Kikuchi, Y.; Nishijima, D.; Nakatsuka, M.; Ando, K.; Higashi, T.; Ueno, Y.; Ishihara, M.; Shoda, K.; Nagata, M.; Kawai, T.; Ueda, Y.; Fukumoto, N.; Doerner, R. P.

    2011-08-01

    Surface damage of carbon fiber composite (CFC) and tungsten (W) due to repetitive ELM-like pulsed plasma irradiation has been investigated by using a magnetized coaxial plasma gun. CX2002U CFC and stress-relieved W samples were exposed to repetitive pulsed deuterium plasmas with duration of ˜0.5 ms, incident ion energy of ˜30 eV, and surface absorbed energy density of ˜0.3-0.7 MJ/m2. Bright spots on a CFC surface during pulsed plasma exposures were clearly observed with a high-speed camera, indicating a local surface heating. No melting of a W surface was observed under a single plasma pulse exposure at energy density of ˜0.7 MJ/m2, although cracks were formed. Cracking of the W surface grew with repetitive pulsed plasma exposures. Subsequently, the surface melted due to localized heat absorption.

  5. Interaction of deuterated hydrocarbon ions and Ar+ with CFC surfaces at room temperature

    International Nuclear Information System (INIS)

    Full text: Carbon-fibre-composite (CFC) is a suitable material for covering walls facing plasma, such as walls of fusion reactors, and therefore the interactions of different projectile ions (deuterated hydrocarbons and Ar+) with hydrocarbon- covered CFC surfaces at room temperature were investigated. The incident energies ranged from a few eV up to 100 eV. Mass spectra of the product ions and their dependence on the incident energy of the projectiles were measured and compared. The results were similar to highly oriented pyrolytic graphite (HOPG) surfaces. This indicates, that the hydrocarbons covering the surface determine the fragmentation and chemical reactivity of the surface. Additionally, K+ and Na+ ions were observed, which originate from contamination of the CFC material. (author)

  6. High RF power test of a CFC antenna module for lower hybrid current drive

    International Nuclear Information System (INIS)

    A mock-up of a 3.7 GHz Lower Hybrid Current Drive (LHCD) antenna module was fabricated from Carbon Fibre Composite (CFC) for the development of heat resistive low Z front facing the plasma. This 2 divided waveguide module is made from CFC plates and rods which are Cu-plated to reduce the RF losses. The withstand-voltage, the RF properties and the outgassing rates for long pulses and high RF power were tested at the Lower Hybrid test bed facility of Cadarache. A reference module made from Dispersion Strengthened Copper (DSC) was also fabricated. After the short pulse conditioning, long pulses with a power density ranging between 50 and 150 MW/m2 were performed with no breakdowns on the CFC module. It was also checked that the highest power density, up to 150 MW/m2, could be transmitted when the waveguides are filled with H2 at a pressure of 5 x 10-2 Pa. During a long pulse, the power reflection coefficient remains low in the 0.8-1.3 % range and no significant change in the reflection coefficient is measured after the thermal cycling provided by the long pulse operation. From thermocouple measurements, RF losses of the copper coated CFC and the DSC modules were compared. No significant differences were measured. From pressure measurements, it was found that the outgassing rate of Cu-plated CFC is about 6-7 times larger than of DSC at 300 deg.C. It is concluded that a CFC module is an attractive candidate for the hardening of the tip of the LHCD antenna. (author)

  7. Catalytic hydrolysis of CFC-12 over solid acid Ti(SO4)2

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The catalytic hydrolysis of dichlorodifluoromethane (CFC-12) was investigated over solid acid Ti(SO4)2. The catalytic activity decreased with the calcination temperature. When space velocity was 6 l h-1 g-cat-1, the CFC-12 conversion at 310oC over Ti(SO4)2 calcined at 350oC remained about 98.5% during 360 h on stream, and the selectivity to by-products remained zero. The findings enlarged the scope of traditional catalyst systems for the CFCs decomposition.

  8. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  9. Model in simuliranje delovanja odprtega hladilnega postopka brez uporabe CFC: Design and simulation of a CFC-free open air-conditioning system:

    OpenAIRE

    Stritih, Uroš; Novak, Peter; Može, Mitja

    2001-01-01

    In this paper a model is presented and its operation of a cooling process that uses air-as the cooling medium. In the introduction, conventional refrigerants are compared with an alternative refrigerant - air. The system construction and the thermodynamic model are presented. The model is used to study the performance of a CFC-free air-conditioning system, in which some parameters of the individual components are variable while the others are constant for the referenced data. The characterist...

  10. On the accuracy of the IWM-CFC approximation in differentially rotating relativistic stars

    CERN Document Server

    Iosif, Panagiotis

    2014-01-01

    We determine the accuracy of the conformal flatness (IWM-CFC) approximation for the case of single, but strongly differentially rotating relativistic stars. We find that for the fastest rotating and most relativistic polytropic models, the deviation from full general relativity is below 5% for integrated quantities and below 10% for local quantities, such as the angular velocity. Furthermore, we study the deviation of the IWM-CFC approximation from full general relativity by evaluating and comparing different error indicators. We find that for the models that are not near the maximum mass, a simple error indicator constructed from local values of the metric potentials is more indicative of the accuracy of the IWM-CFC approximation than an error indicator that is based on the Cotton-York tensor. Furthermore, we construct a simple, linear empirical relation that allows for the estimation of the error made by the IWM-CFC approximation and which only involves the flattening of the star due to rotation and the min...

  11. Tensile fracture characterization of braze joined copper-to-CFC coupon assemblies

    Science.gov (United States)

    Trester, P. W.; Valentine, P. G.; Johnson, W. R.; Chin, E.; Reis, E. E.; Colleraine, A. P.

    1996-10-01

    A vacuum brazing process was used to join a broad spectrum of carbon-fiber reinforced carbon matrix composite (CFC) materials, machined into cylindrical coupons, between coupons of oxygen-free copper, the braze alloy was a copper-base alloy which contained only low activation elements (Al, Si, and Ti) relative to a titanium baseline specification. This demonstration was of particular importance for plasma facing components (PFCs) under design for use in the Tokamak Physics Experiment (TPX); the braze investigation was conducted by General Atomics for the Princeton Plasma Physics Laboratory. A tensile test of each brazed assembly was conducted. The results from the braze processing, testing, and fracture characterization studies of this reporting support the use of CFC's of varied fiber architecture and matrix processing in PFC designs for TPX. Further, the copper braze alloy investigated is now considered to be a viable candidate for a low-activation bond design. The prediction of plasma disruption-induced loads on the PFCs in TPX requires that joint strength between CFC tiles and their copper substrate be considered in design analysis and CFC selection.

  12. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  13. Characterization and damaging law of CFC for high heat flux actively cooled plasma facing components

    Science.gov (United States)

    Chevet, G.; Martin, E.; Boscary, J.; Camus, G.; Herb, V.; Schlosser, J.; Escourbiac, F.; Missirlian, M.

    2011-10-01

    The carbon fiber reinforced carbon composite (CFC) Sepcarb N11 has been used in the Tore Supra (TS) tokamak (Cadarache, France) as armour material for the plasma facing components. For the fabrication of the Wendelstein 7-X (W7-X) divertor (Greifswald, Germany), the NB31 material was chosen. For the fabrication of the ITER divertor, two potential CFC candidates are the NB31 and NB41 materials. In the case of Tore Supra, defects such as microcracks or debonding were found at the interface between CFC tile and copper heat sink. A mechanical characterization of the behaviour of N11 and NB31 was undertaken, allowing the identification of a damage model and finite element calculations both for flat tiles (TS and W7-X) and monoblock (ITER) armours. The mechanical responses of these CFC materials were found almost linear under on-axis tensile tests but highly nonlinear under shear tests or off-axis tensile tests. As a consequence, damage develops within the high shear-stress zones.

  14. Global warming impacts of CFC alternative technologies: Combining fluorocarbon and CO2 effects

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) are on their way out, due to their role in stratospheric ozone depletion and the related international Montreal Protocol agreement and various national phaseout timetables. As the research, engineering development, and manufacturing investment decisions have ensued to prepare for this transition away from CFCs, the climate change issue has emerged and there has recently been increased attention on the direct global warming potential (GWP) of the fluorocarbon alternatives as greenhouse gases. However, there has been less focus on the indirect global warming effect arising from end-use energy changes and associated CO2 emissions. A study was undertaken to address these combined global warming effects. A concept of Total Equivalent Warming Impact (TEWI) was developed for combining the direct and indirect effects and was used for evaluating CFC-replacement options available in the required CFC transition time frame. Analyses of industry technology surveys indicate that CFC-user industries have made substantial progress toward near-equal energy efficiency with many HCFC/HFC alternatives. The findings also bring into question the relative importance of the direct effect in many applications and stress energy efficiency when searching for suitable CFC alternatives. For chillers, household refrigerators, and unitary air-conditioning or heat pump equipment, changes in efficiency of only 2--5% would have a greater effect on future TEWI than completely eliminating the direct effect

  15. The Effect of Diapycnal Mixing on the Ventilation and CFC-11 Uptake in the Southern Ocean

    Institute of Scientific and Technical Information of China (English)

    Yongqi GAO; Helge DRANGE

    2004-01-01

    The Miami Isopycnic Coordinate Ocean Model (MICOM) is used to investigate the effect of diapycnal mixing on the oceanic uptake of CFC-11 and the ventilation of the surface waters in the Southern Ocean (south of 45°S). Three model experiments are performed: one with a diapycnal mixing coefficient Kd (m2 s-1) of 2 × 10-7/N (Expt. 1), one with Kd = 0 (Expt. 2), and one with Kd = 5 × 10-8/N (Expt. 3), N (s-1) is the Brunt-Vaisala frequency. The model simulations indicate that the observed vertical distribution of CFC-11 along 88°W (prime meridian at 0°E) in the Southern Ocean is caused by local ventilation of the surface waters and westward-directed (eastward-directed) isopycnic transport and mixing from deeply ventilated waters in the Weddell Sea region. It is found that at the end of 1997, the simulated net ocean uptake of CFC-11 in Expt. 2 is 25% below that of Expt. 1. The decreased uptake of CFC-11 in the Southern Ocean accounts for 80% of this difference. Furthermore, Expts. 2 and 3 yield far more realistic vertical distributions of the ventilated CFC-waters than Expt. 1. The experiments clearly highlight the sensitivity of the Southern Ocean surface water ventilation to the distribution and thickness of the simulated mixed layer. It is argued that inclusion of CFCs in coupled climate models could be used as a test-bed for evaluating the decadal-scale ocean uptake of heat and CO2.

  16. CFC1 Mutations in Patients with Transposition of the Great Arteries and Double-Outlet Right Ventricle

    Science.gov (United States)

    Goldmuntz, Elizabeth; Bamford, Richard; Karkera, Jayaprakash D.; dela Cruz, June; Roessler, Erich; Muenke, Maximilian

    2002-01-01

    Recent investigations identified heterozygous CFC1 mutations in subjects with heterotaxy syndrome, all of whom had congenital cardiac malformations, including malposition of the great arteries. We hypothesized that a subset of patients with similar types of congenital heart disease—namely, transposition of the great arteries and double-outlet right ventricle, in the absence of laterality defects—would also have CFC1 mutations. Our analysis of the CFC1 gene in patients with these cardiac disorders identified two disease-related mutations in 86 patients. The present study identifies the first autosomal single-gene defect for these cardiac malformations and indicates that some cases of transposition of the great arteries and double-outlet right ventricle can share a common genetic etiology with heterotaxy syndrome. In addition, these results demonstrate that the molecular pathway involving CFC1 plays a critical role in normal and abnormal cardiovascular development. PMID:11799476

  17. Relative abundance estimations of chengal tree in a tropical rainforest by using modified Canopy Fractional Cover (mCFC)

    International Nuclear Information System (INIS)

    Tree species composition estimations are important to sustain forest management. This study challenged estimates of relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of trees species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying trees species composition

  18. Relative abundance estimations of Chengal trees in a tropical rainforest by using modified canopy fractional cover (mCFC)

    International Nuclear Information System (INIS)

    Tree species composition estimations are important to sustain forest management. This study estimates relative abundance of useful timber tree species (chengal) using Hyperion EO-1 satellite data. For the estimation, modified Canopy Fractional Cover (mCFC) was developed using Canopy Fractional Cover (CFC). mCFC was more sensitive to estimate relative abundance of chengal trees rather than Mixture Tuned Matched Filtering (MTMF). Meanwhile, MTMF was more sensitive to estimate the relative abundance of undisturbed forest. Accuracy suggests that the mCFC model is better to explain relative abundance of chengal trees than MTMF. Therefore, it can be concluded that relative abundance of tree species extracted from Hyperion EO-1 satellite data using modified Canopy Fractional Cover is an obtrusive approach used for identifying tree species composition

  19. Accuracy of CFC groundwater dating in a crystalline bedrock aquifer: Data from a site in southern Sweden

    Science.gov (United States)

    Bockgård, Niclas; Rodhe, Allan; Olsson, K. A.

    The concentrations of chlorofluorocarbons (CFC-11, CFC-12, and CFC-113) and tritium were determined in groundwater in fractured crystalline bedrock at Finnsjön, Sweden. The specific goal was to investigate the accuracy of CFC dating in such an environment, taking potential degradation and mixing of water into consideration. The water was sampled to a depth of 42 m in three boreholes along an 800-m transect, from a recharge area to a local discharge area. The CFC-113 concentration was at the detection limit in most samples. The apparent recharge date obtained from CFC-11 was earlier than from CFC-12 for all samples, with a difference of over 20 years for some samples. The difference was probably caused by degradation of CFC-11. The CFC-12 dating of the samples ranged from before 1945 to 1975, with the exception of a sample from the water table, which had a present-day concentration. Conclusions about flow paths or groundwater velocity could not be drawn from the CFCs. The comparison between CFC-12 and tritium concentrations showed that most samples could be unmixed or mixtures of waters with different ages, and the binary mixtures that matched the measured concentrations were determined. The mixing model approach can be extended with additional tracers. Précision de la datation au CFC dans un aquifère rocheux-fracturé: données d'un site du sud de la Suède. Les concentrations en chlorofluorocarbones (CFC-11, CFC-12, CFC-113) et entritium ont été déterminées dans l'eau souterraine d'un massif fracturé à Finnsjön en Suède. Le but de cette étude est de mieux cerner la précision de la méthode de datation au CFC dans ce type d'environnement hydrogéologique, tout en considérant d'éventuels phénomènes de dégradation et de mélange d'eaux. L'eau a été échantillonnée à une profondeur de 42 mètres dans trois forages alignés sur 800 mètres entre une zone de recharge et une zone de déversement. Les concentrations en CFC-113 sont dans la plupart

  20. Leak monitoring for CFC's, HCFC's, HFC's and oxygen depletion: Recent developments

    International Nuclear Information System (INIS)

    The implementation of the Montreal Protocol and Title VI of the Clean Air Act of 1990 are having significant effects on the supply and cost of halocarbon refrigerants. In the US, there will be no new CFC's produced after 1995. Conservation measures which include recovery and recycling are enhanced by continuous monitoring for leaks in refrigeration systems. Some of the non-ozone depleting substitutes for CFC's have toxicity and flammability properties which require continuous monitoring for health and safety. Both economic and safety considerations have led to an increased use of monitoring instruments for halocarbon refrigerant emissions. Halocarbon refrigerants are colorless, odorless and, in general, boil at or below room temperature. In addition, they are high molecular weight compounds with vapor densities three to five times that of air. When refrigerants escape from closed systems, they can be expected to settle into low lying areas (in the absence of air movement)

  1. Tungsten coatings electro-deposited on CFC substrates from oxide molten salt

    International Nuclear Information System (INIS)

    Tungsten is considered as plasma facing material in fusion devices because of its high melting point, its good thermal conductivity, its low erosion rate and its benign neutron activation properties. On the other hand, carbon based materials like C/C fiber composites (CFC) have been used for plasma facing materials (PFMs) due to their high thermal shock resistance, light weight and high strength. Tungsten coatings on CFC substrates are used in the JET divertor in the frame of the JET ITER-like wall project, and have been prepared by plasma spray (PS) and other techniques. In this study, tungsten coatings were electro-deposited on CFC from Na2WO4–WO3 molten salt under various deposition parameters at 900 °C in air. In order to obtain tungsten coatings with excellent performance, the effects of pulse duration ratio and pulse current density on microstructures and crystal structures of tungsten coatings were investigated by X-ray diffraction (XRD, Rigaku Industrial Co., Ltd., D/MAX-RB) and a scanning electron microscope (SEM, JSM 6480LV). It is found that the pulsed duration ratio and pulse current density had a significant influence on tungsten nucleation and electro-crystallization phenomena. SEM observation revealed that intact, uniform and dense tungsten coatings formed on the CFC substrates. Both the average grain size and thickness of the coating increased with the pulsed current density. The XRD results showed that the coatings consisted of a single phase of tungsten with the body centered cubic (BCC) structure. The oxygen content of electro-deposited tungsten coatings was lower than 0.05%, and the micro-hardness was about 400 HV

  2. Replacement of CFCs in thermodynamical systems; Remplacement des C.F.C. dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    Fleurance, M.

    1996-12-31

    Following the Montreal protocol and the withdrawal of the CFC-type refrigerating fluids, York France company has developed and adapted its equipments to new refrigerants. Each user will have to know how to define the best option for his installation: opting for or ignoring the withdrawal of CFCs, confining the installations, changing for new intermediate substitutes (HCFC-type), or changing or replacing with new long term substitutes (HFCs). (J.S.)

  3. Issues and recommendations related to replacement of CFC-114 at the uranium enrichment gaseous diffusion plant

    International Nuclear Information System (INIS)

    The operating uranium enrichment gaseous diffusion plants (GDPs) in Portsmouth, Ohio and Paducah, Kentucky, which are operated for the United States Department for Energy by Martin Marietta Energy Systems (MMES), currently use a chlorofluorocarbon (CFC-114) as the primary process stream coolant. Due to recent legislation embodied in the Clean Air Act, the production of this and other related chlorofluorocarbons (CFCS) are to be phased out with no production occurring after 1995. Since the plants lose approximately 500,000 pounds per year of this process stream coolant through various leaks, the GDPs are faced with the challenge of identifying a replacement coolant that will allow continued operation of the plants. MMES formed the CFC Task Team to identify and solve the various problems associated with identifying and implementing a replacement coolant. This report includes a review of the work performed by the CFC Task Team, and recommendations that were formulated based on this review and upon original work. The topics covered include; identifying a replacement coolant, coolant leak detection and repair efforts, coolant safety concerns, coolant level sensors, regulatory issues, and an analytical decision analysis

  4. Manufacturing and testing of a copper/CFC divertor mock-up for JET

    International Nuclear Information System (INIS)

    An actively cooled divertor is a possible option for future developments at The Joint European Torus (JET). A proof of principle actively cooled tile has been produced in order to qualify the relevant manufacturing technologies and the non destructive control processes. In this frame Ansaldo Ricerche (ARI) has been involved in the construction of a mock-up comprising 6 OFHC copper tubes for water cooling that are brazed to a plate made out of carbon fibre composite (CFC). The final objective was the high heat flux testing of the mock-up at JET in order to evaluate the general behaviour of the component under relevant operating conditions. The key point of the work was the realisation of a sound joint by adapting the expertise gained in ARI in previous R and D activities on brazing heterogeneous materials. Reliable methods for ultrasonic examinations of the pieces were also set up. For successful application to the JET pumped divertor a water-cooled CFC target plate must show surface temperatures of 2. Furthermore, global hydraulic considerations specific to JET limit the system pressure to 0.7 MPa. In such a design, critical heat flux is not the key limit, rather the reliability of the CFC-copper joint in terms of extent of wetting. First tests in the neutral beam test bed at JET show an adequate response for fluxes up to 15 MW/m2. (orig.)

  5. CFC-11 destruction by microwave torch generated atmospheric-pressure nitrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Jasinski, Mariusz; Mizeraczyk, Jerzy; Zakrzewski, Zenon [Centre for Plasma and Laser Engineering, Institute of Fluid Flow Machinery, Polish Academy of Sciences, Gdansk (Poland); Ohkubo, Toshikazu [Department of Electrical and Electronic Engineering, Oita University, Oita (Japan); Chang Jenshih [Department of Engineering Physics, McMaster University, Hamilton, ON (Canada)

    2002-09-21

    A novel plasma method and its application for destruction of Freons using a moderate-power (several hundred watts) microwave torch discharge (MTD) in atmospheric-pressure flowing nitrogen are presented. The capability of the MTD to decompose Freons is demonstrated using a chlorofluorocarbon CCl{sub 3}F (Freon CFC-11) as an example. The gas flow rate and microwave power (2.45 GHz) delivered to the MTD were 1-3 litre min{sup -1} and 200-400 W, respectively. Concentration of the CFC-11 in the nitrogen was up to 50%. The results show that the decomposition efficiency of CFC-11 is up to 100% with the removal rate of several hundred g h{sup -1} and energy efficiency of about 1 kg kWh{sup -1}. This impressive performance, superior to that of other methods, is achieved without generating any significant unwanted by-products. As a result of this investigation, a relatively low-cost prototype system for Freon destruction based on a moderate-power MTD and a scrubber is proposed. (author)

  6. Effects of acoustic hood on noise, CFC-11, and particulate matter in a recycling system for waste refrigerator cabinet.

    Science.gov (United States)

    Guo, Jie; Fang, Wenxiong; Yang, Yichen; Xu, Zhenming

    2014-11-01

    The mechanical-physical process was proven to be technologically feasible for waste refrigerator recycling and has been widely used in the typical e-waste recycling factories in China. In this study, effects of the acoustic hood on the reduction of noise level, CFC-11, and heavy metals (Cr, Ni, Cu, Cd, and Pb) in particulate matter (PM) were evaluated. For noise pollution, the noise level inside and outside the acoustic hood was 96.4 and 78.9 dB, respectively. Meanwhile, it had a significant effect on A-weighted sound level with a reduction from 98.3 to 63.6 dB. For CFC-11 exposure, abundant CFC-11 (255 mg/m(3)) was detected in the acoustic hood. However, the mean concentration of CFC-11 at the outline of polyurethane foam collection was obviously diminished to 14 mg/m(3), and no CFC-11 was monitored around the acoustic hood. The concentrations of PM and heavy metals in PM outside the acoustic hood were lower than those inside the acoustic hood due to the physical barriers of the acoustic hood. Based on the risk assessment, only adverse health effect caused by Pb might likely appear. All the results can provide the basic data for pollution control and risk assessment in waste refrigerator recycling system. PMID:24965005

  7. National action plan for recovery, recycling and reclamation of chlorofluorocarbons (CFC's); Part 1. Piano operativo nazionale per il recupero, il riciclaggio, il trattamento dei clorofluorocarburi (CFC); Parte prima

    Energy Technology Data Exchange (ETDEWEB)

    1993-02-01

    This report develops a plan for the recovery recycling, and reclamation of chlorofluorocarbons (CFC's) for reuse in Canada to ensure that the large consumer and marketplace inventory of these compounds does not enter the atmosphere. Reuse is further necessary for future operation of equipment when the production and importation of CFC's becomes severely restricted or is eliminated. The report also deals with the need to recover hydrochlorofluorocarbons (HCFC's) for reuse. A harmonized national action plan containing a set of agreed-upon objectives and tasks is developed to provide a basis for federal and provincial programs, regulatory action, and data development.

  8. Chapter 11. Comparison of the CFC technique with other techniques (3H, 3H/3He, 85Kr)

    International Nuclear Information System (INIS)

    The applications of CFC technique to solve specific hydrological problems are discussed in other Chapters. It should be pointed out that very often interpretations of CFC data need to rely extensively on additional data. Measurements of concentrations of dissolved gases, such as dissolved oxygen, to determine if there is potential for microbial degradation, can be extremely useful. Noble gas measurements are useful in defining recharge temperature and excess air. Measurements of dissolved nitrogen and argon can also be used to determine recharge temperature and excess air and recognize environments undergoing denitrification. Measurements of dissolved methane are useful in recognizing environments in which all three CFCs can be degraded. Isotope techniques are also useful tools. Tritium measurements have proven particularly useful in helping to validate CFC apparent ages

  9. Pre-Brazed Casting and Hot Radial Pressing: A Reliable Process for the Manufacturing of CFC and W Monoblock Mockups

    International Nuclear Information System (INIS)

    ENEA association is involved in the European International Thermonuclear Experimental Reactor (ITER) R-and-D activities and in particular for the manufacturing of high heat flux plasma-facing components (HHFC), such as the divertor targets, the baffles and the limiters: During the last years ENEA has manufactured actively cooled mock-ups by using different technologies, namely brazing, diffusion bonding and hot isostatic pressing (HIPping). A new manufacturing process has been set up and tested. It was successfully applied for the manufacturing of W armoured monoblock mockups. This technique is the HRP (Hot Radial Pressing) based on performing a radial diffusion bonding between the cooling tube and the armour tile by pressurizing only the internal tube and by keeping the joining zone in vacuum and at the required bonding temperature. The heating is obtained by a standard air furnace. The next step was to apply the HRP technique for the manufacturing of CFC armoured monoblock components. For this purpose some issues have to be solved like as the low CFC tensile strength, the pure copper interlayer between the heat sink and the armour necessary to mitigate the stress at the joint interface and the low wettability of the pure copper on the CFC matrix. This paper reports the research path followed to manufacture a medium scale vertical target CFC and W armoured mockup by HRP. An ad hoc rig able to maintain the CFC in a compressive constant condition was also designed and tested. The casting of a soft copper interlayer between the tube and the tile was performed by a new technique: the Pre-Brazed Casting (PBC, ENEA patent). Some mock-ups with three NB31 CFC tiles were successfully manufactured and tested to thermal fatigue using electron beam facilities. They all reached at least 1000 cycles at 20 MW/m2 without suffering any damage. The manufactured medium scale vertical target mock-up is now under testing at the FE2000 (France) facility. (author)

  10. Fluorinated ethers: A new series of CFC substitutes. Rept. for Aug 88-Oct 91

    International Nuclear Information System (INIS)

    The paper discusses fluorinated ethers, a new series of chlorofluorocarbon (CFC) substitutes. Compounds synthesized to produce substances with suitable refrigerant properties have generally left out sulfur, nitrogen, and oxygen. The general result is that all currently proposed substitutes for CFC and halon replacements have been alkanes. Because of the limited number of compounds of these elements having suitable properties and the current decision to phase out CFCs and (eventually) hydrochlorofluorocarbons (HCFCs), restricting the search to alkanes only is no longer tenable. Consideration of fluorinated ethers effectively doubles the potential list of contenders. The fact that divalent oxygen in a fluorocarbon chain has only a modest effect on vapor pressure, compared to the alkane of similar carbon number and substitution, should be a strong incentive to investigate these compounds. Several new fluorinated compounds have been synthesized and characterized. Additionally, several compounds for which data were not available were synthesized. These compounds, both new and two 'revisited' ones, could function as replacement working fluids in many applications requiring similar properties. Without chlorine, all have zero ozone depletion potential

  11. PERFORMANCE TESTING OF A SEMI-HERMETIC COMPRESSOR WITH HFC-236EA AND CFC-114 AT CHILLER CONDITIONS

    Science.gov (United States)

    The paper gives results of tests of both HFC-236ea and CFC-114 at a range of temperatures covering surface craft and submarine chiller conditions. vaporating temperatures ranged from 1.7 to 12.8 C, and condensing temperatures from 40.6 to 65.6 C, in order to develop a nine-point ...

  12. CFC (Comment-First-Coding)--A Simple yet Effective Method for Teaching Programming to Information Systems Students

    Science.gov (United States)

    Sengupta, Arijit

    2009-01-01

    Programming courses have always been a difficult part of an Information Systems curriculum. While we do not train Information Systems students to be developers, understanding how to build a system always gives students an added perspective to improve their system design and analysis skills. This teaching tip presents CFC (Comment-First-Coding)--a…

  13. Partitioning sources of recharge in environments with groundwater recirculation using carbon-14 and CFC-12

    Science.gov (United States)

    Bourke, Sarah A.; Cook, Peter G.; Dogramaci, Shawan; Kipfer, Rolf

    2015-06-01

    Groundwater recirculation occurs when groundwater is pumped from an aquifer onto the land surface, and a portion of that water subsequently infiltrates back to the aquifer. In environments where groundwater is recirculated, differentiation between various sources of recharge (e.g. natural rainfall recharge vs. recirculated water) can be difficult. Groundwater age indicators, in particular transient trace gases, are likely to be more sensitive tracers of recharge than stable isotopes or chloride in this setting. This is because, unlike stable isotopes or chloride, they undergo a process of equilibration with the atmosphere, and historical atmospheric concentrations are known. In this paper, groundwater age indicators (14C and CFC-12) were used as tracers of recharge by surplus mine water that is discharged to streams. Ternary mixing ratios were calculated based on 14C and CFC-12 concentrations measured along three transects of piezometers and monitoring wells perpendicular to the creeks, and from dewatering wells. Uncertainty in calculated mixing ratios was estimated using a Monte Carlo approach. Ternary mixing ratios in dewatering wells suggest that recharge by mine water accounted for between 10% and 87% of water currently abstracted by dewatering wells. The calculated mixing ratios suggest that recharge by mine water extends to a distance of more than 550 m from the creeks. These results are supported by seepage flux estimates based on the water and chloride balance along the creeks, which suggest that 85-90% of mine water discharged to the creeks recharges the aquifer and recharge by mine water extends between 110 and 730 m from the creeks. Mixing calculations based on gaseous groundwater age indicators could also be used to partition recharge associated with agricultural irrigation or artificial wetland supplementation.

  14. CFCI3 (CFC-11): UV Absorption Spectrum Temperature Dependence Measurements and the Impact on Atmospheric Lifetime and Uncertainty

    Science.gov (United States)

    Mcgillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

    2014-01-01

    CFCl3 (CFC-11) is both an atmospheric ozone-depleting and potent greenhouse gas that is removed primarily via stratospheric UV photolysis. Uncertainty in the temperature dependence of its UV absorption spectrum is a significant contributing factor to the overall uncertainty in its global lifetime and, thus, model calculations of stratospheric ozone recovery and climate change. In this work, the CFC-11 UV absorption spectrum was measured over a range of wavelength (184.95 - 230 nm) and temperature (216 - 296 K). We report a spectrum temperature dependence that is less than currently recommended for use in atmospheric models. The impact on its atmospheric lifetime was quantified using a 2-D model and the spectrum parameterization developed in this work. The obtained global annually averaged lifetime was 58.1 +- 0.7 years (2 sigma uncertainty due solely to the spectrum uncertainty). The lifetime is slightly reduced and the uncertainty significantly reduced from that obtained using current spectrum recommendations

  15. High heat load test of CFC divertor target plate with screw tube for JT-60 superconducting modification

    International Nuclear Information System (INIS)

    A flat carbon fiber composite (CFC) tile mock-up with screw tubes, which have helical fins like a nut, was fabricated aiming at further improvement of the heat removal performance of the cost-effectively manufactured divert or target for JT-60SC (modified JT-60 as a superconducting coil tokamak). The heat removal performance of the mock-up was successfully demonstrated on the JAERI Electron Beam Irradiation Stand. The estimated heat transfer coefficient of the screw tube at the non-boiling region was roughly three times higher than that of the smooth tube. This corresponds to 1.5 times that of the swirl tube. A heat cycle test of 10 MW/m2 showed that the mock-up with the screw tubes could withstand for 1400-cycles. These results indicate that the divertor target plate with the flat CFC tile and the screw tube can be a promising candidate for the JT-60SC divertor target

  16. Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11)

    Science.gov (United States)

    Benardini, James N.; Koukol, Robert C.; Kazarians, Gayane A.; Morales, Fabian

    2013-01-01

    NASA Procedural Requirement 8020.12C entitled "Planetary Protection Provisions for Robotic Extraterrestrial Missions" states that the source-specific encapsulated microbial density for encapsulated organisms (div(0)) in nonmetallic materials ranges from 1-30 spores/cubic cm. The standard laboratory procedure, NASA Standard Procedures for the Microbial Examination of Space Hardware, NHB 5340.1B, does not provide any direction into the methodologies to understand the bioburden within such a fluid as CFC-11 (Freon). This general specification value for the Freon would be applicable to the Freon charged within the Mars Science Laboratory fs (MSL fs) Heat Rejection System. Due to the large volume required to fill this system, MSL could not afford to conservatively allocate 55.8% of the total spore budget of the entire laboratory system (rover, descent stage, cruise stage, and aeroshell) of 5.00 X 10(exp 5) spores at launch. A novel filtration approach was developed to analyze the Freon employing a 50 kDa molecular weight cutoff (MCO) filter, followed by 0.22-micron pore-size filter to establish a calculated microbial bioburden.

  17. Tritiated thymidine and deoxycytidine suicide of mouse hemopoietic colony forming cells (CFC)

    International Nuclear Information System (INIS)

    Significant enhancement of tritiated dCyd suicide occurred when unlabelled dThd was added to cultures of mouse monocytic colony-forming cells. Incorporation experiments supported the suicide experiments in that incorporation of tritiated dCyd into DNA was significantly increased. One hundred micromolar dCyd significantly reduced the radiotoxicity of 0.3 μCi of tritiated dThd; incorporation experiments indicated a dose-related reduction in the incorporation of tritiated dThd into DNA with the addition of 1-100 μM unlabelled dCyd. The addition of 1 μM aminopterin reversed the effect of 100 μM deoxycytidine; viz., incorporation of dThd into DNA was 90% of controls. Aminopterin had a similar effect on deoxyuridine reversal of tritiated dThd incorporation into DNA. Aminopterin had no effect on the reduction of tritiated dThd incorporation into DNA due to the addition of 100 μM unlabelled thymidine. Unlabelled ribonucleosides, Urd and Cyd, did not significantly affect the suicide pattern of tritiated dThd or dCyd when they were added to CFC cultures. Unlabelled deoxyribonucleosides, dThd or dCyd, did not significantly affect the suicide pattern of either tritiated Cyd or Urd when they were added to cultures containing tritiated ribonucleosides. Unlabelled Urd or Cyd was effective in reversing the suicide due to tritiated Urd or Cyd. (author)

  18. Shifting the CFC/W transition point on the first ITER divertor target plates: equilibrium considerations

    Science.gov (United States)

    Kolesnikov, R. A.; Bulmer, R. H.; Lodestro, L. L.; Casper, T. A.; Pitts, R. A.

    2012-03-01

    In the 2007 ITER Design Review, the CFC/W transition point on the first divertor target plates was lowered by 10 cm to allow some experience to be gained in the non-active phases of vertical target operation with strike points on W surfaces, in preparation for a full W divertor in the nuclear phase. For operation on W just above the transition point, we use the CORSICA code to investigate the range of possible H- and L-mode equilibria, with emphasis on the maximum plasma current, achievable shapes, etc. We then investigate the operational space as the transition is lowered still further (both L- and H-mode), while still ensuring sufficient carbon vertical target extent to fulfill the requirements of the non-active phase program. The primary aim of this study is to determine if the current transition point, which can still be modified within some range if required, is optimized with respect to gaining early operational experience on an all-metal target before the nuclear phases begin. In our previous work [1], we investigated the size of feasible βp--li space for both reference and elevated strikes for operation at 14 MA (both L- and H-mode) as well as 12 MA (H-mode) currents. In this paper we present new results on the maximum achievable plasma current as a function of strikes locations. Also, we study plasma self-inductance, volt-second consumption and the vertical instability over the range of the new equilibria. [1] R.A. Kolesnikov, et al., 53^rd APS/DPP, Salt Lake City (2011)

  19. Microstructure characterization of advanced protective Cr/CrN+a-C:H/a-C:H:Cr multilayer coatings on carbon fibre composite (CFC).

    Science.gov (United States)

    Major, L; Janusz, M; Lackner, J M; Kot, M; Major, B

    2016-06-01

    Studies of advanced protective chromium-based coatings on the carbon fibre composite (CFC) were performed. Multidisciplinary examinations were carried out comprising: microstructure transmission electron microscopy (TEM, HREM) studies, micromechanical analysis and wear resistance. Coatings were prepared using a magnetron sputtering technique with application of high-purity chromium and carbon (graphite) targets deposited on the CFC substrate. Selection of the CFC for surface modification in respect to irregularities on the surface making the CFC surface more smooth was performed. Deposited coatings consisted of two parts. The inner part was responsible for the residual stress compensation and cracking initiation as well as resistance at elevated temperatures occurring namely during surgical tools sterilization process. The outer part was responsible for wear resistance properties and biocompatibility. Experimental studies revealed that irregularities on the substrate surface had a negative influence on the crystallites growth direction. Chromium implanted into the a-C:H structure reacted with carbon forming the cubic nanocrystal chromium carbides of the Cr23 C6 type. The cracking was initiated at the coating/substrate interface and the energy of brittle cracking was reduced because of the plastic deformation at each Cr interlayer interface. The wear mechanism and cracking process was described in micro- and nanoscale by means of transmission electron microscope studies. Examined materials of coated CFC type would find applications in advanced surgical tools. PMID:26788794

  20. Potential groundwater age tracer found: Halon-1301 (CF3Br), as previously identified as CFC-13 (CF3Cl)

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2014-09-01

    Groundwater dating using anthropogenic and natural tracer substances is a powerful tool for understanding groundwater dynamics for improved management of groundwater resources. Due to limitations in individual dating methods, often multiple tracers are used to reduce ambiguities. It is commonly accepted that there is a need for further complementary age tracers, in addition to current ones (e.g., tritium, SF6, and CFCs). We propose a potential new groundwater age tracer, Halon-1301 (CF3Br), which can easily be determined using gas chromatography with an attached electron capture detector (GC/ECD) developed by Busenberg and Plummer (2008). Its peak was noted by Busenberg and Plummer (2008), but they believed it to be CFC-13 (CF3Cl) at that time. We performed rigorous tests on gases containing or excluding Halon-1301 and CFC-13 and modern water samples and concluded that the two compounds have extremely similar retention times. Additionally, we found that the ECD response of CFC-13 is far too low to be detected in groundwater or air using standard volumes and sampling techniques. However, the peak areas and concentrations Busenberg and Plummer (2008) reported are in line with what would be expected for Halon-1301. Thus, we are confident that the peak formerly identified as CFC-13 is actually Halon-1301. Busenberg agrees with our findings. We further suggest that Halon-1301 has potential as a (complementary) age tracer, due to its established atmospheric history, and could hypothetically be used to date groundwater recharged in the 1970s or onward. We discuss known relevant properties, such as solubility and stability of Halon-1301 in the context of how these effect its potential application as a groundwater age tracer. Some open questions remain concerning how conservative Halon-1301 is—is it subject to degradation, retardation, and/or local contamination in groundwater. We are confident that Halon-1301 possesses important tracer relevant properties, but further

  1. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Technical progress report, 1 April 1995--30 June 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.; Amrane, K.

    1995-08-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The AirConditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  2. Two-phase flows during draining of liquefied gases initially undersaturated. Validation by water and CFC11; Ecoulements diphasiques lors de la vidange de gaz liquifies initialement sous satures. Validation par l`eau et le CFC11

    Energy Technology Data Exchange (ETDEWEB)

    May, L.

    1996-12-11

    In petroleum industry, the safety studies require to estimate the two-phase flow during accidental draining of pressurized liquefied gas storages. Meanwhile the mass flow strongly depends of initial conditions. Then it is primordial to be able to reckon it in the case where it is the highest, that is to say when the fluid is initially undersaturated. An experimental installation has been carried out. The used fluids are water and CFC11. The experimental measures show that the thermodynamic conditions at the inlet of the pipe (P at +/- 15 mbar and T at +/- 0.15 degrees Celsius) are well controlled. The measured mass flows are compared to different models. The frictions in the monophase domain have been taken into account. It has been shown that the extensive H.E.M. model perfectly estimates the mass flow (as well as for water than for CFC11) for large deviations to saturation. In order to correctly predict the domain of weak variation to saturation, D.E.M. (out of equilibrium) models or H.R.M. (homogeneous model of relaxation) models have to be used. (O.M.) 50 refs.

  3. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    Directory of Open Access Journals (Sweden)

    I MADE RASTA

    2015-06-01

    Full Text Available CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 consisting supervision rules on producing, consuming, and treading ozone damaging materials. The government of Indonesia had ratified the convention through President Decree Number 23 Year 1999. The ozone layer reservation program implementation in Indonesia is facilitated by KLH. Governor of Bali issued Decree Number 523/04-B/HK/2010 on membership restructuring of ozone layer reservation and ozone damaging materials control team work in province of Bali. This research was done in 27 car AC service companies or workshop, which received grant of 3R engine in Denpasar, Bali. The research was dominantly focused on monitoring and evaluation, that is how car AC service company or workshop manage CFC/ R-12 and HFC/R-134a refrigerant at service time using 3R engine that refrigerant does not escape to atmostphere. Cooling machine work procedure test (COP was conducted in laboratory. Research result showed that car AC service company or workshop could manage CFC/ R-12 and HFC /R-l 34a eefctively ( 88,3%. The cooling engine work procedure using CFC /R-12 as the result of 3R engine recovery and recycel resulted in 2,435 while pure CFC/R-12 resulted in 2,54. There were differences in cooling engine work procedure to the use of pure CFC/R-12 refrigerant with that resulted by 3R engine with avarage difference 0,089 or 3,53%.

  4. Consistent sets of atmospheric lifetimes and radiative forcings on climate for CFC replacements: HCFCs and HFCs

    Science.gov (United States)

    Naik, Vaishali; Jain, Atul K.; Patten, Kenneth O.; Wuebbles, Donald J.

    2000-03-01

    Recognition of deleterious effects of chlorine and bromine on ozone and climate over the last several decades has resulted in international accords to halt the production of chlorine-containing chlorofluorocarbons (CFCs) and bromine-containing halons. It is well recognized, however, that these chemicals have had important uses to society, particularly as refrigerants, as solvents, as plastic blowing agents, as fire retardants and as aerosol propellants. This has led to an extensive search for substitute chemicals with appropriate properties to be used in place of the CFCs and halons. The purpose of this study is to evaluate in a consistent manner the atmospheric lifetime and radiative forcing on climate for a number of replacement compounds. The unique aspect of this study is its attempt to resolve inconsistencies in previous evaluations of atmospheric lifetimes and radiative forcings for these compounds by adopting a uniform approach. Using the latest version of our two-dimensional chemical-radiative-transport model of the global atmosphere, we have determined the atmospheric lifetimes of 28 hydrohalocarbons (HCFCs and HFCs). Through the comparison of the model-calculated lifetimes with lifetimes derived using a simple scaling method, our study adds to earlier findings that consideration of stratospheric losses is important in determining the lifetimes of gases. Discrepancies were found in the reported lifetimes of several replacement compounds reported in the international assessment of stratospheric ozone published by the World Meteorological Organization [Granier et al., 1999] and have been resolved. We have also derived the adjusted and instantaneous radiative forcings for CFC-11 and 20 other halocarbons using our radiative transfer model. The sensitivity of radiative forcings to the vertical distribution of these gases is investigated in this study and is shown to be significant. The difference in the global radiative forcing arising from the assumption of a

  5. Tritium retention measurements by accelerator mass spectrometry and full combustion of W-coated and uncoated CFC tiles from the JET divertor

    Science.gov (United States)

    Stan-Sion, C.; Bekris, N.; Kizane, G.; Enachescu, M.; Likonen, J.; Halitovs, M.; Petre, A.; contributors, JET

    2016-04-01

    Accelerator mass spectrometry (AMS) and the full combustion method (FCM) followed by liquid scintillation counting were applied to quantitatively determine the tritium retention in the tungsten-coated carbon fibre composites (CFC), in comparison to uncoated CFC tiles from the JET divertor. The tiles were adjacent and exposed to plasma operations between 2007 and 2009. The tritium depth profiles are showing that the tritium retention on the W-coated tile was reduced by a factor of 13.5 in comparison to the uncoated tile whereas the bulk tritium concentration is approximately the same for both tiles.

  6. The damage of ozone layer from the influence of CFC fluids and their contribution on the greenhouse effect

    International Nuclear Information System (INIS)

    The first vapor compression refrigeration systems and the problems with the used refrigerants are discussed. A result of the research were CFC fluids which are nontoxic, nonflammable, stable and inert. The excellent characteristics of CFC were a good reason for an enlarged expanding use in other applications, such as aerosols, polyurethane foam, solvent etc. After the discovery that CFCs damage the protective ozone layer in the stratosphere, Montreal protocol is signed (1987), which foresees a cutback in the production and use of CFCs. The phase out in the production of aerosols, foams and solvents is very effective and fast, but in the refrigeration systems is very slow because of their complex requirements and conflict of interests. The newest regulations from UNEAP are: the ban in the production and use of CFCs from 01 January, 1996. The long life of CFCs in the atmosphere contributes to the greenhouse effect and increase the average temperature on earth. The effect is mainly caused by carbon dioxide emissions (50%), while the contribution of CFCs is about 20 to 25%. The well known companies offer on the market new alternative fluids for refrigeration systems, mainly HFC fluids, but their influence upon the environment is still not proved. We already have the lesson of history. (author)

  7. New high O2 carrying perfluorochemical emulsions: toxicity, radiosensitivity of GM-CFC and development of metastases in mice

    International Nuclear Information System (INIS)

    The effects of two new concentrated perfluorochemical emulsions based on F-66E and PFOB, which carry significantly more oxygen than Fluosol-DA 20%, were tested on normal tissues (toxicity and radiation response) and on the development of metastases from Lewis Lung Carcinoma (3LL) in female C57 BL/6 mice. Twenty one days after injection of F-66E or PFOB emulsions (15 ml/kg body weight), the spleen and liver weights were significantly increased but had returned to normal after 2-3 months. Splenomegaly already observed in 3LL bearing mice was significantly increased by F-66E emulsion injection. The radiosensitivity of GM-CFC was not altered when unanesthetized GM-CFC was not altered when unanesthetized mice were pretreated with F-66E emulsions and/or carbogen 1 hr prior to and during irradiation. The rate of tumor take and the period before detection of tumors were not modified when an emulsion of F-66E was injected simultaneously or 10 days after 3LL cells. Mean survival of mice, and the number of metastases on lung surfaces were similar in F-66E injected mice and control mice

  8. WO3/ZrO2 Strong Acid as a Catalyst for the Decomposition of Chlorofluorocarbon (CFC-12)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ Introduction Chlorofluorocarbons (CFCs) diffusing to the stratosphere is a major reason for ozone depletion[1]. Also CFCs has been claimed to be notorious for its greenhouse effect[2]. So, recently it has become very important to eliminate CFCs as far as protecting the ozone layer surrounding the earth is concerned. Among various kinds of approaches to do destruction to CFCs, the catalytic decomposition seems to be the most practical and energetically favorable one, especially for treating small amounts of CFCs[3,4]. Recently, Fu et al.[3] reported that TiO2 modified with H2SO4 was much more active than TiO2 for the decomposition of CFC-12 in the presence of water vapor, and they attributed this tremendous enhancement in activity to the superacidic property of the sulfated catalyst. Their research results substantially stimulate us to investigate the catalytic decomposition of CFC-12 in the presence of water vapor over WO3/ZrO2 strong acid, which is more thermally stable than the sulfated oxides superacids[5].

  9. Refrigerating and air conditioning systems in the Republic of Macedonia regarding to the use of CFC fluids

    International Nuclear Information System (INIS)

    Classification of refrigerating systems and their condition in the Republic of Macedonia, by the capacity and application. Review of the subjects involved in refrigeration in the Republic of Macedonia: manufactures of refrigerating systems, distributors of refrigerating equipment, distributors of (CFC) refrigerants, maintenance and servicing of refrigerating systems regarding to the quality and the weak points. Measures and projects in the Republic of Macedonia in the field of the protection of the ozone layer. Regulations by the Montreal protocol. Regulations in the Republic of macedonia concerning refrigerating systems and CFC fluids in them. Country programme of the Republic of Macedonia and institutional activities. Projects in 'Frinko; and 'Sileks' where the manufacturing technologies are changed. Project 'Refrigerant management plan' in which are included: forming of training centers, training of service technicians and engineers involved in refrigeration and air conditioning, equipping of services and companies with on equipment for good practice in refrigeration and refrigerant's recovery, forming of recycling centers for purification of used refrigerants, training of custom officers. (Author)

  10. Micro-chemical analysis of high heat loaded CFC-Cu interfaces from Tore Supra and Wendelstein 7-X

    International Nuclear Information System (INIS)

    A comparison of high-heat-flux tested carbon-fiber reinforced carbon (CFC)/Cu materials of Tore Supra and Wendelstein 7-X plasma-facing components is made in order to understand the different fatigue behavior of the bonding interfaces, in particular for the Tore Supra materials. The elemental distribution around the bonding layer and the chemical composition of the active element titanium are characterized by secondary ion mass spectrometry and x-ray photoelectron spectroscopy. The results show that the improved bonding of the Wendelstein 7-X target elements compared to the Tore Supra pump limiter elements is due to a modified silicon and titanium distribution at the bonding interface. However, the difference in fatigue behavior between the two Tore Supra components cannot be attributed to the bonding interface, since the elemental distribution and chemistry of these components are identical and no degradation is observed after an extended heat flux exposure.

  11. Influence of wind fields on the uptake of CFC-11 in the global ocean model%风场对全球海洋CFC-11吸收的影响

    Institute of Scientific and Technical Information of China (English)

    方怡; 徐永福; 李阳春; 覃军

    2014-01-01

    为了在中国科学院大气物理研究所的全球海洋模式(LASG/IAP Climate Ocean Model, LICOM)中研究不同的风场引起的海气传输速度对三氯一氟甲烷(CFC-11)在海洋中的分布和吸收产生的影响,同时选出更适用于 LICOM 模式模拟海洋对气体吸收的风场,本文做了4组对比实验,即传输速度为常数(实验-C)以及依赖3个不同风场(Esbensen and Kushnir观测风场(实验-EK)、National Centers for Environmental Prediction(NCEP)再分析风场(实验-NP)、QuikSCAT卫星风场(实验-QS))的实验。在对比分析中重点考察了CFC-11的海气通量、海表浓度、水柱总量、传输过程等。结果显示,不同风场带来的传输速度差异会造成模拟结果在局部海域存在显著差异,但在大部分海域的差异并不显著。而且随着积分时间的增加,从海气通量、存储量两方面可以看出,不同模拟结果之间的差异有着减小的趋势。如1955年1月北大西洋局部地区,不同的风场下的海气通量模拟结果间的差异达到20%左右,到了1995年1月这种差异下降到15%左右。此外,传输速度的选取依赖风场计算值的全球平均值(试验-C)会造成模拟结果相对偏小,而风速相对较大的QuikSCAT卫星风场资料在一定程度上使得模式模拟结果与观测资料更为接近。%Using a global ocean general circulation model (LICOM) developed by the Institute of Atmospheric Physics (IAP) of the Chinese Academy of Sciences, we conducted four numerical experiments to investigate the influence of different wind fields on the uptake and transport of CFC-11 in the global ocean. Three experiments were performed using the same formula of the air-sea gas transfer velocity that is dependent on wind speed, in which wind speeds were from Esbensen and Kushnir (Exp-EK), NCEP (Exp-NP) and QuickSCAT (Exp-QS). An-other experiment is called Exp-C, in which the transfer velocity is a space-independent constant of 14.5 cm

  12. EVALUASI PENGELOLAAN REFRIGERAN CFC, DAN HFC DENGAN MESIN 3R DAN UJI UNJUK KERJA MESIN PENDINGIN STUDI KASUS PADA BENGKEL AC MOBIL DI DENPASAR - BALI

    OpenAIRE

    I Made Rasta; I W. Kasa; I Gede Mahardika

    2015-01-01

    CFC refrigerant has been known to be one of causes of ozone layer diminishing and HFC is one of green house gases contributing to global warming through the leak and synthetic refrigerant waste to environment. As a response to the ozone layer diminishment on stratosphere, UNEP, in 1981, through a negotiating process of international stages of development reserve the ozone layer through Wina Convention legalized in March 1985. It was then followed up with Montreal Protocol in September 1987 co...

  13. X-ray micro-laminography for the ex situ analysis of W-CFC samples retrieved from JET ITER-like wall

    Science.gov (United States)

    Tiseanu, I.; Craciunescu, T.; Lungu, M.; Dobrea, C.; Contributors, JET

    2016-02-01

    x-ray micro-laminography was qualified and implemented as a complementary solution for the 3D microstructural analysis of tungsten coated carbon-fibre reinforced carbon (W/CFC) samples retrieved from JET ITER-like wall. As expected, the W layers spatially correlate with the morphology of the CFC substrate. Three main cases were distinguished; (i) tungsten layers coated parallel to PAN fibre bundles tend to have a quasi-continuous, weakly waved surface (waves amplitude <100 μm) (ii) tungsten layers coated onto the relatively porous felt region appear to smoothly follow even the surface of the largest pores of around 250 μm and (iii) samples coated perpendicular to the PAN fibre bundles display frequently and strong crater-like discontinuities of the metal layer. The characteristics dimensions of these gaps range in the order of 300-400 μm both in the coating plane and perpendicular to it. On some craters the bottom W layer is broken and the generated debris can be found even deeper than one mm into the CFC substrate. These W particles, sized of 20-40 μm, are always found in the large gaps located between the fibre bundles perpendicular to the coated surface.

  14. Upwelling velocity and ventilation in the Mauritanian upwelling system estimated by CFC-12 and SF6 observations

    Science.gov (United States)

    Tanhua, Toste; Liu, Mian

    2015-11-01

    Transient tracer data (CFC-12 and SF6) from three oceanographic field campaigns to the Mauritanian Upwelling area conducted during winter, spring and summer from 2005 to 2007 is presented. The transient tracers are used to constrain a possible solution to the transient time distribution (TTD) along 18°N and to quantify the mean ages in vertical sections perpendicular to the coast. We found that an Inverse Gaussian distribution where the ratio of the moments Δ and Γ equals 1.2 is a possible solution (Δ/Γ = 1.2) of the TTD. The transient tracers further show considerable under-saturation in the mixed layer during the winter and spring cruises that can only be maintained by mixing or upwelling by tracer-poor water from below the mixed layer. We use dissipation data from microstructure measurements and the tracer depth distribution to quantify the flux of tracers to the mixed layer by vertical diffusivity and wind data from the ship to quantify the air-sea flux. We then use the magnitude of the under-saturation in the mixed layer to estimate the advective upwelling velocity which is the balance the first two processes, in a steady state assumption. We find that the upwelling velocities range from less than 1 to 5.6 × 10- 5 m s- 1 (SF6 transient tracer data for calculating upwelling velocity, and found an overall uncertainty of roughly ± 50%.

  15. Development of a low temperature solid HIP process for joining CFC monoblocks onto CuCrZr tubes

    International Nuclear Information System (INIS)

    A low temperature solid HIP process is developed for ITER Divertor Baffle components in order to join AMC CFC monoblocks onto CuCrZr tubes without overaging. For the fabrication solution annealed cold worked CuCrZr-tubes age-hardened during the hot isostatic pressing (HIP) process are joined to the back-casted (AMC) WHC copper ring of the WC monoblock. The process relevant influence parameters (clearance between components, thickness of can, maximum HIP pressure, pressure and temperature history in time) and quality relevant parameters (contact pressure at HIP interface, stresses in the WC body) are determined in a brainstorming. By using the design of experiments (DoE) software a number of parameter sets are defined that act as input for the process simulation via finite element method (FEM) based models each of which representing an individual parameter set. The values for the quality relevant parameters calculated this way are then evaluated with the DoE software in order to detect the functional dependencies between them. An optimum set of parameters is detected and has been verified successfully in a manufacturing process of several prototype components as well as full-scale components for the ITER Divertor Baffle. (author)

  16. Simulation experimental investigation of plasma off-normal events on advanced silicon doped CFC-NS31

    International Nuclear Information System (INIS)

    Fusion devices high heat loading due to off-normal events (e.g., plasma disruption, slow transients and ELMs, which can occur during a transition from detached to attached divertor operation) requires high thermal conductivity materials. Therefore, carbon fiber composites (CFCs) with high thermal conductivity are favorable. In the framework of the European Fusion Technology program, a great effort has been made to develop Si doped CFCs. NS31 is a 3D CFC containing about 8-10 at.% of silicon. The previous results showed, that NS31 poses lower chemical erosion, lower tritium retention and higher resistivity to water/oxygen reaction in comparing with undoped CFCs. Off-normal simulation experiments were performed under two conditions: (a) 700 MW/m2, 10 ms and (b) slow transient 20 MW/m2, 2 and 4 s. NS31 behaved very stable even under these extremely severe conditions. In this paper, the detailed results of simulation experiment on high heat loading due to off-normal events are presented and consequences are discussed

  17. Microstructure and properties of SiC gradiently coated Cf/C composites prepared by a RCLD method

    Institute of Scientific and Technical Information of China (English)

    Jun-hua Chen; Cuang-li Chen; Hao-ran Geng; Yan Wang

    2009-01-01

    The SiC gradiently coated carbon fiber/carbon (Cf/C) composites were prepared by a two-step rapid chemical liquid depo-sition (RCLD) method. The microstructure and properties of the composites were investigated using X-ray diffraction, scanning elec-tron microscopy together with energy dispersive X-ray analysis, bending tests, and oxidation tests. The experimental results show that the surface layer of the composites is composed of SiC, pyrocarbon, and carbon fibers. Their inner area consists of pyrocarbon and carbon fibers. The SiC content gradiently decreases with increasing distance from the outer surface to the center of the compos-ites. Furthermore, the thickness of the SiC layer increases with increasing tetraethylorthosilicate content and deposition time. SiC coatings have no significant influence on the bending strength of the composites. However, the oxidation resistance of the compos-ites increases with increasing thickness of the SiC layer.

  18. Post-coring entrapment of modern air in polar ice cores collected near the firn-ice transition: evidence from CFC-12 measurements in Antarctic firn air and shallow ice cores

    Directory of Open Access Journals (Sweden)

    M. Aydin

    2010-01-01

    Full Text Available In this study, we report the first measurements of CFC-12 (CCl2F2 in air extracted from shallow ice cores along with firn air CFC-12 measurements from three Antarctic sites. The firn air data are consistent with the known atmospheric history of CFC-12. In contrast, the ice core samples collected near the firn-ice transition exhibit anomalously high CFC-12 levels. Together, the ice core and firn air data provide evidence for presence of modern air entrapped in shallow ice core samples. We propose that this is due to closure of open pores after drilling, entrapping modern air and resulting in elevated CFC-12 mixing ratios. Our measurements reveal the presence of open porosity below the depth at which firn air samples can be collected and demonstrate how the composition of bubble air in shallow ice cores can be altered during the post-drilling period through purely physical processes. These results have implications for investigations involving trace gas composition of bubbles in shallow ice cores.

  19. Materials compatibility and lubricants research on CFC-refrigerant substitutes. Quarterly MCLR program technical progress report, January 1, 1995--March 31, 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.

    1995-04-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. The work is guided by an Advisory Committee consisting of technical experts from the refrigeration and air-conditioning industry and government agencies. The Air-Conditioning and Refrigeration Technology Institute, Inc., (ARTI) manages and contracts multiple research projects and a data collection and dissemination effort. Detailed results from these projects are reported in technical reports prepared by each subcontractor.

  20. Evaluation of the Erosion on the CFC tiles of the ITER Divertor by means o f FE calculations

    International Nuclear Information System (INIS)

    Full text of publication follows: The vertical target of the ITER divertor is armoured with Carbon Fibre Composite (CFC) mono-blocks in the lower part. This part is subjected to the maximum power and particles loads and, consequently, has a risk of high erosion and a significant risk of failure. In order to calculate the erosion during operation an original methodology has been developed using the CASTEM CEA finite element code. The calculation is based on a series of steady states the mesh being updated at each step of the iteration taking into account the rate of erosion between two steps. The model was developed thanks to the routines developed 10 years ago for the toroidal pump limiter of Tore Supra and takes into account shadowing effect and possible penetration of power into the gap between two mono-blocks. Both physical and chemical sputtering together with sublimation have been included in the code to describe the loss of material by the thermal and particle loads envisaged for ITER normal operation regime. This model has been validated by comparison with analytical or other code results. As erosion instability in normal operation in case of one faulty mono-block besides good ones due to the balanced rate between the various erosion mechanisms at different temperatures can be expected, coherent plasma parameters, which represent the worse cases of erosion in normal operation, have been taken into account to analyse the erosion behaviour of the mono-blocks. The aim of the study was also to evaluate the influence of a mono-block defect on erosion behaviour and the impact of these phenomena on the mono-block acceptance criteria. The calculations have pointed out the occurrence of some erosion instabilities for the studied cases (neighbour mono-block with reduced conductivity or with 90 deg. defects). Moreover it was shown that, when applying 20 MW/m2 to the erosion model already subjected to the normal condition loads for 10,000 s, the plasma shaping of the

  1. Greenhouse impact of CH{sub 4}, N{sub 2}O and CFC emissions in Finland and its control potential

    Energy Technology Data Exchange (ETDEWEB)

    Pipatti, R.; Savolainen, I.; Sinisalo, J. [VTT Energy, Espoo (Finland)

    1995-12-31

    Methane (CH{sub 4}), nitrous oxide (N{sub 2}O) and chlorofluorocarbon (CFC) emissions contribute considerably to the anthropogenic enhancement of Earth`s greenhouse effect. The limitation of atmospheric concentrations of CH{sub 4} and N{sub 2}O is considered important also in the Climate Convention. Chlorine released from the CFCs in the stratosphere destroys ozone (O{sub 3}) and the emissions are therefore regulated with the Montreal Protocol. The greenhouse impact of CFCs might be, at least to some extent, compensated by the depletion of O{sub 3} which is also a greenhouse gas. The objective of the presentation is to assess the role of anthropogenic CH{sub 4}, N{sub 2}O, and CFC emissions in the total direct greenhouse impact due to human activities in Finland. The emission estimates for the gases are presented, as well as scenarios for emission history, future development and control potential. The greenhouse impact of the gases is compared with that of carbon dioxide (CO{sub 2}) emissions in Finland. (author)

  2. The impact of thermal fatigue and carbidization on the W coatings deposited on CFC tiles for the ITER-like Wall project at JET

    International Nuclear Information System (INIS)

    Highlights: ► Degradation curves of the W coatings depend on temperature and number of pulses. ► Thermo-mechanical properties of the W coatings are associated with degradation curves. ► Thermal fatigue and carbidization affect the interface between CFC and W. ► A pore structure was detected at the interface by SEM examination. -- Abstract: Since August 2011 JET operates with the ITER-like wall comprising bulk Be tiles, bulk W tiles and W coated CFC tiles with a thickness of 10–15 μm and 20–25 μm. In order to evaluate behavior of the W coatings to a cyclic thermal loading relevant to JET operation, high heat flux (HHF) tests have been carried out up to 5100 pulses with an electron beam facility at peak temperatures of 1000 °C, 1250 °C and 1450 °C. The pulse duration was 24 s. Optical inspections of the W layer performed periodically by interrupting the test revealed small delaminations with the size of 50–500 μm. The dependence of the delamination percentage on the number of pulses can be seen as a degradation curve for each particular W coating. In this way the thermo-mechanical properties of the W coatings can be characterized quantitatively. Thermal fatigue and carbidization of the tungsten due to the diffusion of the carbon from the substrate have been recognized as mechanisms for degradation of the coatings. Tungsten carbides have been identified by using TEM (transmission electron microscopy) diffraction analysis on FIB (focused ion beam) prepared cross-section samples subjected to HHF tests. Nano-pores developed at the CFC–Mo and Mo–W interfaces during the tests might be also responsible for the degradation of the coating

  3. Multi-tracer approach (18O, 3H/3He, CFC, SF6, 35S) to find the best emergency drinking water supply, Vorarlberg, Austria

    Science.gov (United States)

    Kralik, Martin; Vergnaud, Virginie; Uriostegui, Stephanie; Esser, Bradley

    2016-04-01

    To provide an emergency drinking water supply in case of catastrophic events (regional chemical accidents, floods, earth quakes etc.), wells and springs should be known which are fed by a large reservoir. Such reservoirs provide a good filtering capacity and long Mean Residence Times (MRTs) of the raw water. Their existence allows to use these resources for longer periods excluding the danger of contamination. This provides the water authorities the necessary time to set measures to protect the general water supply. After preselection of 16 wells and springs all over the territory of the province of Vorarlberg at the western end of Austria by the local water authority, these wells and springs were measured (water temperature, electric conductivity, pH and dissolved oxygen content) and sampled monthly for δ 18O/2H measurements over the winter half-year 2013/14. At the same time the tritium concentrations of the October and March samples were measured as well. Based on the variation of the monthly on-site measurements and the δ 18O/2H results 12 wells and springs were selected for further investigations. On these sites samples for 3H/3He, CFC-11/12/113, SF6 and sulphur-35 measurements were collected in August 2014. As expected from a humid alpine area, non of the selected springs or wells showed really long MRTs. Five out of 16 investigated sites are regarded as well suited to be used as emergency water source with a range of MRTs of 9 - 30 years. Five springs and wells are regarded of limited suitability due to the shorter MRTs of 5 - 9 years. In two springs the 3H/3He method could not be applied due to He-degassing in a karst-system and during sampling. CFC and SF6 excess at some sites with anthropogenic and geogenic sources hampered the utilisation of these gases as dating tool, but they were useful as source tracers. Sulphur-35 was detected in two wells only, indicating contribution of very young water (< 1 year). In both cases MRTs of 13 - 17 years, calculated

  4. Dating of young groundwater using four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301): methodology and first results.

    Science.gov (United States)

    Bartyzel, Jakub; Rozanski, Kazimierz

    2016-01-01

    A dedicated, GC-based analytical system is presented which allows detection of four anthropogenic trace gases (SF6, SF5CF3, CFC-12 and Halon-1301) in a single water sample, with detection limits and measurement uncertainties sufficiently low to employ them as quantitative indicators of groundwater age. The gases dissolved in water are extracted in the field using the method based on a dynamic head-space concept. In the laboratory, the investigated gases are cryogenically enriched, separated and measured using an electron capture detector. Reproducibility of the analyses is in the order of 2-5 %. The investigated tracers were measured in several production wells located in the recharge area of an intensively exploited aquifer in southern Poland. While the piston-flow ages of groundwater in the investigated wells revealed internal consistency, they appeared to be generally smaller than the ages derived from time series of tritium content in those wells, interpreted by lumped-parameter models. This difference stems mainly from significantly longer travel times of tritium through the unsaturated zone, when compared to the gaseous tracers being used. The results of this study highlight the benefits of using multiple tracing in quantifying timescales of groundwater flow in shallow aquifer systems. PMID:26863003

  5. Materials Compatibility and Lubricants Research on CFC-refrigerant substitutes. Quarterly MCLR Program technical progress report, July 1--September 30, 1995

    Energy Technology Data Exchange (ETDEWEB)

    Szymurski, S.R.; Hourahan, G.C.; Godwin, D.S.; Amrane, K.

    1995-10-01

    The Materials Compatibility and Lubricants Research (MCLR) program supports critical research to accelerate the introduction of CFC and HCFC refrigerant substitutes. The MCLR program addresses refrigerant and lubricant properties and materials compatibility. The primary elements of the work include data collection and dissemination, materials compatibility testing, and methods development. This report summarizes the research conducted during the third quarter of calendar year 1995 on the following projects: Thermophysical properties of HCFC alternatives; Compatibility of manufacturing process fluids with HFC refrigerants and ester lubricants; Compatibility of motor materials used in air-conditioning for retrofits with alternative refrigerants and lubricants; Compatibility of lubricant additives with HFC refrigerants and synthetic lubricants; Products of motor burnouts; Accelerated test methods for predicting the life of motor materials exposed to refrigerant-lubricant mixtures; Investigation of flushing and clean-out methods; Investigation into the fractionation of refrigerant blends; Lean flammability limits as a fundamental refrigerant property; Effect of selected contaminants in AC and R equipment; Study of foaming characteristics; Study of lubricant circulation in systems; Evaluation of HFC-245ca for commercial use in low pressure chillers; Infrared analysis of refrigerant mixtures; Refrigerant database; Refrigerant toxicity survey; Thermophysical properties of HFC-32, HFC-123, HCFC-124 and HFC-125; Thermophysical properties of HFC-143a and HFC-152a; Theoretical evaluations of R-22 alternative fluids; Chemical and thermal stability of refrigerant-lubricant mixtures with metals; Miscibility of lubricants with refrigerants; Viscosity, solubility and density measurements of refrigerant-lubricant mixtures; Electrohydrodynamic enhancement of pool and in-tube boiling of alternative refrigerants; Accelerated screening methods; and more.

  6. O perfil do contador e os níveis de habilidades cognitivas nos exames Enade e suficiência do CFC: uma análise sob a perspectiva da taxonomia de Bloom

    OpenAIRE

    Francisco Marton Gleuson Pinheiro; José Maria Dias Filho; Raimundo Nonato Lima Filho; Laerson Morais Silva Lopes

    2013-01-01

    This research identifies if the levels of cognitive skills demanded by ENADE and sufficiency exam of the CFC are adherent to the accountant profile required by the National Education Council (CNE) from the perspective of Bloom’s Taxonomy. We analyzed two editions of ENADE and the last two editions of the sufficiency exams as well as the Accountants professional profile required of by Resolution CNE/CES 10/2004. The exam questions and professional profile required by the CNE were classified in...

  7. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC) evidence

    Science.gov (United States)

    Stewart, M. K.; Thomas, J. T.

    2008-01-01

    The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA) underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%), with smaller contributions from the Upper Takaka River (18%) and valley rainfall (8%), while Fish Creek Spring contains mostly Upper Takaka River water (50%). In addition, much of the Upper Takaka River contribution to the aquifer (58%) bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 yr, and CFC-11 measurements, give a mean residence time of 8 yr for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 yr and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water with mean age 1.2 yr and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusion below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs and allows much of the

  8. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2007-05-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 years, and CFC-11 measurements, give a mean residence time of 8 years for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 years and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water, with mean age 1.2 years and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusive below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs

  9. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC evidence

    Directory of Open Access Journals (Sweden)

    J. T. Thomas

    2008-01-01

    Full Text Available The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the karst uplands (74%, with smaller contributions from the Upper Takaka River (18% and valley rainfall (8%, while Fish Creek Spring contains mostly Upper Takaka River water (50%. In addition, much of the Upper Takaka River contribution to the aquifer (58% bypasses the springs and is discharged offshore via submarine springs. The chemical concentrations of the Main Spring show input of 0.5% of sea water on average, which varies with flow and derives from the deep aquifer. Tritium measurements spanning 40 yr, and CFC-11 measurements, give a mean residence time of 8 yr for the Main Spring water using the preferred two-component model. Our conceptual flow model, based on the flow, chloride, oxygen-18 and age measurements, invokes two different flow systems with different recharge sources to explain the flow within the AMA. One system contains deeply penetrating old water with mean age 10.2 yr and water volume 3 km3, recharged from the karst uplands. The other, at shallow levels below the valley floor, has much younger water with mean age 1.2 yr and water volume 0.4 km3, recharged by Upper Takaka River and valley rainfall. The flow systems contribute in different proportions to the Main Spring, Fish Creek Springs and offshore springs. Their very different behaviours, despite being in the same aquifer, are attributed to the presence of a diorite intrusion below the surface of the lower valley, which diverts the deep flow towards the Waikoropupu Springs and allows

  10. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2010-11-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments (e.g., enhancements of 13 pptv and 11 pptv for CFC-11 and CFC-12, respectively. Emissions estimates of HFC-152a (0.98±0.05 Gg and HFC-134a (1.40±0.11 Gg in LA County for 2008 were obtained using the observed HFC:CO enhancement ratio. The emission rates were extrapolated to the SoCAB (1.48±0.07 Gg for HFC-152a and 2.12±0.17 Gg for HFC-134a and US (30.1±1.5 Gg for HFC-152a and 43.0±3.4 Gg for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB also were calculated by a second method that utilizes air quality modeling. Estimates obtained using both methods agree well.

  11. O perfil do contador e os níveis de habilidades cognitivas nos exames Enade e suficiência do CFC: uma análise sob a perspectiva da taxonomia de Bloom

    Directory of Open Access Journals (Sweden)

    Francisco Marton Gleuson Pinheiro

    2013-11-01

    Full Text Available This research identifies if the levels of cognitive skills demanded by ENADE and sufficiency exam of the CFC are adherent to the accountant profile required by the National Education Council (CNE from the perspective of Bloom’s Taxonomy. We analyzed two editions of ENADE and the last two editions of the sufficiency exams as well as the Accountants professional profile required of by Resolution CNE/CES 10/2004. The exam questions and professional profile required by the CNE were classified into two levels of cognitive skills in Bloom’s Taxonomy: the first, considering a lower cognitive level; and the second, considering a higher level. The significance test for proportions indicated that levels of cognitive skills required by ENADE and the proficiency exams are not adherent to the accountant profile provided by the CNE. Regarding the frequency of issues, it was not charged higher cognitive level, although in 2009 the ENADE has not presented significant difference between issues.

  12. MANUAL FOR NON-CFC AEROSOL PACKAGING: CONVERSION FROM CFC TO HYDROCARBON PROPELLANTS

    Science.gov (United States)

    The report provides technical assistance to aerosol product marketers and fillers in other nations now faced with eliminating chlorofluorocarbons (CFCs) under the terms of the Montreal Protocol. t addresses the issues of hydrocarbon propellant supply, product reformulation, equip...

  13. Dicty_cDB: CFC748 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AETNKKLERLLISLNLLGGLIGGTNGPPIAASINTQNEPDNRQNAPIAQNFQQYQQNQPI PNQNQISNQNQISNQNQNQNQNQNQ--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxixkxxxkxxxxx...xxiignxxixvxxxkkxv xxhwxfxxxwkxxxmkxikrnlmnlxqf*mrfqifqf...ikikfqikikfqikikikikiki--- ---xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxnxxxl*gxxxxxxnxxkxxf xcigxsxxigkxxx

  14. Dicty_cDB: CFC757 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qaqahhqaaqahqaahhhhhqaaqvhhlqalhqaqvaqalh qaqaaqalh--- ---*ssssssssssssxxxx*sssxxx**sssxxxx***xxxrxxx...rxxsxxxx*xxxxx ssssxrxxxsss*xssxxrxxxcssxxxxxxcxxxxxsxxxxxxxxxxxxxxxxsxxxxs xxxx*xxxxxxxxxxsxxxxxxxxxxxxxxxxxxxx...ssxxxxxsxxxsssssssssssss sssssssssssssssssssssssssssssssssssssssssssssssssssssssssss...SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSS--- ---iiiiiiiiiiiixkxkxiiixxxmmiiixxxxxmmxxxkxxxkxxixkxxxxxxxx...i iiixkxxxiiimxxixxkkxxlfixxxxxxxxxxxxxxmxxxxlxxxxxlxxxxlxxxlx xxxxxxqxxxxlxxxqxxxxlxxxlxxxxxxxxxllxxxxllxxxxx

  15. Dicty_cDB: CFC685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne*rkr*ti*rfrincl*kfyiks sygsiritfyk*icrrlsrfkilwwyrsc**irnslskesiesipfg*e*mgc*cstiqw *ssqfrslhsiikttrsyngfrftir...KKKISASSIFFESMPYQIGADGLI DYQRLEENA--- ---lfnv*ygslqwfsscsiigftirll*cchqyhs*nlkrttfrnhll*kr*ksrw*w* rn*rvrh*i

  16. Dicty_cDB: CFC256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nificant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions... for synthesis of longfatty acids in plants. 1306 0.0 1 BD082645 |BD082645.1 Methods and compositions for sy...nthesis of long chain polyunsaturated fatty acids. 1306 0.0 1 BD082630 |BD082630.1 Methods and compositions

  17. Dicty_cDB: CFC343 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available for suppressing growth of plasmodium. 58 1e-18 6 BD183625 |BD183625.1 Material for diagnosing malaria and im...mune antigen for suppressing growth of plasmodium. 58 1e-18 6 U00152 |U00152.1 Plasmodium falciparum enolase

  18. Dicty_cDB: CFC796 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 58 9e-07 2 CF806266 |CF806266.1 psHB007xC07f USDA-IFAFS:Expression of Phytophthora sojae genes during infection and propaga...tion Phytophthora sojae cDNA clone sHB007C07 5, mRNA seq

  19. High-temperature brazing for reliable tungsten-CFC joints

    International Nuclear Information System (INIS)

    The joining of tungsten and carbon-based materials is demanding due to the incompatibility of their chemical and thermophysical properties. Direct joining is unfeasible by the reason of brittle tungsten carbide formation. High-temperature brazing has been investigated in order to find a suitable brazing filler metal (BFM) which successfully acts as an intermediary between the incompatible properties of the base materials. So far only low Cr-alloyed Cu-based BFMs provide the preferential combination of good wetting action on both materials, tolerable interface reactions, and a precipitation free braze joint. Attempts to implement a higher melting metal (e.g. Pd, Ti, Zr) as a BFM have failed up to now, because the formation of brittle precipitations and pores in the seam were inevitable. But the wide metallurgical complexity of this issue is regarded to offer further joining potential

  20. EXPERIMENTAL INVESTIGATION OF PIC FORMATION DURING CFC INCINERATION

    Science.gov (United States)

    The report gives results of experiments to assess: (1) the effect of residual copper retained in an incineration facility on polychlorinated dibenzo-p-dioxin and dibenzofuran (PCDD/PCDF) formation during incineration of non-copper-containing chlorofluorocarbons (CFCs); and (2) th...

  1. Modeling the CFC phasedown and replacement phase-in schedules

    International Nuclear Information System (INIS)

    While the elimination of CFCs is a timely and global initiative, there are many factors that will impact the time schedule for both eliminating the use of CFCs, and the commercial availability and successful use of the replacements. Obstacles to the transition vary by region, company, specific application, as well as choice of substitutes and their performance. This paper addresses how these issues will be handled in the development of a computer model aimed at gauging the implications of this transition on this and related chemical businesses (i.e., chlorocarbons, HCI, HF, EDC/VCM, and the chlor-alkali industry)

  2. Strength and fatigue measurements for CfC materials

    International Nuclear Information System (INIS)

    CfC-materials are considered as candidate materials for the divertors of fusion reactors as well as for protecting tiles of the first wall. As a consequence of cyclic thermal loading the mechanical failure modes will be spontaneous failure due to exceeding of the limit of strength and failure caused by cyclic fatigue. These two failure modes are of main interest to the experimental investigations on CfC-materials. The mechanical behaviour of several CfC-materials was studied applying different types of testing: strength measurements, determination of fatigue and recording of crack-resistance curves. (orig.)

  3. Dicty_cDB: CFC101 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qlkkvkikfvksicnkn**fkkkkpkk--- Homology vs CSM-cDNA Score E Sequences producing si...-42 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant...iksl*yfvhiqikyqyn*kklklnl*nqfvtktsnlkkknxkk--- Frame B: LNHCSILFIFKLNINTIKKS*n*ickinl*qklvi*kkktxkk--- Frame C: *iivvfcsysn*isi...ana DNA chromosome 4, contig fragment No. 72. 40 0.033 5 BX322575 |BX322575.3 Zebrafish DNA sequence *** SEQ...quence 1 from Patent WO0151627. 38 0.049 4 AC148398 |AC148398.3 Medicago truncatula clone mth2-24c23, WORKIN

  4. Refrigeration CFC's recovery, reuse, alternatives and new legislation

    International Nuclear Information System (INIS)

    The industrialized nations of the world met in 1986 in Vienna, Austria, to discuss curbs on the production of chlorofluorocarbons (CFCs). Scientists had determined that these compounds, typically used as refrigerants, were accumulating in the upper layers of the earth's atmosphere. The chlorine atoms in the compounds were catalytically converting ozone in the stratosphere to oxygen, effectively reducing ozone levels. Ozone in the stratosphere serves as a protective shield, reflecting ultraviolet radiation (UV) from the sun from striking the earth's surface. The loss of this protective shield would result in increased UV radiation levels. Plant growth on land and plankton production in the seas would be stunted, altering the food chain. Severe climatic changes would also result. At the initial meeting in Vienna, and at a subsequent meeting in Montreal, the industrialized nations agreed to limit the production of CFCs based on 1986 worldwide production levels. This paper examines alternatives to the use of CFCs, their recovery and reuse, and new legislation governing their use

  5. Dicty_cDB: CFC703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *xxx*xsss sxrxx*xss*xxx**xrxxxxxxxxxxxcxxxxxsxxxxxcxxxxxxxxxxxxxxxxxxs xxxxxxxxxxxxsxxxxxxxxsxxxxxxxsxxxxsxx...xxxsxsxssssssssssssssss ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss sssrektnlkxii Frame B:

  6. Dicty_cDB: CFC438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TEINASE. Sitophilus zeamais (maize weevil), mRNA sequence. 50 2e-06 3 dna update 20...d_04H08_TEXF1 Psoroptes ovis mixed Psoroptes ovis cDNA clone Po_ad_04H08 5' similar to O46030 CYSTEINE PRO

  7. Dicty_cDB: CFC580 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lifagxqledgrtlsd yniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegippdqqr lif...agkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienv kakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltg ktitle...ledgrtlsd yniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegippdqqr lifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle...vegsdnienv kakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltg ktitlevegsdnienvktkiqdk

  8. Dicty_cDB: CFC240 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available niekcktkdsr*rryxtrsxtfhfagxql edgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnien...vktkiqdke gippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitleve gsdnienvkakiqdkegippdqqrlifagkqledgrt...lsdyniqkestlhlvlrlrggmq ifvktltgktitlevegsdnienvktkiqdk* Translated Amino Acid sequence (All Frames) Frame A...: ifsnsfllyky*ihilffyil*hfikkkkkknlknxlfxkkk--- ---lxlxlxggmqxx*ktxpgktitlevkvvxt...qkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdke gippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle

  9. Dicty_cDB: CFC877 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sysll itiskkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegippdqq rlifagkqledgrt...lsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnien vkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktlt gktitle...skkestlhlvlrlrggmqifvktltgktitlevegsdnienvktkiqdkegippdqq rlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle...vegsdnien vkakiqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktlt gktitlevegsdnienvktkiqdkegip Frame B...vvttlrm*kqkfktkkvsh Frame C: ihfyytnikfifyffiycniskkkkkkki*kxxflxkk--- ---fx*xpxxgktitleveg*cqp*ecktkxxr*rxv

  10. Dicty_cDB: CFC518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxdnkkxvetxrcvsithvlhy*lnn Translated Amino Acid sequ...ence (All Frames) Frame A: ---ervkfknt*istmvxvfnxsp*slitslxlsqn*dlvvslssxfqkhtihhsxrnyn xlh*klkxxwtl*rnytf*x...YTSLRXKLQX SSLEIKEXLDTLEKLHILXDYDDXGYLXQIFTX*c*r*aalfslxlskettxmvsvlvxl npslkqsxd

  11. Dicty_cDB: CFC332 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 |pid:none) Xenopus laevis hypothetical protei... 43 0.011 BT075193_1( BT075193 |pid:none) Osmer...otein update 2009. 5.12 PSORT psg: 0.83 gvh: 0.33 alm: 0.39 top: 0.53 tms: 0.00 mit: 0.28 mip: 0.00 nuc: 0.00 erl: 0.00 er... C: ffkhtnt*iifiylsthpkysy*wqk*qyqlkmkisfk*iynqikqlki*nve*nlkpqf **tikf*hlme...V Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Val...ne ISB-362P17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 46 5e-05 2 AC119130 |AC119130.3 Rattus norvegicus

  12. Raman study of CFC tiles extracted from the toroidal pump limiter of Tore Supra

    OpenAIRE

    Pardanaud, C.; Giacometti, G.; Martin, C; Ruffe, R.; Angot, T.; Areou, E.; Pegourie, B.; Tsitrone, E.; Dittmar, T.; Hopf, C.; Jacob, W.; Schwarz-Selinger, T.; Roubin, P.

    2011-01-01

    The structure of six tiles extracted from the erosion and deposition zones (thin and thick deposition) of the Tore Supra toroidal pump limiter (TPL) have been analysed in the framework of the DITS campaign using micro-Raman spectroscopy. This post-mortem analysis gives information on both carbon structure and D content. We have found that the carbon structure is most often similar to that of plasma-deposited hard amorphous carbon layers. The role of the surface temperature during the discharg...

  13. Replacement of CFCs in thermodynamical systems; Remplacement des CFC dans les systemes thermodynamiques

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Some chlorofluorocarbons (CFCs) are well-adapted to coldness production by vapour compression and thus are widely used in the storage of agriculture-food products from the production to the domestic consumer but also in air-conditioning systems and heat pumps. Atmospheric impacts of the use of CFCs (`ozone hole`) led the international community to adopt remedial measures which aim to prohibit the production of CFCs. These constraints led the users of refrigerating fluids to use substitution fluids and to develop new techniques of energy recovery and heat/coldness production. This workshop takes stock of this situation and of the problems encountered by the various actors involved in the replacement of CFCs in thermodynamical systems: evolutions of regulation, point of view of refrigerating fluid producers and of compressors and heat exchangers manufacturers, research studies on substitution fluids, recovery of CFCs and other refrigerating fluids, revival in the use of natural fluids (like ammonia), and use of new thermodynamical systems like compression/absorption (water/ammonia) cycles. (J.S.)

  14. Evaporation and vapor shielding of CFC targets exposed to plasma heat fluxes relevant to ITER ELMs

    International Nuclear Information System (INIS)

    Carbon fibre composite NB31 was tested at plasma gun facility MK-200UG by plasma heat fluxes relevant to Edge Localised Modes in ITER. The paper reports the results obtained on the evaporation threshold of carbon fibre composite, the velocity of carbon vapor motion along and across the magnetic field lines, and the parameters of carbon plasma such as temperature, density and ionization state. First experimental results on investigation of the vapor shield onset conditions are presented also. The obtained experimental data are compared with the results of numerical modeling.

  15. IDENTIFICATION OF CFC AND HCFC SUBSTITUTES FOR BLOWING POLYURETHANE FOAM INSULATION PRODUCTS

    Science.gov (United States)

    The report gives results of a cooperative effort to identiry chlorofluorocarbons and hydrochlorofluorocarbon substitutes for blowing polyurethane foam insulation products. The substantial ongoing effort is identifying third-generation blowing agets for polyurethane foams to repla...

  16. Mechanism study of c.f.c Fe-Ni-Cr alloy corrosion in supercritical water

    International Nuclear Information System (INIS)

    Supercritical water can be use as a high pressure coolant in order to improve the thermodynamic efficiency of power plants. For nuclear concept, lifetime is an important safety parameter for materials. Thus materials selection criteria concern high temperature yield stress, creep resistance, resistance to irradiation embrittlement and also to both uniform corrosion and stress corrosion cracking.This study aims for supplying a new insight on uniform corrosion mechanism of Fe-Ni-Cr f.c.c. alloys in deaerated supercritical water at 600 C and 25 MPa. Corrosion tests were performed on 316L and 690 alloys as sample autoclaves taking into account the effect of surface finishes. Morphologies, compositions and crystallographic structure of the oxides were determined using FEG scanning electron microscopy, glow discharge spectroscopy and X-ray diffraction. If supercritical water is expected to have a gas-like behaviour in the test conditions, the results show a significant dissolution of the alloy species. Thus the corrosion in supercritical water can be considered similar to corrosion in under-critical water assuming the higher temperature and its effect on the solid state diffusion. For alloy 690, the protective oxide layer formed on polished surface consists of a chromia film topped with an iron and nickel mixed chromite or spinel. The double oxide layer formed on 316L steel seems less protective with an outer porous layer of magnetite and an inhomogeneous Cr-rich inner layer. For each alloy, the study of the inner protective scale growth mechanisms by marker or tracer experiments reveals that diffusion in the oxide scale is governed by an anionic process. However, surface finishes impact deeply the growth mechanisms. Comparisons between the results for the steel suggest that there is a competition between the oxidation of iron and chromium in supercritical water. Sufficient available chromium is required in order to form a thin oxide layer. Highly deformed or ultra fine microstructure surfaces lead to thin chromium rich oxide layers thanks to either diffusion short circuiting or increasing Cr oxide nucleation site. The nature of the surface is a determining factor in the steel instance. The same parameter breeds different effects for the Ni-based alloy. Machined surfaces lead to internal oxidation on alloy 690 even if a thin Cr and Mn rich oxide scale is formed. Competitive diffusion of oxygen and Cr species through the diffusion short circuit paths of the alloy is suggested. This work proposes oxide growth mechanisms for each case. Finally the conditions leading to the formation of chromium-rich protective oxide films in supercritical water are discussed. (author)

  17. Moving Advanced Desiccant Materials into Mainstream Non-CFC Cooling Products

    Energy Technology Data Exchange (ETDEWEB)

    Sand, J. R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Grossman, T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rice, C. K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Fairchild, P. D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gross, I. L. [Engelhard/ICC, Hatboro, PA (United States). Fresh Air Solutions

    2004-12-30

    Desiccant dehumidification technology is emerging as a technically viable alternative for comfort conditioning in many commercial and institutional buildings. Attempts to improve the indoor air quality of buildings has resulted in increasingly stringent guidelines for occupant outdoor air ventilation rates. Additionally, revised building heating, ventilating, and air-conditioning (HVAC) design criteria based on regional peak dew point data highlight the important of the latent (moisture removal) building load relative to the sensible (temperature) building load.

  18. Energy and global warming impacts of CFC alternative technologies for foam building insulations

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCS) have been used as blowing agents in foam insulation, as the working fluids in cooling and refrigeration equipment, and as solvents in general and precision cleaning applications since their introduction in the 1930s. The number of applications and volumes of CFCs used grew at a tremendous pace during the 1960s and 1970s, but in the mid-1980s it was confirmed that these extremely useful chemicals contribute to the destruction of stratospheric zone and that they are the primary cause of the CFCs have also been found to be second only to carbon dioxide as a factor causing increased greenhouse warming. These chemicals are being phased out of use rapidly to protect the ozone layer and it is very important that the replacements for CFCs do not result in a net increase in global warming by introducing less efficient processes that lead to higher energy use and increased carbon dioxide emissions. A study was conducted to identify those alternative chemicals and technologies that could replace CFCs in energy related applications before the year 2000, and to assess the total potential impact of those alternatives on global warming. The analysis for this project included an estimate of the direct effects from the release of blowing agents, refrigerants, and solvents into the atmosphere and the indirect effects of carbon dioxide emissions resulting from energy use for commercial and residential building insulation, household and commercial refrigeration, building and automobile air conditioning, and general metal and electronics solvent cleaning. This paper focuses on those aspects of the study relevant to building insulation. In general the hydrofluorocarbon (HFC) and hydrochlorofluorocarbon alternatives for CFCs lead to large and sometimes dramatic reductions in total equivalent warming impact, lifetime equivalent C02 emissions (TEWI). Most of the reductions result from decreased direct effects without significant changes in energy use

  19. Potential CFC replacements: Tropospheric lifetimes of C 3 hydrofluorocarbons and hydrofluoroethers

    Science.gov (United States)

    Cooper, David L.; Cunningham, Terry P.; Allan, Neil L.; McCulloch, Archie

    Attack by tropospheric hydroxyl radicals results in much shorter residence times for hydrofluorocarbons (HFCs) than for the fully halogenated chlorofluorocarbons (CFCs). Empirical structure-activity relations, previously calibrated for HFCs containing two carbon atoms, are used with semi-empirical and ab initio calculations to provide realistic first estimates of tropospheric lifetimes of various chlorine-free HFCs and hydrofluoroethers (HFEs) containing three carbon atoms. The heavily fluorinated HFEs are of particular interest in that they are likely to possess thermophysical properties which are suited to a range of applications for which CFCs are currently employed. Many of the HFEs are predicted to have shorter lifetimes than HFC-134a (CF 3CH 2F), which is already in large-scale commercial production as an alternative refrigerant. Factors are identified which appear to favour short lifetimes for HFEs.

  20. Hydrocarbons as CFC substitutes; Ersatz von FCKW-Kaeltemitteln durch Kohlenwasserstoffe

    Energy Technology Data Exchange (ETDEWEB)

    Doehlinger, M.

    1996-12-31

    When CFCs are to be replaced as refrigerants in heat pumps and air conditioning systems, producers tend to use fluorocarbons in spite of their well-known contribution to global heating. Hydrocarbons like propane and butane are a feasible alternative. The problem of inflammability can be solved by careful handling. (orig.) [Deutsch] Beim Ersatz von FCKW-Kaeltemitteln fuer Waermepumpen und Kaeltemaschinen in der Klimatechnik greift man haeufig auf FKW zurueck, obwohl diese Stoffe den Treibhauseffekt foerdern. Kohlenwasserstoffe wie die Fluessiggase Propan und Butan koennen ebenso als Kaeltemittel verwendet werden. Ihre Brennbarkeit spielt bei sachgemaessem Umgang keine Rolle. (orig.)

  1. Behavior of stress singularities near the free edge of CFC/TZM bond interface under transient high heat flux loading

    International Nuclear Information System (INIS)

    A duplex divertor component composed of dissimilar materials experiences considerable thermal stresses under fusion operation conditions, due to the mismatch of the thermal expansion. The stress states near the free edge of the bond interface are very critical because stress intensification occurs and sometimes stress singularities exist. The fracture mechanical approach can be applied to characterize the behavior of these singular stress fields. A semi-analytical procedure is employed to describe the stress singularity in terms of the stress intensity factor. Since some of critical fusion operating situations are coupled with the transient thermal flow, it is important to assess the design requirements for transient thermal loads. The applicability of the current approach to a non-harmonic temperature field generated by a transient thermal load is discussed. The stress intensity factors are calculated for various transient high heat flux loads. The effect of the temperature gradient at the interface on the stress singularity and on the interfacial stress is investigated quantitatively. (orig.)

  2. Fluticasone Propionate, 100 µg bid, Using a Non-CFC Propellant, HFA 134a, in Asthmatic Children

    Directory of Open Access Journals (Sweden)

    Brian Lyttle

    2003-01-01

    Full Text Available BACKGROUND: Secondary to phasing out chlorofluorocarbons (CFCs, the fluticasone propionate (FP pressurized metered-dose inhaler has been formulated in a nonozone-depleting propellant, hydrofluoralkane (HFA 134a.

  3. Catalytic Decomposition of CFC-12 over Heteropolyacids%杂多酸催化分解氟里昂-12

    Institute of Scientific and Technical Information of China (English)

    马臻; 华伟明; 唐颐; 高滋

    2000-01-01

    @@ Chlorine atoms from chlorofluorocarbons (CFCs) deplete stratospheric ozone and CFCs are green-house gases too. Owing to these environmental problems, many kinds of CFCs have been banned since the Montreal Protocol and two kinds of cleaning techniques have been developed. One is the synthesis of CFCs alternatives[1,2] and the other is the decomposition of banned CFCs in existing equipments[3,4].

  4. Heat flux distribution and gyro-radius smoothing effect on misaligned CFC tile in the Tore Supra tokamak

    Czech Academy of Sciences Publication Activity Database

    Corre, Y.; Dejarnac, Renaud; Gardarein, J.-L.; Gaspar, J.; Escourbiac, F.; Gauthier, E.; Gunn, J.; Komm, Michael; Lipa, M.; Loarer, T.; Missirlian, M.; Rigollet, F.

    Toki City: National Institute for Fusion Science, 2014. P3-086-P3-086. [International Conference on Plasma Surface Interactions 2014/21./. 26.05.2014-30.05.2014, Kanazawa] Institutional support: RVO:61389021 Keywords : Heat loads * IR thermography * misalignment * limiter Subject RIV: BL - Plasma and Gas Discharge Physics http://psi2014.nifs.ac.jp/Files/Files/Abstracts/P3-086_Corre_PSI2014.pdf

  5. Heat flux distribution and gyro-radius smoothing effect on misaligned CFC tile in the Tore Supra tokamak

    Czech Academy of Sciences Publication Activity Database

    Corre, Y.; Dejarnac, Renaud; Gardarein, J.-L.; Gaspar, J.; Escourbiac, F.; Gauthier, E.; Gunn, J. P.; Komm, Michael; Lipa, M.; Loarer, T.; Missirlian, M.; Rigollet, F.

    2015-01-01

    Roč. 463, August (2015), s. 832-836. ISSN 0022-3115. [PLASMA-SURFACE INTERACTIONS 21: International Conference on Plasma-Surface Interactions in Controlled Fusion Devices. Kanazawa, 26.05.2014-30.05.2014] Institutional support: RVO:61389021 Keywords : Heat loads * IR thermography * misalignment * limiter Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.865, year: 2014 http://www.sciencedirect.com/science/article/pii/S002231151400720X

  6. ANÁLISE EXPERIMENTAL DO HIDROCARBONETO R290 PARA A SUBSTITUIÇÃO DO CFC12 EM REFRIGERADOR DOMÉSTICO

    Directory of Open Access Journals (Sweden)

    Jucelino Gomes da Silva

    2011-03-01

    Full Text Available Recentemente, muita atenção tem sido dada aos chamados fluidos naturais, que são menos agressivos ao meio ambiente e também apresentam grande importância na necessidade latente do aumento da eficiência energética dos equipamentos em comparação aos fluidos sintéticos. O presente trabalho trata de uma análise experimental do hidrocarboneto propano (R290 como fluido refrigerante em um bebedouro de água potável projetado para operar com R12 numa estratégia de drop-in. O bebedouro foi preparado através da instalação de um manômetro na linha de alta pressão e um na linha de baixa pressão, termopares em cinco pontos estratégicos do ciclo termodinâmico: sucção do compressor, descarga do compressor, saída do condensador, entrada do evaporador e saída do evaporador, além da medição da temperatura da água e do ambiente. O ensaio de abaixamento de temperatura foi realizado durante 90 minutos sem atuação do termostato. A carga do hidrocarboneto propano (R290 aplicado ao equipamento foi reduzida em 61,5% com relação ao R12. Foram monitorados os dados de pressões de sucção e descarga do compressor, corrente elétrica consumida pelo compressor e temperaturas nos pontos do ciclo de refrigeração. Os parâmetros obtidos do ensaio foram comparados através do uso do software Coolpack, onde os diagramas pressão-entalpia (P-h para os fluidos foram obtidos e as características operacionais de trabalho de compressão, efeito refrigerante, efeito de condensação e coeficiente de performance (COP foram estudadas. Os resultados obtidos demonstraram um consumo de corrente elétrica 30% inferior em relação à operação com R12, porém, com muitas oscilações durante o tempo. As pressões para o R290 se apresentaram maiores em comparação com o R12. A razão de pressões do R290 foi 28% menor que para o R12. Após 16 minutos de funcionamento ocorreu a formação de gelo na serpentina do evaporador. O COP obtido para o R290 foi de 2,60, enquanto que para o R12 foi de 2,43. A utilização do hidrocarboneto se mostrou eficiente para o equipamento de pequeno porte. Sendo compatível com o óleo do compressor e não necessitando de substituição de nenhum componente do sistema além de permitir a redução da quantidade de fluido refrigerante do sistema. PALAVRAS-CHAVE: eficiência energética, propano, refrigerador doméstico; drop-in.

  7. 40 CFR Appendix E to Subpart B of... - The Standard for Automotive Refrigerant Recycling Equipment Intended for Use With Both CFC-12 and...

    Science.gov (United States)

    2010-07-01

    ... cannot exceed 80% of volume at 21.1 °C of its maximum rating as defined by DOT standards, 49 CFR 173.304... sample of 30 to 130 g is vaporized directly into the Karl Fischer anolyte. A coulometer titration...

  8. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC) evidence

    OpenAIRE

    Stewart, M. K.; Thomas, J T

    2008-01-01

    The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA) underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourc...

  9. Residence time distribution in a large unconfined-semiconfined aquifer in the Argentine Pampas using 3H/3He and CFC tracers

    Science.gov (United States)

    Martínez, D. E.; Fourré, E.; Londoño, O. M. Quiroz; Jean-Baptiste, P.; Galli, M. Glok; Dapoigny, A.; Grondona, S. I.

    2016-02-01

    The Pampa region in Argentina includes vast unconfined-semiconfined aquifers that local economies depend upon, but detailed knowledge of the associated water resources is still lacking. The Pampeano aquifer in the Pampa plain of Argentina covers around 1.5 million km2. In order to achieve a better understanding of the hydrogeological system through the estimation of mean residence times (MRT), water samples were taken from 12 monitoring wells, drilled at different depths in four locations, and analyzed for environmental tracers. The concentrations of 3H, tritiogenic 3He and chlorofluorocarbons (CFCs) can be explained by mixtures of young waters adjusted to exponential piston flow models (EPM) or dispersion models (DM), and different proportions of tracer-free waters (dead water). The sampling site located very close to the water divide shows a dominance of young waters: 85 % of water best represented by a DM model with a MRT of 3 years. For the shallow wells at other sites, best-fitting models result in a DM with MRT between 20 and 35 years, and proportions of dead water between 40 and 60 %. These results lead to important updates in the conceptual model of the Pampeano aquifer. Large proportions of dead water at a few meters depth can be the consequence of upward flows in a multilayered aquifer or diffusive retardation in the inter-bedded clay layers.

  10. Experimental SF6/-//SF6 and Cl/-//CFC13 electron-attachment cross sections in the energy range 0-200 meV

    Science.gov (United States)

    Chutjian, A.

    1981-01-01

    Experimental cross sections for the electron-attachment processes for SF6(-)/SF6 and Cl(-)/CFl3 are reported in the energy range 0-200 meV by normalizing each attachment line shape to measurement of a thermal rate coefficient. When the same ion states are detected, good agreement is found between present values, for which a monoenergetic electron source is used, and swarm-unfolded results. The present data constitute a new limit for cross sections reported at high resolution at the lowest electron energy.

  11. Toxicology evaluation and hazard review for non-CFC containing rigid foams BKC 44317 and last-a-foam MSL-02A

    Energy Technology Data Exchange (ETDEWEB)

    Greulich, K.A.; Archuleta, M.M.

    1996-06-01

    New pour-in-place, low density, rigid polyurethane foam kits have been developed to mechanically stabilize damaged explosive ordnance. Although earlier foam systems used chlorofluorocarbons as blowing agents, the current versions rely on carbon dioxide generated by the reaction of isocynates with water. In addition, these kits were developed to manually generate small quantifies of rigid foam in the field with minimal or no protective equipment. The purpose of this study was to evaluate and summarize available hazard information for the components of these rigid foam kits and to provide recommendations for personal protective equipment to be used while performing the manual combination of the components. As with most rigid foam systems, these kits consist of two parts, one a mixture of isocyanates; the other, a combination of polyols, surfactants, and amine catalysts. Once completely deployed, the rigid foam is non-toxic. The components, however, have some important health effects which must be considered when establishing handling procedures.

  12. Residence time distribution in a large unconfined-semiconfined aquifer in the Argentine Pampas using 3H/3He and CFC tracers

    Science.gov (United States)

    Martínez, D. E.; Fourré, E.; Londoño, O. M. Quiroz; Jean-Baptiste, P.; Galli, M. Glok; Dapoigny, A.; Grondona, S. I.

    2016-08-01

    The Pampa region in Argentina includes vast unconfined-semiconfined aquifers that local economies depend upon, but detailed knowledge of the associated water resources is still lacking. The Pampeano aquifer in the Pampa plain of Argentina covers around 1.5 million km2. In order to achieve a better understanding of the hydrogeological system through the estimation of mean residence times (MRT), water samples were taken from 12 monitoring wells, drilled at different depths in four locations, and analyzed for environmental tracers. The concentrations of 3H, tritiogenic 3He and chlorofluorocarbons (CFCs) can be explained by mixtures of young waters adjusted to exponential piston flow models (EPM) or dispersion models (DM), and different proportions of tracer-free waters (dead water). The sampling site located very close to the water divide shows a dominance of young waters: 85 % of water best represented by a DM model with a MRT of 3 years. For the shallow wells at other sites, best-fitting models result in a DM with MRT between 20 and 35 years, and proportions of dead water between 40 and 60 %. These results lead to important updates in the conceptual model of the Pampeano aquifer. Large proportions of dead water at a few meters depth can be the consequence of upward flows in a multilayered aquifer or diffusive retardation in the inter-bedded clay layers.

  13. Transport and degradation of chlorofluorocarbons (CFCs) in the pyritic Rabis Creek aquifer, Denmark

    DEFF Research Database (Denmark)

    Hinsby, K.; Hojberg, A.L.; Engesgaard, P.;

    2007-01-01

    Vertical profiles of the chlorofluorocarbons CFC-11, CFC-12, and CFC-113 penetrating aerobic and anaerobic parts of a shallow sandy aquifer show that the CFC gases are degraded in the <1 m thick transition zone from aerobic to anaerobic groundwater in a pyritic sand aquifer at Rabis Creek, Denmark...

  14. Characteristics and treatment of temporal lobe epilepsy with a history of complicated febrile convulsion

    OpenAIRE

    Kanemoto, K.; Takuji, N.; Kawasaki, J.; Kawai, I.

    1998-01-01

    This study aimed to examine the close correlation between complicated febrile convulsions (CFC) and medial temporal lobe epilepsy and to delineate characteristics of temporal lobe epilepsy with CFC. Patients with temporal lobe epilepsy were divided into those with a prior episode of CFC (n=52), those with febrile convulsions other than CFC, and those witout either (n=345). Clinical constellations, neuroimaging, drug resistance, and effects of temporal lobectomy of the three gro...

  15. Tropospheric degradation mechanisms of chloroflourcarbons

    International Nuclear Information System (INIS)

    This report is prepared in connection to a contract with The Nordic Council of Ministers. After a short introduction the experimental procedure is described. The derived rate constants for reactions between the hydroxyl radical and CFC-11, CFC-12, CFC-22 and methylchloroform are discussed. Future work is suggested. (author)

  16. Nickel and cobalt electrodeposited on carbon fiber cloth as the anode of direct hydrogen peroxide fuel cell

    Science.gov (United States)

    Yang, Fan; Cheng, Kui; Xiao, Xue; Yin, Jinling; Wang, Guiling; Cao, Dianxue

    2014-01-01

    Carbon fiber cloth (CFC) supported Ni and Co electrodes are prepared by electrodeposition (Ni/CFC and Co/CFC). Their catalytic performance for H2O2 electrooxidation in KOH solution is investigated and compared with Au/CFC electrode. Ni/CFC electrode exhibits higher catalytic activity than Au/CFC and Co/CFC electrodes. The performance of a direct peroxide-peroxide fuel cell (DPPFC) with Ni/CFC anode and Pd/CFC cathode is examined. The cell shows a peak power density of 21.6 mW cm-2 at 20 °C and 53.8 mW cm-2 at 50 °C. The cell performance is improved with the increase of anolyte and catholyte flow rate and operation temperature. Results indicates that the performance of DPPFC with low-cost Ni/CFC anodes is comparable with those using precious metal anodes, e.g., Au/CFC and Pd/CFC.

  17. MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR

    Science.gov (United States)

    The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...

  18. Gastrointestinal and renal abnormalities in cardio-facio-cutaneous syndrome

    International Nuclear Information System (INIS)

    Cardio-facio-cutaneous syndrome (CFC) is an uncommon autosomal recessive condition recently distinguished from Noonan syndrome but with more marked growth failure and ectodermal dysplasia. Abdominal symptoms are frequently described but anatomic lesions in CFC have rarely been described. We have found significant anatomic abnormalities in CFC patients including antral foveolar hyperplasia, severe constipation with fecal impaction, nephrocalcinosis and renal cysts. (orig.)

  19. A purge-and-trap capillary column gas chromatographic method for the measurement of halocarbons in water and air

    Energy Technology Data Exchange (ETDEWEB)

    Happell, J.D.; Wallace, D.W.R.; Wills, K.D.; Wilke, R.J.; Neill, C.C.

    1996-06-01

    This report describes an automated, accurate, precise and sensitive capillary column purge- and -trap method capable of quantifying CFC-12, CFC-11, CFC-113, CH{sub 3}CCL{sub 3}, and CCL{sub 4} during a single chromatographic analysis in either water or gas phase samples.

  20. Dislocations and elementary processes of plasticity in FCC metals: atomic scale simulations; Dislocations et processus elementaires de la plasticite dans les metaux CFC: apports des simulations a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodney, D

    2000-07-01

    We present atomic-scale simulations of two elementary processes of FCC crystal plasticity. The first study consists in the simulation by molecular dynamics, in a nickel crystal, of the interactions between an edge dislocation and glissile interstitial loops of the type that form under irradiation in displacement cascades. The simulations show various atomic-scale interaction processes leading to the absorption and drag of the loops by the dislocation. These reactions certainly contribute to the formation of the 'clear bands' observed in deformed irradiated materials. The simulations also allow to study quantitatively the role of the glissile loops in irradiation hardening. In particular, dislocation unpinning stresses for certain pinning mechanisms are evaluated from the simulations. The second study consists first in the generalization in three dimensions of the quasi-continuum method (QCM), a multi-scale simulation method which couples atomistic techniques and the finite element method. In the QCM, regions close to dislocation cores are simulated at the atomic-scale while the rest of the crystal is simulated with a lower resolution by means of a discretization of the displacement fields using the finite element method. The QCM is then tested on the simulation of the formation and breaking of dislocation junctions in an aluminum crystal. Comparison of the simulations with an elastic model of dislocation junctions shows that the structure and strength of the junctions are dominated by elastic line tension effects, as is assumed in classical theories. (author)

  1. Tracer (18O, 3H, 3H/3He, CFC and SF6) and hydrochemistry to elucidate processes and mean residence times in porous aquifers in the South-East of Austria (Grazer and Leibnitzer Feld)

    Science.gov (United States)

    Kralik, M.; Humer, F.; Darling, G.; Sültenfuß, J.; Wyhlidal, S.

    2012-04-01

    The European Water Framework Directive requires the surface and groundwater bodies in the EU to be back to good quality conditions by 2015. To elucidate the mean residence time (MRT), the recharge area and the potential source of contaminations in particular monitoring wells a combination of several tracers has to be applied at least over one year to answer these questions with confidence. For the implementation of this goal it is necessary that any measures to improve groundwater quality show an impact depending on the MRT. The two groundwater bodies "Grazer Feld" and "Leibnitzer Feld" in the southern part of Styria, Austria stretch out along the river Mur in the N - S direction and covers an area of 166 and 103 km2. The porous aquifer of 10 - 20 m (Grazer Feld) of 6 - 10 m (Leibnitzer Feld) thickness consists of sandy gravel and boulders. In both groundwater bodies are about 2/3 of the aquifer is covered by loam of variable thickness. The depth to water varies between 2 - 20 and 2 - 8 m, respectively. The mean precipitation rate is 900 mm/a. The groundwater runs more or less along the river Mur with a small gradient. The northern part of the Grazer Feld groundwater body is dominated by the urban structure of the city of Graz. The southern part and the groundwater body Leibnitzer Feld is impacted intensively by agricultural use. Due to the extensive agricultural use it contains high concentrations of nitrate and pesticides and shows other hydrochemical changes caused by urbanisation and industrial use. In 33 monitoring wells delta oxygen-18 was analysed four times during one year within the framework of the Austrian hydrochemical groundwater monitoring system. During one campaign 3H, 3H/3He, CFCs and SF6 was analysed in all wells. In addition, the same methods were applied on depth-resolved groundwater samples at selected wells (Kralik et al. 2011). The results of the 3H-input and 3H/3He-models support in both groundwater bodies the rapid water circulation (Grath, J. (2011): Grundwasseralter ausgewählter Grundwasserkörper, 2009/2010: Grazer Becken, Jauntal, Leibnitzer Feld, Rheintal, Unteres Salzachtal, Wulkatal. 205 S., Ber. S259, Umweltbundesamt, Wien (http://www.lebensministerium.at/publikationen/ wasser/grundwasser.html).

  2. The GEF project of China energy saving and CFC free refrigerator established%GEF节能项目启动中国节能氟时昂替代电冰箱项目正式启动

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ 记者:我刊在今年的第一期曾有过关于中国节能电冰箱项目启动的报道,了解到该项目的总体情况,您是否能具体谈谈该项目的组织机构?项目将如何实施?

  3. Evaluation of Environment Impact of Trifluoroacetates from the Degradation of CFC Substitutes%氟里昂替代品降解产物TFA对生态环境的影响评价

    Institute of Scientific and Technical Information of China (English)

    万小春; 胡建信; 张剑波

    2001-01-01

    氟里昂替代品的降解产物三氟乙酸(TFA)可以在水体中稳定存在,无明显的光解和生物降解,TFA以致在一些水体中不断累积.预计到2010年大气中TFA的含量可达到5~20pg/m3,降水中其含量可达到100~160ng/L.累积到一定的浓度时,TFA对生态系统包括动植物的危害是明显的,可抑制植物生长,并对动物造成伤害.

  4. A conceptual model of flow to the Waikoropupu Springs, NW Nelson, New Zealand, based on hydrometric and tracer (18O, Cl,3H and CFC) evidence

    OpenAIRE

    Thomas, J T; Stewart, M. K.

    2007-01-01

    The Waikoropupu Springs, a large karst resurgence 4 km from the coast, are supplied by the Arthur Marble Aquifer (AMA) underlying the Takaka Valley, South Island, New Zealand. New evidence on the recharge sources in the catchment, combined with previous results, is used to establish a new recharge model for the AMA. Combined with the oxygen-18 mass balance, this yields a quantitative description of the inputs and outputs to the aquifer. It shows that the Main Spring is sourced mainly from the...

  5. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase over the South Coast Air Basin of California

    Directory of Open Access Journals (Sweden)

    B. Barletta

    2011-03-01

    Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  6. HFC-152a and HFC-134a emission estimates and characterization of CFCs, CFC replacements, and other halogenated solvents measured during the 2008 ARCTAS campaign (CARB phase) over the South Coast Air Basin of California

    Science.gov (United States)

    Barletta, B.; Nissenson, P.; Meinardi, S.; Dabdub, D.; Sherwood Rowland, F.; Vancuren, R. A.; Pederson, J.; Diskin, G. S.; Blake, D. R.

    2011-03-01

    This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB), which includes much of Los Angeles (LA) County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg) and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg) in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO) enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr-1 for HFC-152a and 2.12 ± 0.28 Gg yr-1 for HFC-134a) and then extrapolated to the United States (32 ± 4 Gg yr-1 for HFC-152a and 43 ± 6 Gg yr-1 for HFC-134a) using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.

  7. Pengetahuan, Sikap dan Tindakan Pemilik Bengkel AC Mobil Tentang Pemakaian CFC Sebagai Polutan Gas Rumah Kaca Pada Bengkel AC Mobil di Kelurahan Petisah Tengah Kecamatan Medan Petisah Tahun 2010.

    OpenAIRE

    Nasution, Gabriella Septiani

    2011-01-01

    Atmospheric temperature was determined by the levels of gases called green house gases that could cause the greenhouse effect causing global warming and ozone depletion. Chlorofluorocarbon (CFCs) was one type of greenhouse gases, one of which comes from automobile air conditioner servicing activities. This problem occurred since the use of air conditioner contained freon or refrigerant fake which is unsafe for environment and the occurrence of leaks in car air conditioning servicing process. ...

  8. Study of Dissolved Chlorofluorocarbons in Lake Washington

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Measurements of three chlorofluorocarbons (CFCs): trichlorofluoromethane (CFC-11), dichlorodifluoromethane (CFC-12) and trichlorotrifluoroethane (CFC 113), along with methyl chloroform (CH3CCl3) and carbon tetrachloride (CCl4) were made in water samples from Lake Washington, using Electron Capture Gas Chromatography (EC GC). The samples were collected in mid autumn, a period when the lake's upper layer undergoes rapid cooling. At the time of sampling, a strong vertical temperature gradient was present in the lake, with surface temperatures of ~14℃, and near bottom (50 meters) temperatures of ~8℃. The concentrations of dissolved CFC 12 and CFC 11 increased with depth, as expected from the higher solubilities of these gases at lower temperatures. Atmospheric measurements made at the sampling site at the time of the cruise, showed that CFC 11 and CFC 12 saturations in the near surface samples were 100 % and 106%, respectively. For the deepest sample (52 meters) CFC 11 and CFC 12 saturations were 102 % and 126 %. Because the surface layer of the lake responds to changes in atmospheric CFCs on a time scale of several weeks, the higher than equilibrium concentrations of CFC 12 observed at the time of sampling may reflect earlier episodes of elevated levels of atmospheric CFC 12 in this urban area. High concentrations of dissolved CFCs in runoff or industrial effluent might also lead to elevated CFC levels in the lake. The cold, deep water of Lake Washington is relatively isolated from the effects of surface gas exchange except during winter, and the supersaturations observe in the deep layer may reflect periods of elevated atmospheric CFC 12 levels from the previous winter season. These results were compared to summertime profiles of CFC 11 and CFC 12 made in 1994.

  9. X-ray micro-tomography studies on carbon based composite materials for porosity network characterization

    International Nuclear Information System (INIS)

    Quantitative characterization of the porosity structure of the carbon reinforced carbon fibre (CFC) materials is carried out by high resolution cone-beam X-ray micro-tomography (CBμCT). It is shown that CBμCT provides useful information pertaining to the in-depth fuel migration into carbon tiles function of the CFC material structure. The investigated materials comprised two types of non-irradiated CFC samples (former ITER reference CFC NB31 and JET CFC DMS780) and a series of CFC N11 samples in the frame of the Deuterium Inventory in Tore Supra (DITS) post-mortem analysis. A procedure for the quantitative evaluation of the CFC porosity factor has been introduced and tested. Useful information about the pores connectivity as well as the metal impregnation inside the CFC macroscopic pores, in case of heat sink region of the TS CFC, can be retrieved. The method can be used for the quality control monitoring of the new CFC ITER reference materials.

  10. Noaa chlorofluorocarbon tracer program air and seawater measurements: 1986-1989. Data file

    International Nuclear Information System (INIS)

    The NOAA Chlorofluorocarbon (CFC) Tracer Program at PMEL has been measuring the growing burden of these anthropogenic gases in the thermocline waters of the Pacific Ocean since 1980. The central goals of the NOAA CFC Tracer Program are to document the transient invasion of the CFC tracers into the Pacific Ocean, by means of repeat occupations of key hydrographic sections at 5-year intervals, and to interpret these changing distributions in terms of coupled ocean-atmosphere models. Studies are underway to use the CFC observations in model-validation studies, and to help develop predictive capabilities on the decade-to-century timescale. The report includes measurements of trichlorofluoromethane (CFC-11) and dichlorodifluoromethane (CFC-12) dissolved in seawater samples collected in the Pacific Ocean by the NOAA CFC Tracer Program on six cruises during the period of 1986-1989. Measurements of depth, pressure, salinity, temperature, and dissolved oxygen are included with the CFC data. Measurements of CFC-11 and CFC-12 in air samples collected along the cruise tracks are also included in the report. Data from the report are also available from the authors in digital format

  11. Repopulation of murine alveolar macrophage colony-forming cells after whole body irradiation

    International Nuclear Information System (INIS)

    A study was made of the repopulation of alveolar macrophage colony-forming cells (AL-CFC) after a supra lethal irradiation and bone marrow transplantation in mice. The repopulation of both CFU-S (hemopoietic stem cells) and the committed stem cells for both granulocytes and monocytes (GM-CFC) in the femoral bone marrow occurred within 2 weeks. In sharp contrast, the repopulation of AL-CFC in the lung was a very slow process. The number of AL-CFC, which are more resistant to irradiation than both CFU-S and GM-CFC, was reduced to 1% of control values one day after the irradiation and recovered slowly with time. It took almost nine weeks for the number of AL-CFC per mouse to reach normal levels. The number of recoverable alveolar cells in these mice never dropped below 70% of control values and reached the nadir about two weeks after the irradiation. (UK)

  12. Optimal Policies against Profit Shifting: The Role of Controlled-Foreign-Company Rules

    OpenAIRE

    Haufler, Andreas; Mardan, Mohammed; Schindler, Dirk

    2016-01-01

    By introducing controlled-foreign-company (CFC) rules, the parent country of a multinational firm reserves the right to tax the income of the firm's foreign affiliates if the tax rate in the affiliate's host country is below a specified threshold. We identify the conditions under which binding CFC rules are part of the optimal tax mix when governments can set the statutory tax rate, a thin capitalization rule and the CFC rule. We also analyze the effects of economic and financial integration ...

  13. Neuroleptic Drugs Revert the Contextual Fear Conditioning Deficit Presented by Spontaneously Hypertensive Rats: A Potential Animal Model of Emotional Context Processing in Schizophrenia?

    OpenAIRE

    Calzavara, Mariana Bendlin; Medrano, Wladimir Agostini; Levin, Raquel; Kameda, Sonia Regina; Andersen, Monica Levy; Tufik, Sergio; Silva, Regina Helena; Frussa-Filho, Roberto; Abílio, Vanessa Costhek

    2008-01-01

    Schizophrenia, bipolar disorder, and attention deficit/hyperactivity disorder (ADHD) present abnormalities in emotion processing. A previous study showed that the spontaneously hypertensive rats (SHR), a putative animal model of ADHD, present reduced contextual fear conditioning (CFC). The aim of the present study was to characterize the deficit in CFC presented by SHR. Adult male normotensive Wistar rats and SHR were submitted to the CFC task. Sensitivity of the animals to the shock and the ...

  14. Characteristics of the in vitro monocyte-macrophage colony-forming cells detected within mouse thymus and lymph nodes

    International Nuclear Information System (INIS)

    The enigmatic presence of in vitro colony-forming cells (CFC) within the thymus (T) and lymph node (LN) organs prompted us to determine additional characteristics of this cell population in an effort to examine their relationship to other colony-forming cells (CFC, CFU-c) derived from several hematopoietic sites. Their cluster-to-colony ratio, survival in the absence of colony-stimulating activity (CSA), radiosensitivity, drug sensitivity, and fraction in cell cycle were compared to the same parameters for CFU-c derived from bone marrow (BM), spleen (SPL), and peripheral blood leukocytes (PBL) and those CFC derived from thioglycollate-stimulated peritoneal exudate (PE). When compared with the parameters characteristic of CFU-c derived from BM, SPL, and PBL, the T-CFC and LN-CFC differed markedly in cluster-to-colony ratio, sensitivity to absence of pregnant mouse uterus extract (PMUE) in culture, and rate of appearance of colonies in culture. Similarities were observed in sensitivity to radiation (D0 value) and cytotoxic drugs as well as the fraction in cell cycle. In comparison with the CFC derived from the peritoneal exudate, two similarities were observed; namely, the marked survival in the absence of CSA in culture and the same fraction in cell cycle. However, T-CFC and LN-CFC were significantly lower in cluster-to-colony ratio and more sensitive to 60Co γ radiation than PE-CFC. Data are provided on the nature of a subpopulation of the ubiquitous monocyte-macrophage CFC located in the thymus and lymph nodes of the mouse. The results indicated that the CFC is a heterogenous population in several respects and support the implication that the tissue microenvironment may alter the phenotypic expression of the resident CFC population

  15. Long-lived halocarbon trends and budgets from atmospheric chemistry modelling constrained with measurements in polar firn

    Directory of Open Access Journals (Sweden)

    P. Martinerie

    2009-01-01

    Full Text Available The budgets of seven halogenated gases (CFC-11, CFC-12, CFC-113, CFC-114, CFC-115, CCl4 and SF6 are studied by comparing measurements in polar firn air from two Arctic and three Antarctic sites, and simulation results of two numerical models: a 2-D atmospheric chemistry model and a 1-D firn diffusion model. The first one is used to calculate atmospheric concentrations from emission trends based on industrial inventories; the calculated concentration trends are used by the second one to produce depth concentration profiles in the firn. The 2-D atmospheric model is validated in the boundary layer by comparison with atmospheric station measurements, and vertically for CFC-12 by comparison with balloon and FTIR measurements. Firn air measurements provide constraints on historical atmospheric concentrations over the last century. Age distributions in the firn are discussed using a Green function approach. Finally, our results are used as input to a radiative model in order to evaluate the radiative forcing of our target gases. Multi-species and multi-site firn air studies allow to better constrain atmospheric trends. The low concentrations of all studied gases at the bottom of the firn, and their consistency with our model results confirm that their natural sources are insignificant. Our results indicate that the emissions, sinks and trends of CFC-11, CFC-12, CFC-113, CFC-115 and SF6 are well constrained, whereas it is not the case for CFC-114 and CCl4. Significant emission-dependent changes in the lifetimes of halocarbons destroyed in the stratosphere were obtained. Those result from the time needed for their transport from the surface where they are emitted to the stratosphere where they are destroyed. Efforts should be made to update and reduce the large uncertainties on CFC lifetimes.

  16. Flow boiling test of GDP replacement coolants

    International Nuclear Information System (INIS)

    The tests were part of the CFC replacement program to identify and test alternate coolants to replace CFC-114 being used in the uranium enrichment plants at Paducah and Portsmouth. The coolants tested, C4F10 and C4F8, were selected based on their compatibility with the uranium hexafluoride process gas and how well the boiling temperature and vapor pressure matched that of CFC-114. However, the heat of vaporization of both coolants is lower than that of CFC-114 requiring larger coolant mass flow than CFC-114 to remove the same amount of heat. The vapor pressure of these coolants is higher than CFC-114 within the cascade operational range, and each coolant can be used as a replacement coolant with some limitation at 3,300 hp operation. The results of the CFC-114/C4F10 mixture tests show boiling heat transfer coefficient degraded to a minimum value with about 25% C4F10 weight mixture in CFC-114 and the degree of degradation is about 20% from that of CFC-114 boiling heat transfer coefficient. This report consists of the final reports from Cudo Technologies, Ltd

  17. Updating hydrogen fluoride (HF) FTIR time series above Jungfraujoch: comparison of two retrieval algorithms and impact of line shape models

    OpenAIRE

    Duchatelet, Pierre; Demoulin, Philippe; Hase, Frank; Mahieu, Emmanuel; Bernath, Peter; Boone, Chris; Walker, Kaley

    2010-01-01

    Fluorine enters the stratosphere mainly in the form of chlorofluorocarbons (CFCs; principally CFC-11 and CFC-12) and tetrafluoromethane (CF4), which have been widely emitted at ground level by human activities over the past few decades. In the lower stratosphere, the photolysis of the long-lived CFC-11 (CCl3F) and CFC-12 (CCl2F2), whose emissions from the ground have been progressively phased out by the Montreal Protocol and its successive Amendments and Adjustments, leads to the formation of...

  18. Competition Policy in Mexico

    OpenAIRE

    Ernesto Estrada Gonzalez

    2008-01-01

    The CFC faces significant challenges from cartel activity, prevailing regulatory restrictions on competition, and exclusionary practices undertaken by some of the most powerful corporations in Mexico.

  19. Measures to protect the ozone layer

    International Nuclear Information System (INIS)

    The author describes international efforts for protection of the ozone layer and cites a number of agreements on the reduction of CFC and halons. He also mentions the voluntary restrictions that German CFC producers and users have set up for themselves. (orig.)

  20. Characteristics and treatment of temporal lobe epilepsy with a history of complicated febrile convulsion.

    Science.gov (United States)

    Kanemoto, K; Takuji, N; Kawasaki, J; Kawai, I

    1998-02-01

    This study aimed to examine the close correlation between complicated febrile convulsions (CFC) and medial temporal lobe epilepsy and to delineate characteristics of temporal lobe epilepsy with CFC. Patients with temporal lobe epilepsy were divided into those with a prior episode of CFC (n=52), those with febrile convulsions other than CFC, and those without either (n=345). Clinical constellations, neuroimaging, drug resistance, and effects of temporal lobectomy of the three groups were compared. A close association between CFC and temporal lobe epilepsy was confirmed. The salient features of temporal lobe epilepsy with CFC were early age at onset of habitual seizures (about 10 years), the predominance of autonomic auras, and a high incidence of MRI evidence of unilateral medial temporal sclerosis. Patients with temporal lobe epilepsy with prior CFC had an excellent outcome after surgery, by contrast with an unfavourable response to drug therapy. The surgical results were discouraging in patients with temporal lobe epilepsy without history of any febrile convulsions and without solid brain tumours. These results indicate surgical intervention as the choice of therapy in a substantial number of patients with temporal lobe epilepsy with a history of CFC. PMID:9489540

  1. The WNT/β-catenin pathway is involved in the anti-adipogenic activity of cerebrosides from the sea cucumber Cucumaria frondosa.

    Science.gov (United States)

    Xu, Hui; Wang, Fei; Wang, Jingfeng; Xu, Jie; Wang, Yuming; Xue, Changhu

    2015-07-01

    Both adipocyte hypertrophy and hyperplasia lead to obesity. Here, we isolated cerebrosides from the sea cucumber Cucumaria frondosa (CFC) and examined its anti-adipogenic activity in vitro. CFC inhibited the lipid accumulation of 3T3-L1 cells and suppressed PPARγ and C/EBPα expressions, proving its anti-adipogenic activity. Furthermore, CFC suppressed lipogenesis in mature adipocytes. The WNT/β-catenin pathway acts as an anti-adipogenic factor. CFC enhanced β-catenin expression, promoted its nuclear translocation and up-regulated the expression of CCND1 and c-myc, two target genes of β-catenin. Moreover, after cells were treated with the β-catenin inhibitor 21H7, β-catenin nuclear translocation and transcription activity can be recovered by CFC. These findings suggested that CFC promoted the activation of the WNT/β-catenin pathway. Besides, CFC enhanced the expressions of Fz1, LRP5 and LRP6, while it had no effect on the expressions of Wnt10b and GSK3β. These findings indicated that CFC exhibits anti-adipogenic activity through enhancing the activation of the WNT/β-catenin pathway, which was mediated by FZ and LRPs. PMID:26091058

  2. Pulmonary vein orientation assessment: Is it necessary in patients undergoing contact force sensing guided radiofrequency catheter ablation of atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Pim Gal

    2015-09-01

    Conclusions: This study shows that in patients undergoing PVI with the CFC ablation system, PV orientation does not affect CF and is not associated with AF free survival. PV orientation assessment does not appear to be necessary in patients undergoing CFC PVI.

  3. Improvement of cesium leaching resistance of solidified borate wastes with copper-ferrocyanide-vermiculite adsorbent

    International Nuclear Information System (INIS)

    Removal of cesium from deionized water, sea water, and lime water with copper ferrocyanide (CFC) and porous media including silica gel, bentonite, vermiculite, and zeolite were investigated; CFC and vermiculite were incorporated to prepare a compound adsorbent which was used to improve the Cs-leaching resistance of solidified borate wastes. It was shown that the Cs-removal efficiency by CFC is largely affected by pHs of the solutions, good cesium removal occurs in pHs ranged from 3 to 12 and the best from 7 to 10; the effect of Cs concentration is significantly only from lime water for Cs > 10-6 M at high pH and is insignificant from other solutions. Vermiculite and zeolite were shown to have better removal efficiency than silica gel and bentonite, and vermiculite was chosen to incorporate with CFC to make compound adsorbents because of its good compatibility with CFC. Compound adsorbents with different CFC contents were used as additives in the solidification of borate radwaste for improving the cesium leaching resistance of waste forms. Experimental results showed that the measured, cesium leaching index following ANSI/ANS 16.1, was increased from 7.96 to 9.76 by adding 0.25% of a compound adsorbent containing 20% CFC and 80% vermiculite, which indicated that the CFC-vermiculite compound adsorbent is very useful for improving cesium leaching resistance of the solidified borate radwastes

  4. The influence of the seasonal mixed layer on oceanic uptake of CFCs

    Science.gov (United States)

    Haine, Thomas W. N.; Richards, Kelvin J.

    1995-06-01

    The issue of the appropriate GFC boundary condition for the interior of the ocean is addressed. A review of observations clearly shows substantial departure from saturation equilibrium and represents the greatest uncertainty in interpreting CFG measurements. A series of simple models is developed to determine the factors which control the CFC-11, CFC-12 and CFC-113 saturations and CFC-113:CFC-12 ratio age.The physical processes of subduction and entrainment have a strong effect; the sequestration of fluid in the seasonal thermocline and spatial variations in the depth of mixing are most important. The uncertainty in the chemical mechanisms has a smaller influence. To the limited extent that the observational database can be compared to the model results, there is good agreement. The model suggests that the variation in CFC-113:CFC-12 age is significantly less than in the saturations of CFCs 11, 12, or 113. However, given a physically realistic seasonal ocean model, the CFC saturation and age boundary condition should be predictable.

  5. Neuroleptic drugs revert the contextual fear conditioning deficit presented by spontaneously hypertensive rats: a potential animal model of emotional context processing in schizophrenia?

    Science.gov (United States)

    Calzavara, Mariana Bendlin; Medrano, Wladimir Agostini; Levin, Raquel; Kameda, Sonia Regina; Andersen, Monica Levy; Tufik, Sergio; Silva, Regina Helena; Frussa-Filho, Roberto; Abílio, Vanessa Costhek

    2009-07-01

    Schizophrenia, bipolar disorder, and attention deficit/hyperactivity disorder (ADHD) present abnormalities in emotion processing. A previous study showed that the spontaneously hypertensive rats (SHR), a putative animal model of ADHD, present reduced contextual fear conditioning (CFC). The aim of the present study was to characterize the deficit in CFC presented by SHR. Adult male normotensive Wistar rats and SHR were submitted to the CFC task. Sensitivity of the animals to the shock and the CFC performance after repeated exposure to the task were investigated. Pharmacological characterization consisted in the evaluation of the effects of the following drugs administered previously to the acquisition of the CFC: pentylenetetrazole (anxiogenic) and chlordiazepoxide (anxiolytic); methylphenidate and amphetamine (used for ADHD); lamotrigine, carbamazepine, and valproic acid (mood stabilizers); haloperidol, ziprasidone, risperidone, amisulpride, and clozapine (neuroleptic drugs); metoclopramide and SCH 23390 (dopamine antagonists without antipsychotic properties); and ketamine (a psychotomimmetic). The effects of paradoxical sleep deprivation (that worsens psychotic symptoms) and the performance in a latent inhibition protocol (an animal model of schizophrenia) were also verified. No differences in the sensitivity to the shock were observed. The repeated exposure to the CFC task did not modify the deficit in CFC presented by SHR. Considering pharmacological treatments, only the neuroleptic drugs reversed this deficit. This deficit was potentiated by proschizophrenia manipulations. Finally, a deficit in latent inhibition was also presented by SHR. These findings suggest that the deficit in CFC presented by SHR could be a useful animal model to study abnormalities in emotional context processing related to schizophrenia. PMID:18281713

  6. Emission quantification of refrigerant CFCs, HCFCs and HFCs in megacity Lahore (Pakistan) and contributed ODPs and GWPs

    Indian Academy of Sciences (India)

    Zia Ul-Haq; Muhammad Ali; Syeda Adila Batool; Salman Tariq; Zarmina Qayyum

    2016-08-01

    An integrated assessment of emissions of some important refrigerant ozone depleting substances (ODSs) (CFC-11, CFC-12, HCFC-141b and HFC-134a) and their contributed ozone depletion potentials (ODPs) and global warming potentials (GWPs) have been made in the megacity Lahore (Pakistan) for the periodfrom 2005 to 2013. During the production of 6.488 million refrigerator units, the cumulative estimated emissions of CFC-11, CFC-12, HCFC-141b and HFC-134a were 129.7, 6.8, 1257 and 104 mega grams (1 Mg = 106 grams). The estimated GWP (CO2-eq) and ODP (CFC 11-eq) associated with productionphase emissions of these four gases were 616.07, 73.52, 910.96, and 87.36 kilotonnes, and 129.7, 6.8, 139.4, and 0 tonnes, respectively. ODP of HFC-134a is considered to be zero. In addition, the repair and maintenance of 81.2 thousand units resulted in 10.8 Mg emissions of CFC-12 with 10.8 tonnes ODP(CFC11-eq) and 117,802 tonnes GWP (CO2-eq) that were higher than the HFC-134a emissions recorded at 4.3 Mg causing 4563 tonnes GWP(CO2-eq). A decrease in ODP (CFC 11-eq) and GWP (CO2-eq) at the rate of −8.3% and −8.2% per year is observed to be contributed by all the selected ODSs during the study period.

  7. Untangling cross-frequency coupling in neuroscience.

    Science.gov (United States)

    Aru, Juhan; Aru, Jaan; Priesemann, Viola; Wibral, Michael; Lana, Luiz; Pipa, Gordon; Singer, Wolf; Vicente, Raul

    2015-04-01

    Cross-frequency coupling (CFC) has been proposed to coordinate neural dynamics across spatial and temporal scales. Despite its potential relevance for understanding healthy and pathological brain function, the standard CFC analysis and physiological interpretation come with fundamental problems. For example, apparent CFC can appear because of spectral correlations due to common non-stationarities that may arise in the total absence of interactions between neural frequency components. To provide a road map towards an improved mechanistic understanding of CFC, we organize the available and potential novel statistical/modeling approaches according to their biophysical interpretability. While we do not provide solutions for all the problems described, we provide a list of practical recommendations to avoid common errors and to enhance the interpretability of CFC analysis. PMID:25212583

  8. Activation of human natural killer cells by the soluble form of cellular prion protein

    Energy Technology Data Exchange (ETDEWEB)

    Seong, Yeon-Jae [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Hafis Clinic, Seoul (Korea, Republic of); Sung, Pil Soo; Jang, Young-Soon; Choi, Young Joon [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Bum-Chan [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Park, Su-Hyung [Laboratory of Translational Immunology and Vaccinology, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of); Park, Young Woo [Aging Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Shin, Eui-Cheol, E-mail: ecshin@kaist.ac.kr [Laboratory of Immunology and Infectious Diseases, Graduate School of Medical Science and Engineering, KAIST, Daejeon (Korea, Republic of)

    2015-08-21

    Cellular prion protein (PrP{sup C}) is widely expressed in various cell types, including cells of the immune system. However, the specific roles of PrP{sup C} in the immune system have not been clearly elucidated. In the present study, we investigated the effects of a soluble form of recombinant PrP{sup C} protein on human natural killer (NK) cells. Recombinant soluble PrP{sup C} protein was generated by fusion of human PrP{sup C} with the Fc portion of human IgG{sub 1} (PrP{sup C}-Fc). PrP{sup C}-Fc binds to the surface of human NK cells, particularly to CD56{sup dim} NK cells. PrP{sup C}-Fc induced the production of cytokines and chemokines and the degranulation of granzyme B from NK cells. In addition, PrP{sup C}-Fc facilitated the IL-15-induced proliferation of NK cells. PrP{sup C}-Fc induced phosphorylation of ERK-1/2 and JNK in NK cells, and inhibitors of the ERK or the JNK pathways abrogated PrP{sup C}-Fc-induced cytokine production in NK cells. In conclusion, the soluble form of recombinant PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways. - Highlights: • Recombinant soluble PrP{sup C} (PrP{sup C}-Fc) was generated by fusion of human PrP{sup C} with IgG1 Fc portion. • PrP{sup C}-Fc protein induces the production of cytokines and degranulation from human NK cells. • PrP{sup C}-Fc protein enhances the IL-15-induced proliferation of human NK cells. • PrP{sup C}-Fc protein activates human NK cells via the ERK and JNK signaling pathways.

  9. Implications from the changes in the levels of halocarbons and the compliance with the Montreal Protocol

    Science.gov (United States)

    Chang, Chih-Chung; Wang, Jia-Lin; Lin, Neng-Huei; Liu, Wen-Tzu; Chew, Clock; Ou-Yang, Chang-Feng; Lee, Bo-Ru; Chang, Chih-Yuan

    2013-04-01

    An extensive air sampling made at 51 sites in metropolitan Taipei was conducted in 2012. The results were compared with the sampling made in 1998 using almost identical sampling approach. The goal is to investigate the changes in concentration levels and variability of ozone depleting substances (ODS) in urban atmosphere over the period of 14 years. Seven major halocarbons, i.e., CFC-11 (CCl3F), CFC-12 (CCl2F2), CFC-113 (CCl2FCClF2), CH3CCl3, CCl4, CHCl=CCl2 and CCl2=CCl2, with the latter two being non-ODS but possible carcinogens, were analyzed to assess how successful the transition to an era of ceased emissions of ODS is. After 14 years, the concentrations of CFC-11, CFC-113 and CCl4 were found to be within the proximity of the background levels in the Northern Hemisphere. Moreover, we used concentration variability to imply emissions and usage of ODS. The variability of CFC-11 and CCl4 was less than 4% expressed as one standard deviation, indicating negligible usage for these two ODS in this city of five million residents. Surprisingly, a few samples showed high values for CFC-113, indicating that sporadic usage of CFC-113 still existed. The decline in concentration variability over the 14-year period was particularly dramatic for CFC-12 and CH3CCl3, which may be related to the fact that cars made after mid-1994 were required to use HFC-134a to replace CFC-12 as the air conditioning refrigerant, and other chlorine-free solvents largely replaced CH3CCl3 in the past decade.

  10. Modelo en laboratorio de las reacciones de degradación de los CFC'S, HCFC'S y HFC'S en la atmósfera : su relación con la degradación de la capa de ozono y el efecto invernadero

    OpenAIRE

    Vázquez Dols, José Luis

    1999-01-01

    La concentración de ozono en la estratosfera es producto de un balance de fuerzas creadoras y destructivas. El nivel de ozono en la estratosfera debe mantenerse constante, actuando en régimen permanente. En la estratosfera la concentración de ozono varía ligeramente reflejando ligeras variaciones sobre el punto de equilibrio entre la formación y la destrucción. Estas fluctuaciones son debidas a procesos naturales tales como: ciclos estacionales, erupciones volcánicas, cambios en la intensidad...

  11. Influences of Py C/SiC/TaC Interfaces on Mechanical Properties of 3 D Fine-woven Punctured Cf/C Composites%PyC/SiC/TaC界面对三维细编Cf/C复合材料力学性能的影响

    Institute of Scientific and Technical Information of China (English)

    曾凡浩; 熊翔

    2011-01-01

    采用等温气相沉积方法制备了一种含PyC/SiC/TaC界面的炭/炭复合材料,采用偏光显微镜、X射线衍射和扫描电镜分析了材料的结构和断裂特点,采用单轴拉伸和三点弯曲方法研究了PyC/SiC/TaC界面对炭/炭复合材料力学性能的影响.金相和XRD表明热解炭界面是各向同性炭,TaC界面是NaCl型立方结构,SiC的结构以立方β-SiC为主,有少量的10H-SiC结构.TaC/SiC纤维界面能显著提高复合材料的拉伸、弯曲性能以及Z向压缩性能.整体密度为1.89 g/cm3时,含界面炭/炭材料的抗弯强度达375 MPa,约为无界面材料的4倍,同时材料整体密度的增加也能显著改善其力学性能.分析表明材料总体呈非线性脆断,有一定的假塑性行为.压缩载荷作用下Z向和XY向都为与受力方向成45°的剪切型破坏.%The 3D fine-woven punctured Cf/C-(PyC/SiC/TaC) composites, composed of PyC/SiC/TaC interfaces and pyrocarbon ( PyC) matrix, were synthesized by isothermal chemical vapor infiltration(ICVI) methods. The structure and fracture characteristics of these composites have been examined by polarized light microscopy ( PLM) , scanning electron microscopy (SEM) and X-ray diffraction (XRD). The influences of PyC/SiC/TaC interfaces on the C/C composites were investigated by uniaxial tension and three-point bending methods. It was found that the PyC interface has isotropic( ISO) structure, and the TaC layer has NaCl-type cubic structure, while the SiC layer has few wurtzite type lOH-SiC besides β-SiC structure. The TaC/SiC fiber coating can greatly improve tensile, flexural and z-direction compressive properties of the composites. The maximum of flexural strength are 375 Mpa at density of 1. 89 g/cm3, which are about three times higher than that of samples without TaC/SiC fiber coating. The mechanical properties can be improved obviously by the increase of bulk density of the composites as well. The analysis tells that the composite exhibits a nonlinear brittle failure , indicating a certain pseudoplastic behavior. Failure modes of the samples under compressive load along Z or XY direction present 45° shear fracture.

  12. Chapter 6. Models of groundwater ages and residence times

    International Nuclear Information System (INIS)

    CFC ages are generally based on absolute concentrations. As a result, when waters of different ages mix, the CFC concentration changes and so does the apparent age. Because CFC concentrations in the atmosphere are not a linear function of time, the apparent age is not necessarily proportional to the fraction of each component of water in the mixture. In this chapter, more general models of groundwater age distributions in simple aquifer types are reviewed, as well as how the age distribution relates to aquifer properties

  13. Non-metals as structural materials in the first wall of a thermonuclear reactor

    International Nuclear Information System (INIS)

    Graphites and carbon fiber reinforced materials currently are tested and used as materials for protecting the first wall of existing or planned magnetic confinement experiments. Apart from the strongly exposed components such as limiters, divertors or deflecting plates, also other first-wall components now are increasingly protected or tested for protection by CFC materials. Due to their very good thermal shock resistance and the low atomic mass Z, graphites and CFC materials together with beryllium are quite superior over all other candidate materials. In addition, graphites and CFC materials have good resistance to thermal cycling. (orig./GG)

  14. Supplementary Info. to Archbold et al. (2012) Carbon isotopic fractionation of CFCs during abiotic and biotic degradation. Environ. Sci. & Tech., 46(3): 1764-1773

    OpenAIRE

    Archbold, Marie; Elliot, Trevor; Kalin, Robert

    2011-01-01

    Contains 9 pages of text on the laboratory study and field site with background information on the potential degradation products of CFC-113 and CFC-11 using ZVI, CFC sources in atmospheric and landfill gases, supporting information on Methodology for the ZVI batch studies and sampling at the landfill site for the current study, supporting results for the batch pH and Eh evolution and batch degradation products, for the emissions of CFCs through Landfill Soil Cover on the Old Landfill site, a...

  15. Target Awareness: Lupus

    Medline Plus

    Full Text Available ... Lupus Day Become a Media Spokesperson Become an Activist Participate in a Clinical Trial Fundraise Your Way ... Now Walk to End Lupus Now Become an Activist Participate in a Clinical Trial CFC #10566 Ways ...

  16. The Ozone Layer and Metered Dose Inhalers

    Directory of Open Access Journals (Sweden)

    Louis-Philippe Boulet

    1998-01-01

    Full Text Available The stratospheric ozone layer plays a crucial role in protecting living organisms against ultraviolet radiation. Chlorofluorocarbons (CFC contained in metered-dose inhalers (MDIs contribute to ozone depletion and in accordance with the Montreal Protocol on Substances That Deplete the Ozone Layer established 10 years ago, phase-out strageies have been developed worldwide for this category of agents. Alternatives to CFC-containing inhalers have been developed, such as powder inhalers and those using hydrofluoroalkanes (HFAs as propellants, which have been shown to be as safe and effective as CFC-containing inhalers and even offer interesting advantages over older inhalers. The transition to non-CFC MDIs requires a major effort to make the new products available and to ensure adequate comparision with the previous ones. It also requires a harmonization of actions taken by industry, government, licencing bodies and patients or health professional associations to ensure adequate information and education to the public and respiratory care providers.

  17. PUBLICATIONS (AIR POLLUTION TECHNOLOGY BRANCH, AIR POLLUTION PREVENTION AND CONTROL DIVISION, NRMRL)

    Science.gov (United States)

    The Air Pollution Technology Branch (APTB) of NRMRL's Air Pollution Prevention and Control Division produces and publishes highly specialized technical and scientific documents related to APTB's research. Areas of research covered include artificial intelligence, CFC destruction,...

  18. Asthma Inhalers

    Science.gov (United States)

    ... you may be able to receive free and discount drugs if you are unable to aff ord ... than the CFC-containing products they replace. Pharmaceutical companies are committed to ensuring that no patient is ...

  19. 77 FR 12276 - Combined Notice of Filings #2

    Science.gov (United States)

    2012-02-29

    ...-000. Applicants: Interstate Power and Light Company. Description: IPL and FCW--LBA Agreement to be... and Light Company. Description: IPL and FCW--CFC Agreement to be effective 9/24/2012. Filed Date:...

  20. 5 CFR 950.203 - Public accountability standards.

    Science.gov (United States)

    2010-01-01

    ... organization is directed by an active and responsible governing body whose members have no material conflict of... fundraising practices prohibit the sale or lease of its CFC contributor lists. (7) Certify that its...

  1. Central Flyway Duck Banding project : Annual progress report 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Central Flyway Council (CFC) initiated a six year duck banding program in 1996 with emphasis on mallard banding in North Dakota, South Dakota, Montana, and...

  2. Swiss provider of refrigerants opts for natural refrigerants; Traditioneller Kaeltemittelhaendler in der Schweiz setzt auf natuerliche Kaeltemittel

    Energy Technology Data Exchange (ETDEWEB)

    Knus, S.

    2005-10-01

    Friosol, a leading provider of synthetic refrigerant, now opts for natural refrigerants. Friosol has been on the market for more than 55 years, especially in Switzerland, and CFC refrigerants used to be their key line of business. (orig.)

  3. Regeneration of hemopoietic precursor cells in spleen organ cultures from irradiated mice: influence of genotype of cells injected and of the spleen microenvironment

    International Nuclear Information System (INIS)

    The regeneration of hemopoietic precursor cells was monitored in spleen organ cultures from lethally irradiated mice injected with 10(7) normal syngeneic or allogeneic bone marrow cells. The important role of the microenvironment in supporting hemopoiesis was confirmed by the failure of mutant Sl/Sld spleens to support CFC regeneration in organ cultures. However, the extent and quality of the CFC regeneration was clearly dependent on the genetic properties of the injected cells. Evidence for this was obtained from the regeneration patterns of various CFC types in organ cultured spleens derived from different mouse donor-recipient strain combinations that maintained the differences in the bone marrow frequency of various CFC types characteristic of the donor strain

  4. Consumerism triggers AC explosion

    Energy Technology Data Exchange (ETDEWEB)

    Lafferty, Richard

    1997-05-01

    The growth in air conditioning in the United Kingdom in recent years is examined in this article, and split systems, the phasing out of CFC and HCFC refrigerants, global warming, and comfort levels are considered. (UK)

  5. COMPOSITION CHANGES IN REFRIGERANT BLENDS FOR AUTOMOTIVE AIR CONDITIONING

    Science.gov (United States)

    Three refrigerant blends used to replace CFC-12 in automotive air conditioners were evaluated for composition changes due to typical servicing and leakage. When recommended service procedures were followed, changes in blend compositions were relatively small. Small changes in b...

  6. 5 CFR 950.301 - National and international federations eligibility.

    Science.gov (United States)

    2010-01-01

    ... from the date of its IRS tax-exemption letter to the closing date of the CFC application period. (ii..., accountants, lawyers, and other vendors of goods and/or services to assist in accomplishing its...

  7. Effects of Consideration of Future Consequences and Temporal Framing on Acceptance of the HPV Vaccine Among Young Adults.

    Science.gov (United States)

    Kim, Jarim; Nan, Xiaoli

    2016-09-01

    This study examines how individual difference in consideration of future consequences (CFC) and temporal framing (i.e., present- vs. future-oriented message) interact to influence the persuasive outcomes of a health message promoting human papillomavirus (HPV) vaccination among young adults. Results of an experiment (N = 416) showed a significant interaction effect of CFC and temporal framing on persuasion. The nature of the interaction suggested that individuals with high CFC generally were more persuaded by the present-oriented messages, compared to the future-oriented messages. On the other hand, those with low CFC responded similarly to the present- and future-oriented messages. Implications of the findings for HPV vaccination messaging are discussed. PMID:26799968

  8. Target Awareness: Lupus

    Medline Plus

    Full Text Available ... Council Government Relations Financial Accountability Employment & Internships Contact Us Press Center Take Action Donate Now Walk to End Lupus Now Become an Activist Participate in a Clinical Trial CFC #10566 Ways to Give Find a Local ...

  9. Climate change and ozone layer protection

    International Nuclear Information System (INIS)

    This conference is composed of 27 communications of which the following main themes are: general approach to the problems of climatic change, greenhouse effect and ozone layer; France, Cameroon and Switzerland examples of energy conservation and greenhouse gas reduction; energy conservation measures and policies for dwellings, transport, industry, agriculture and food industry with a global aspect of reducing greenhouse gas emissions; CFC utilization effects on environment and alternatives to CFC utilization

  10. The Ozone Layer and Metered Dose Inhalers

    OpenAIRE

    Louis-Philippe Boulet

    1998-01-01

    The stratospheric ozone layer plays a crucial role in protecting living organisms against ultraviolet radiation. Chlorofluorocarbons (CFC) contained in metered-dose inhalers (MDIs) contribute to ozone depletion and in accordance with the Montreal Protocol on Substances That Deplete the Ozone Layer established 10 years ago, phase-out strageies have been developed worldwide for this category of agents. Alternatives to CFC-containing inhalers have been developed, such as powder inhalers and thos...

  11. Hyper-Brain Networks Support Romantic Kissing in Humans

    OpenAIRE

    Müller, Viktor; Lindenberger, Ulman

    2014-01-01

    Coordinated social interaction is associated with, and presumably dependent on, oscillatory couplings within and between brains, which, in turn, consist of an interplay across different frequencies. Here, we introduce a method of network construction based on the cross-frequency coupling (CFC) and examine whether coordinated social interaction is associated with CFC within and between brains. Specifically, we compare the electroencephalograms (EEG) of 15 heterosexual couples during romantic k...

  12. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Directory of Open Access Journals (Sweden)

    J. W. Elkins

    2012-09-01

    Full Text Available Since the Montreal Protocol on substances that deplete the ozone layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS, particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. The CFC-11 lifetime of 45 yr, currently recommended in the World Meteorological Organisation (WMO Scientific Assessment of Ozone Depletion, lies at the lower uncertainty bound of our estimates which are 524066 yr (1-sigma uncertainty when AGAGE data were used, and 504066 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is higher than the WMO estimates of 85 yr (10488123 using AGAGE, 10387122 using NOAA. Our estimates of the lifetime of CFC-12 and CH3CCl3 agree well with other recent estimates being 10885137 and 10484135 yr (CFC-12, AGAGE and NOAA, respectively and 5.24.85.6 and 5.24.85.7 yr (CH3CCl3, AGAGE and NOAA, respectively.

  13. Strength and durability characteristics of polymer-modified carbon fiber concrete

    OpenAIRE

    Torgal, Fernando Pacheco; Gonzalez, J.(National Centre for Particle and High Energy Physics, Minsk, Belarus); Jalali, Said

    2010-01-01

    Carbon-fiber concrete (CFC) materials are gaining momentum due to the reduction of carbon fiber cost and also to the sensing performance of carbon fiber reinforced concrete based structures. For carbon fiber concrete electrical resistance increases with tensile stress and decreases upon compression. Therefore CFC can act as self-monitoring strain sensor. Nevertheless, fiber incorporation is responsible for a loss in concrete workability, and also for a slightly compression strength r...

  14. Reduction in LFP cross-frequency coupling between theta and gamma rhythms associated with impaired STP and LTP in a rat model of brain ischemia

    Directory of Open Access Journals (Sweden)

    Tao Zhang

    2013-04-01

    Full Text Available The theta-gamma cross-frequency coupling (CFC in hippocampus was reported to reflect memory process. In this study, we measured the CFC of hippocampal local field potentials (LFPs in a two-vessel occlusion (2VO rat model, combined with both amplitude and phase properties and associated with short and long-term plasticity indicating the memory function. Male Wistar rats were used and a 2VO model was established. STP and LTP were recorded in hippocampal CA3-CA1 pathway after LFPs were collected in both CA3 and CA1. Based on the data of relative power spectra and phase synchronization, it suggested that both the amplitude and phase coupling of either theta or gamma rhythm were involved in modulating the neural network in 2VO rats. In order to determine whether the CFC was also implicated in neural impairment in 2VO rats, the coupling of CA3 theta–CA1 gamma was measured by both phase-phase coupling (n:m phase synchronization and phase-amplitude coupling. The attenuated CFC strength in 2VO rats implied the impaired neural communication in the coordination of theta-gamma entraining process. Moreover, compared with modulation index (MI a novel algorithm named cross frequency conditional mutual information (CF-CMI, was developed to focus on the coupling between theta phase and the phase of gamma amplitude. The results suggest that the reduced CFC strength probably attributed to the disruption of the phase of CA1 gamma envelop. In conclusion, it implied that the phase coupling and CFC of hippocampal theta and gamma played an important role in supporting functions of neural network. Furthermore, synaptic plasticity on CA3-CA1 pathway was reduced in line with the decreased CFC strength from CA3 to CA1. It partly supported our hypothesis that directional CFC indicator might probably be used as a measure of synaptic plasticity.

  15. Solar production of catalytic filamentous carbon by thermal decomposition of hydrocarbons and carbon monoxide

    Energy Technology Data Exchange (ETDEWEB)

    Kirillov, V.A.; Kuvshinov, G.G.; Mogilnykh, Yu.I. [Boreskov Institute of Catalysis, Novosibirsk (Russian Federation); Reller, A. [University of Hamburg (Germany); Steinfeld, A.; Weidenkaff, A.; Meier, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1999-08-01

    Concentrated solar radiation was used as the clean source of process heat for the production of Catalytic Filamentous Carbon (CFC) by thermal decomposition of gaseous hydrocarbons and by CO disproportionation in the presence of small metal catalyst particles. Depending on the catalyst, two different types of CFC, namely nano tubes and nano fibers, were obtained in solar experiments at the PSI solar furnace. (author) 2 figs., 1 tab., 7 refs.

  16. The evolution of the inorganic fluorine budget since the mid-1980s based on FTIR measurements at northern mid-latitudes

    OpenAIRE

    Duchatelet, Pierre; Feng, Wuhu; Chipperfield, Martyn; Ruhnke, Roland; Bernath, Peter; Boone, Chris; Walker, Kaley; Demoulin, Philippe; Mahieu, Emmanuel

    2011-01-01

    Fluorine enters the stratosphere principally in the form of CFCs (chlorofluorocarbons, mainly CFC-12 and CFC-11), HCFCs (hydrochlorofluorocarbons, mainly HCFC-22) and HFCs (hydrofluorocarbons, mainly HFC-134a) which have been (or are still) widely emitted at ground level by human activities. In the lower stratosphere, the photolysis of these halogenated source gases leads to the formation of the two fluorine reservoirs COClF and COF2. The subsequent photolysis of these two compounds frees F a...

  17. Cross-frequency coupling in real and virtual brain networks

    OpenAIRE

    Jirsa, Viktor; Müller, Viktor

    2013-01-01

    Information processing in the brain is thought to rely on the convergence and divergence of oscillatory behaviors of widely distributed brain areas. This information flow is captured in its simplest form via the concepts of synchronization and desynchronization and related metrics. More complex forms of information flow are transient synchronizations and multi-frequency behaviors with metrics related to cross-frequency coupling (CFC). It is supposed that CFC plays a crucial role in the organi...

  18. Cross-Frequency Coupling in Real and Virtual Brain Networks

    Directory of Open Access Journals (Sweden)

    Viktor Jirsa

    2013-07-01

    Full Text Available Information processing in the brain is thought to rely on the convergence and divergence of oscillatory behaviors of widely distributed brain areas. This information flow is captured in its simplest form via the concepts of synchronization and desynchronization and related metrics. More complex forms of information flow are transient synchronizations and multi-frequency behaviors with metrics related to cross-frequency coupling (CFC. It is supposed that CFC plays a crucial role in the organization of large-scale networks and functional integration across large distances. In this study we describe different CFC measures and test their applicability in simulated and real electroencephalographic (EEG data obtained during resting state. For these purposes, we derive generic oscillator equations from full brain network models. We systematically model and simulate the various scenarios of cross-frequency coupling under the influence of noise to obtain biologically realistic oscillator dynamics. We find that (i specific CFC-measures detect correctly in most cases the nature of CFC under noise conditions, (ii bispectrum and bicoherence correctly detect the CFCs in simulated data, (iii empirical resting state EEG show a prominent delta-alpha CFC as identified by specific CFC measures and the more classic bispectrum and bicoherence. This coupling was mostly asymmetric (directed and generally higher in the eyes-closed than in the eyes-open condition. In conjunction, these two sets of measures provide a powerful toolbox to reveal the nature of couplings from experimental data and as such allow inference on the brain state dependent information processing. Methodological advantages of using CFC measures and theoretical significance of delta and alpha interactions during resting and other brain states are discussed.

  19. Cross-Frequency Coupling in Real and Virtual Brain Networks

    OpenAIRE

    Viktor Jirsa; Viktor Müller

    2013-01-01

    Information processing in the brain is thought to rely on the convergence and divergence of oscillatory behaviors of widely distributed brain areas. This information flow is captured in its simplest form via the concepts of synchronization and desynchronization and related metrics. More complex forms of information flow are transient synchronizations and multi-frequency behaviors with metrics related to cross-frequency coupling (CFC). It is supposed that CFC plays a crucial role in the organi...

  20. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Directory of Open Access Journals (Sweden)

    M. Rigby

    2013-03-01

    Full Text Available Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS, particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. A steady-state lifetime of 45 yr for CFC-11, currently recommended in the most recent World Meteorological Organisation (WMO Scientific Assessments of Ozone Depletion, lies towards the lower uncertainty bound of our estimates, which are 544861 yr (1-sigma uncertainty when AGAGE data were used and 524561 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is significantly higher than the WMO estimates of 85 yr, being 10999121 (AGAGE and 10997124 (NOAA. New estimates of the steady-state lifetimes of CFC-12 and CH3CCl3 are consistent with the current WMO recommendations, being 11195132 and 11295136 yr (CFC-12, AGAGE and NOAA respectively and 5.044.925.20 and 5.044.875.23 yr (CH3CCl3, AGAGE and NOAA respectively.

  1. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    Science.gov (United States)

    Rigby, M.; Prinn, R. G.; O'Doherty, S.; Montzka, S. A.; McCulloch, A.; Harth, C. M.; Mühle, J.; Salameh, P. K.; Weiss, R. F.; Young, D.; Simmonds, P. G.; Hall, B. D.; Dutton, G. S.; Nance, D.; Mondeel, D. J.; Elkins, J. W.; Krummel, P. B.; Steele, L. P.; Fraser, P. J.

    2013-03-01

    Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began in the early 1970s along with the first lifetime estimates calculated by considering their atmospheric trends. We now have global mole fraction records spanning multiple decades, prompting this lifetime re-evaluation. Using surface measurements from the Advanced Global Atmospheric Gases Experiment (AGAGE) and the National Oceanic and Atmospheric Administration Global Monitoring Division (NOAA GMD) from 1978 to 2011, we estimated the lifetime of CFC-11, CFC-12, CFC-113 and CH3CCl3 using a multi-species inverse method. A steady-state lifetime of 45 yr for CFC-11, currently recommended in the most recent World Meteorological Organisation (WMO) Scientific Assessments of Ozone Depletion, lies towards the lower uncertainty bound of our estimates, which are 544861 yr (1-sigma uncertainty) when AGAGE data were used and 524561 yr when the NOAA network data were used. Our derived lifetime for CFC-113 is significantly higher than the WMO estimates of 85 yr, being 10999121 (AGAGE) and 10997124 (NOAA). New estimates of the steady-state lifetimes of CFC-12 and CH3CCl3 are consistent with the current WMO recommendations, being 11195132 and 11295136 yr (CFC-12, AGAGE and NOAA respectively) and 5.044.925.20 and 5.044.875.23 yr (CH3CCl3, AGAGE and NOAA respectively).

  2. Craniofacial and Dental Development in Cardio-facio-cutaneous Syndrome: The Importance of Ras Signaling Homeostasis

    OpenAIRE

    Goodwin, Alice F.; Oberoi, Snehlata; Landan, Maya; Charles, Cyril; Groth, Jessica; Martinez, Anna; Fairley, Cecilia; Weiss, Lauren A.; Tidyman, William E.; Klein, Ophir D.; Rauen, Katherine A.

    2012-01-01

    Cardio-facio-cutaneous syndrome (CFC) is a RASopathy that is characterized by craniofacial, dermatologic, gastrointestinal, ocular, cardiac, and neurologic anomalies. CFC is caused by activating mutations in the Ras/mitogen-activated protein kinase (MAPK) signaling pathway that lies downstream of receptor tyrosine kinase (RTK) signaling. RTK signaling is known to play a central role in craniofacial and dental development, but to date, no studies have systematically examined individuals with C...

  3. Does consideration of future consequences moderate the relationship between aggression and alcohol use in adolescents? Results from the United Kingdom

    OpenAIRE

    McKay, Michael Thomas; Dempster, Martin; Mello, Zena

    2015-01-01

    Background: An increasing body of literature suggests that those who give greater consideration to the future consequences (CFC) of their present behaviours are at a reduced risk of negative health outcomes. The present study examined whether CFC moderated the relationship between four domains of aggression and alcohol use in adolescents in the United Kindgom. Methods: Participants were 1058 adolescents from Northern Ireland. Participants completed questionnaires assessing: Anger; Hostility; ...

  4. Ozone depletion and skin cancer incidence: an integrated modelling approach

    OpenAIRE

    Slaper H; den Elzen MGJ; de Woerd HJ; Greef J de

    1992-01-01

    A decrease in stratospheric ozone, probably caused by chlorofluorocarbon (CFC) emissions, has been observed over large parts of the globe. The incidence of skin cancer is expected to increase due to ozone depletion. An integrated source-risk model is developed and applied to evaluate the increased skin cancer incidence related to various CFC emission scenarios. The source-risk model is an independent submodule within the framework of IMAGE, an integrated source-effect-model for climate change...

  5. Carbon fiber cloth supported Au nano-textile fabrics as an efficient catalyst for hydrogen peroxide electroreduction in acid medium

    Science.gov (United States)

    Yang, Fan; Cheng, Kui; Wang, Guiling; Cao, Dianxue

    2015-09-01

    The size-controlled hierarchical textile-like Au nanostructures supported carbon fiber cloth (Au NTs/CFC) is successfully fabricated through a simple low-cost electrochemical route. The electrodes are characterised by scanning electron microscopy equipped with an energy dispersive X-ray spectrometer, transmission electron microscopy and X-ray diffractometer. Without any conducting carbons and polymer binders, the 3D electrode with unique structure is directly used as the electrocatalyst for H2O2 reduction in acid solution and the catalytic performance is evaluated by voltammetry and chronoamperometry. The Au NTs/CFC electrode exhibits much higher catalytic activity and remarkably improved utilization of Au than Au nanoparticles (Au NPs/CFC) prepared by the same method owing to its unique structure. In the solution of 3.0 mol L-1 H2SO4 + 0.1 mol L-1 H2O2, with the reduction potential of 0 V, the current of -0.72 A cm-2 mg-1 can be obtained on Au NTs/CFC electrode and only a current of -0.09 A cm-2 mg-1 can be achieved on Au NPs/CFC electrode. All these results reveal that the novel Au NTs/CFC electrode exhibits excellent catalytic performance and superior stability for H2O2 electroreduction in acid medium, benefitting from the unique 3D structure which can ensure high utilization of catalyst.

  6. Contribution of some ozone depleting substances (ODS) and greenhouse gases (GHGs) on total column zone growth at Srinagar (34°N, 74.8°), India

    Indian Academy of Sciences (India)

    P K Jana; D K Saha; D Sarkar

    2013-02-01

    A critical analysis has been made on the contribution of CFC-11, CFC-12, CFC-113, CH2Cl, CH3Br, CCl4, CH3CCl3, HCFCs, halons, WMO (World Meteorological Organization) minor constituents, CH4, N2O and water vapour to the variation of total column ozone (TCO) concentration at the station in Srinagar (34°N, 74.8°E), India from 1992 to 2003. With the implementation of Montreal Protocol, though the concentrations of CFC-11, CFC-113, CH3Cl, CH3Br, CCl4 and CH3CCl3 had decreased, the concentrations of CFC-12, HCFCs, halons, WMO minor constituents, CH4, N2O and water vapour had increased, as a result of which TCO had risen from 1992 to 2003 at the above station. The nature of yearly variations of concentrations of the above ozone depleting substances and greenhouse gases as well as ozone has been presented. Possible explanations for build-up of TCO have also been offered.

  7. Contribution of some ozone depleting substances (ODS) and greenhouse gases (GHGs) on total column ozone growth at Srinagar (34°N, 74.8°E), India

    Science.gov (United States)

    Jana, P. K.; Saha, D. K.; Sarkar, D.

    2013-02-01

    A critical analysis has been made on the contribution of CFC-11, CFC-12, CFC-113, CH3Cl, CH3Br, CCl4, CH3CCl3, HCFCs, halons, WMO (World Meteorological Organization) minor constituents, CH4, N2O and water vapour to the variation of total column ozone (TCO) concentration at the station in Srinagar (34°N, 74.8°E), India from 1992 to 2003. With the implementation of Montreal Protocol, though the concentrations of CFC-11, CFC-113, CH3Cl, CH3Br, CCl4 and CH3CCl3 had decreased, the concentrations of CFC-12, HCFCs, halons, WMO minor constituents, CH4, N2O and water vapour had increased, as a result of which TCO had risen from 1992 to 2003 at the above station. The nature of yearly variations of concentrations of the above ozone depleting substances and GHGs as well as ozone has been presented. Possible explanations for build-up of TCO have also been offered.

  8. Radioprotective effects of combination broncho-vaxom, a macrophage activator, and indomethacin, an inhibitor of prostaglandin production. Relationship to myelopoiesis

    International Nuclear Information System (INIS)

    The effects of the bacterial extract broncho-vaxom (BV; radioprotective immunomodulator; 500 μg/mouse i.p., -24 h) and indomethacin (INDO; inhibitor of prostaglandin production; 2x40 μg/mouse i.m., - 24 h and - 3 h) on the post-irradiation recovery of hemopoietic functions in mice were investigated. Both agents were administered either alone or in combination. Endogenous spleen colony formation was increased in all treatment groups, with combination-treated mice exhibiting the greatest effects. Similarly, 24 h after combined administration of BV and INDO (i.e. at the time of presumed irradiation) to the non-irradiated mice granulocyte-macrophage colony-forming cell (GM-CFC) numbers were greater in the bone marrow and spleen. Also, as determined by hydroxyurea injection, there was an increase in the number of GM-CFC in the S-phase of the cell cycle in the bone marrow. However, GM-CFC in the spleen of combination pretreated mice was not stimulated to significant proliferation as compared to GM-CFC in the spleen of mice injected with BV alone. Combined modality treatment was also more effective than single agent treatments in accelerating bone marrow cellularity and GM-CFC regeneration, but not in accelerating GM-CFC regeneration in the spleen. Combined administration of BV and INDO to mice prior to lethal irradiation exerted and additional radioprotective effect and protected 95% of the C57B1/6 mice. (au) 42 refs

  9. Redesigning of a Canard Control Surface of an Advanced Fighter Aircraft: Effect on Buckling and Aerodynamic Behavior

    Directory of Open Access Journals (Sweden)

    Shrivastava Sachin

    2015-01-01

    Full Text Available A redesign of canard control-surface of an advanced all-metallic fighter aircraft was carried out by using carbon fibre composite (CFC for ribs and panels. In this study ply-orientations of CFC structure are optimized using a Genetic-Algorithm (GA with an objective function to have minimum failure index (FI according to Tsai-Wu failure criterion. The redesigned CFC structure was sufficiently strong to withstand aerodynamic loads from stress and deflection points of view. Now, in the present work CFC canard structure has been studied for its buckling strength in comparison to existing metallic design. In this study, the existing metallic design was found to be weak in buckling. Upon a detailed investigation, it was revealed that there are reported failures in the vicinity of zones where initial buckling modes are excited as predicted by the finite element based buckling analysis. In view of buckling failures, the redesigned CFC structure is sufficiently reinforced with stringers at specific locations. After providing reinforcements against buckling, the twist and the camber variations of the airfoil are checked and compared with existing structure data. Finally, the modal analysis has been carried out to compare the variation in excitation frequency due to material change. The CFC structure thus redesigned is safe from buckling and aerodynamic aspects as well.

  10. Comparison of scintigraphic and plethysmographic measurements for determination of capillary filtration coefficient in human limbs

    International Nuclear Information System (INIS)

    To determine the capillary filtration coefficient (CFC) the continuous rise of the plethysmographic curve under conditions of venous congestion is used conventionally. The combination of plethysmographic and scintigraphic methods is of advantage because it allows discrimination between local vascular and extravascular volume changes. Moreover the scintigraphic registrations indicate the moment when the filling of the capacity vessels has reached a steady state. Six male subjects were tested using this method. Data obtained from plethysmography (strain gauge), scintigraphy (Tc-99m labelled erythrocytes) and venous pressure measurements were used to calculate the CFC of forearm and calf. The calculations of the CFC were carried out by various methods. CFC-values taken from the congestion period were too low due to methodical reasons. On the other hand the values obtained from the post-congestion period are in accordance with those yielded by the conventional method. The average CFC was 0.0058 +- 0.0013 (forearm) and 0.0053 +- 0.0011 ml/min X mm Hg X 100 ml soft tissue (Calf). The intravascular volumes of forearm and calf usually were constant 3-4 min after the beginning of the congestion period. Our results indicate that a plethysmographic-scintigraphic method can be applied to determine the CFC in human limbs. The conventional method is justified if the intravascular filling period of 3-4 min (increase in i.v. pressure of about 40 mm Hg) is taken into consideration. (orig.)

  11. Hematopoetic progenitor cell changes in the blood as indicators of radiation damage to the bone marrow

    International Nuclear Information System (INIS)

    The results obtained from the canine experiments learly show that in the case of whole body irradiation in the dose range of 0.4 Gy, if given acutely, and in the dose range of 0.6 Gy if given in fractions or chronically, CFC-GM changes in the blood can be shown that are indicative of damage to the bone marrow CFC-GM compartment. However, in contrast to the in vitro situation no exact dose response relationship can be defined due to the large inter- and intra-individual variations in the blood CFC-GM concentration. The data obtained from the follow-up studies, on the other hand, point to a very important aspect, namely that on the basis of blood CFC-GM alterations some residual damage to the bone marrow can be demonstrated even 160 days after a radiation dose of approx. 0.8 Gy. From the results obtained from patients in the course of radiotherapy, though quite limited, it becomes evident that the method of blood CFC-GM determinations as an assay of bone marrow function after irradiation in principle is transferable to man. However, up to now it is quite unclear in which way the pattern of blood CFC-GM alterations will differ for different exposure conditions. (orig.)

  12. Damage of actively cooled plasma facing components of magnetic confinement controlled fusion machines

    Energy Technology Data Exchange (ETDEWEB)

    Chevet, G. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France)], E-mail: gaelle.chevet@cea.fr; Schlosser, J. [Association Euratom-CEA, DSM/DRFC, CEA Cadarache, Saint-Paul-Lez-Durance (France); Martin, E.; Herb, V.; Camus, G. [Universite Bordeaux 1, UMR 5801 (CNRS-SAFRAN-CEA-UB1), Laboratoire des Composites Thermostructuraux, F-33600 Pessac (France)

    2009-03-31

    Plasma facing components (PFCs) of magnetic fusion machines have high manufactured residual stresses and have to withstand important stress ranges during operation. These actively cooled PFCs have a carbon fibre composite (CFC) armour and a copper alloy heat sink. Cracks mainly appear in the CFC near the composite/copper interface. In order to analyse damage mechanisms, it is important to well simulate the damage mechanisms both of the CFC and the CFC/Cu interface. This study focuses on the mechanical behaviour of the N11 material for which the scalar ONERA damage model was used. The damage parameters of this model were identified by similarity to a neighbour material, which was extensively analysed, according to the few characterization test results available for the N11. The finite elements calculations predict a high level of damage of the CFC at the interface zone explaining the encountered difficulties in the PFCs fabrication. These results suggest that the damage state of the CFC cells is correlated with a conductivity decrease to explain the temperature increase of the armour surface under fatigue heat load.

  13. Structure of Sphingolipids From Sea Cucumber Cucumaria frondosa and Structure-Specific Cytotoxicity Against Human HepG2 Cells.

    Science.gov (United States)

    Jia, Zicai; Song, Yu; Tao, Suyuan; Cong, Peixu; Wang, Xiaoxu; Xue, Changhu; Xu, Jie

    2016-03-01

    To investigate the relationship between structure and activity, three glucocerebroside series (CFC-1, CFC-2 and CFC-3), ceramides (CF-Cer) and long-chain bases (CF-LCB) of sea cucumber Cucumaria frondosa (C. frondosa) were isolated and evaluated in HepG2 cells. The molecular species of CFC-1, CFC-2 and CFC-3 and CF-Cer were identified using reversed-phase liquid chromatography with heated electrospray ionization coupled to high-resolution mass spectrometry (RPLC-HESI-HRMS), and determined on the basis of chemical and spectroscopic evidence: For the three glucocerebroside series, fatty acids (FA) were mainly saturated (18:0 and 22:0), monounsaturated (22:1, 23:1 and 24:1) and 2-hydroxyl FA (2-HFA) (23:1 h and 24:1 h), the structure of long-chain bases (LCB) were dihydroxy (d17:1, d18:1 and d18:2) and trihydroxy (t16:0 and t17:0), and the glycosylation was glucose; For CF-Cer, FA were primarily saturated (17:0) and monounsaturated (16:1 and 19:1), the structure of LCB were dihydroxy (d17:1 and d18:1), and trihydroxy (t16:0). The results of cell experiment indicated that all of three glucocerebroside series, CF-Cer and CF-LCB exhibited an inhibitory effects on cell proliferation. Moreover, CFC-3 was most effective in three glucocerebrosides to HepG-2 cell viability. The inhibition effect of CF-LCB was the strongest, and the inhibition effect of CF-Cer was much stronger than glucocerebrosides. PMID:26861868

  14. Behavioral functioning in cardiofaciocutaneous syndrome: Risk factors and impact on parenting experience.

    Science.gov (United States)

    Pierpont, Elizabeth I; Wolford, Melinda

    2016-08-01

    The present study is an investigation of behavioral functioning in children with cardiofaciocutaneous syndrome (CFC). CFC is a rare single-gene disorder associated with cardiac disease, characteristic skin and facial features, intellectual disability, and neurological complications such as seizures and structural brain anomalies. Emotional and behavioral features of CFC have not been systematically investigated. We aimed to identify key variables that contribute to psychopathology during childhood and adolescence, and to examine the impact of challenging behaviors on the caregiving experience. Parents of 34 children and adolescents with CFC completed standardized broadband measures of child emotional and behavioral functioning, as well as measures of sensory modulation, functional communication, and caregiver stress. Results indicate that children with CFC syndrome are at heightened risk for psychopathology, with attention problems, social difficulties, and unusual behaviors (e.g., obsessive thoughts, strange behaviors, repetitive acts) found to be especially prevalent. Behavioral challenges in children with CFC syndrome were significantly associated with a history of obstetric complications and with problems modulating sensory information. With regard to the impact of child neurocognitive and behavioral issues on the caregiving experience, parent self-reported stress was significantly higher among parents of children who engaged in more problem behaviors, and lower among parents whose children could communicate effectively with others. Results of this study suggest avenues to help families cope with CFC-related stressors and enhance overall functioning. In particular, this study highlights the need for educational and treatment interventions aimed at addressing sensory needs, increasing functional communication, and identifying and managing challenging behaviors. © 2016 Wiley Periodicals, Inc. PMID:27149079

  15. An assessment of alternatives for replacing Freon 113 in bench type electrical circuit board cleaning at Fermi National Accelerator Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Isakson, K.; Vessell, A.L.

    1994-07-01

    Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ``best alternatives``: Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases.

  16. An assessment of alternatives for replacing Freon 113 in bench type electrical circuit board cleaning at Fermi National Accelerator Laboratory

    International Nuclear Information System (INIS)

    Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ''best alternatives'': Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases

  17. Replacement of chlorofluorocarbons (CFCs) at the DOE Gaseous Diffusion Plants: An assessment of global impacts

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE) operates two uranium enrichment plants. Together, the two plants maintain an inventory of approximately 14 million pounds of a chlorofluorocarbon (CFC), dichlorote-trafluoroethane (CFC-114) as a coolant. Annual operational CFC-114 losses total over 500,000 pounds. In February, 1992, President Bush announced that the US would terminate manufacture and importation of Class 1 ozone depleting substances (including CFC-114) by the end of 1995. To comply with this requirement DOE has considered introducing a replacement coolant by the end of 1995. Two perfluorocarbons (PFCs) - namely, octofluoro-cyclobutane and decafluorobutane - are presently the only known coolants that could meet safety requirements. They would not contribute to stratospheric ozone depletion but contribute to global warming. The paper describes an analysis of the potential global impacts of the proposed replacement of CFC-114 with a PFC. A problem with analyses of global warming and ozone depletion impacts is that even large sources of compounds that contribute to these effects contribute only very small fractions of the total effect. The authors take the position that significant effects to global warming and ozone depletion have already occurred, and that any additional contribution to these effects are contributions to cumulatively significant adverse effects on the environment. The paper describes four alternatives and the extent to which each would contribute to global warming and ozone depletion

  18. ITER transient consequences for material damage: modelling versus experiments

    International Nuclear Information System (INIS)

    Carbon-fibre composite (CFC) and tungsten macrobrush armours are foreseen as PFC for the ITER divertor. In ITER the main mechanisms of metallic armour damage remain surface melting and melt motion erosion. In the case of CFC armour, due to rather different heat conductivities of CFC fibres a noticeable erosion of the PAN bundles may occur at rather small heat loads. Experiments carried out in the plasma gun facilities QSPA-T for the ITER like edge localized mode (ELM) heat load also demonstrated significant erosion of the frontal and lateral brush edges. Numerical simulations of the CFC and tungsten (W) macrobrush target damage accounting for the heat loads at the face and lateral brush edges were carried out for QSPA-T conditions using the three-dimensional (3D) code PHEMOBRID. The modelling results of CFC damage are in a good qualitative and quantitative agreement with the experiments. Estimation of the droplet splashing caused by the Kelvin-Helmholtz (KH) instability was performed

  19. Rapid detection of cancer related DNA nanoparticulate biomarkers and nanoparticles in whole blood

    Science.gov (United States)

    Heller, Michael J.; Krishnan, Raj; Sonnenberg, Avery

    2010-08-01

    The ability to rapidly detect cell free circulating (cfc) DNA, cfc-RNA, exosomes and other nanoparticulate disease biomarkers as well as drug delivery nanoparticles directly in blood is a major challenge for nanomedicine. We now show that microarray and new high voltage dielectrophoretic (DEP) devices can be used to rapidly isolate and detect cfc-DNA nanoparticulates and nanoparticles directly from whole blood and other high conductance samples (plasma, serum, urine, etc.). At DEP frequencies of 5kHz-10kHz both fluorescent-stained high molecular weight (hmw) DNA, cfc-DNA and fluorescent nanoparticles separate from the blood and become highly concentrated at specific DEP highfield regions over the microelectrodes, while blood cells move to the DEP low field-regions. The blood cells can then be removed by a simple fluidic wash while the DNA and nanoparticles remain highly concentrated. The hmw-DNA could be detected at a level of <260ng/ml and the nanoparticles at <9.5 x 109 particles/ml, detection levels that are well within the range for viable clinical diagnostics and drug nanoparticle monitoring. Disease specific cfc-DNA materials could also be detected directly in blood from patients with Chronic Lymphocytic Leukemia (CLL) and confirmed by PCR genotyping analysis.

  20. Potent attenuation of context fear by extinction training contiguous with acquisition

    Science.gov (United States)

    Bernier, Brian E.; Lacagnina, Anthony F.

    2015-01-01

    Studies on the behavioral mechanisms underlying contextual fear conditioning (CFC) have demonstrated the importance of preshock context exposure in the formation of aversive context memories. However, there has been comparatively little investigation of the effects of context exposure immediately after the shock. Some models predict that nonreinforced context exposure at the end of the acquisition session will strongly influence the strength of conditioning and/or recruit distinct neural mechanisms relative to extinction after acquisition. Here we investigate the effects of manipulating postshock context exposure on CFC in mice. Prolonging the period of context exposure immediately following the shock caused a significant and durable reduction in conditioned fear. This immediate postshock context exposure was more effective at attenuating conditioned fear than was an equivalent amount of context exposure a day or more after acquisition. The results suggest that nonreinforced exposure to the context influences conditioned fear through distinct mechanisms depending on whether it occurs during acquisition or after it. The superiority of immediate postshock context exposure was specific to single-shock CFC; in two-shock CFC, immediate and delayed postshock context exposure had similar effects. Consistent with previous reports, we hypothesize that the effectiveness of extinction is modulated by emotional state, and procedures engendering higher postshock freezing (such as two-shock CFC) are associated with weaker immediate extinction. PMID:25512575

  1. Radiosensitivity increases with differentiation status of murine hemopoietic progenitor cells selected using enriched marrow subpopulations and recombinant growth factors

    International Nuclear Information System (INIS)

    The radiosensitivity of populations of colony-forming cells (CFC) in murine bone marrow was investigated using different recombinant colony-stimulating factors (CSFs; murine IL-3 and granulocyte-macrophage CSF and human granulocyte CSF), or purified murine macrophage CSF. With unfractionated normal bone marrow the CFC increased in radiosensitivity as they progressed through the granulocyte lineage. The D0 values ranged from 129 +/- 12 cGy for CFC stimulated with GM-CSF down to 42 +/- 2 cGy after stimulation with G-CSF. IL-3 stimulated a CFC population which gave the only survival curve with a shoulder (n = 1.9 +/- 0.3). With semipurified populations of primitive or bipotential CFC, D0 values were generally lower with respect to the equivalent values for unpurified bone marrow (range 62 +/- 7 cGy to 135 +/- 7 cGy). Changes in cluster/colony ratio and colony morphology together possibly with products of accessory cells influence the interpretation of the radiosensitivity parameters

  2. Time orientation and eating behavior: Unhealthy eaters consider immediate consequences, while healthy eaters focus on future health.

    Science.gov (United States)

    Dassen, Fania C M; Houben, Katrijn; Jansen, Anita

    2015-08-01

    Time orientation could play an important role in eating behavior. The current study investigated whether eating behavior is associated with the Consideration of Future Consequences scale (CFC). Specifically, it was examined whether unhealthy eaters consider the future less and are more concerned with immediate gratification. A related measure of time orientation is delay discounting, a process by which a reinforcer becomes less valuable when considered later in time. Recent research argues that the relation between time orientation and health behaviors is measured best at a behavior-specific level. In the current study, we explored the relationships between CFC and discount rate - both general and food-specific - and their influence on healthy eating. Participants with ages 18 to 60 (N = 152; final sample N = 146) filled in an online questionnaire consisting of the CFC, a food-specific version of the CFC (CFC-food), the Monetary Choice Questionnaire (MCQ) and an adapted MCQ version with snack food as a reinforcer. Self-reported healthy eating was positively related to the future subscale (r = .48, p MCQ and MCQ-snack) were not related to healthy eating (all p > .05). In order to predict behavior, measurements of time orientation should thus be tailored to the behavior of interest. Based on current results, shifting one's concern from the immediate consequences of eating to a more future-oriented perspective may present an interesting target for future interventions aimed at promoting healthy eating and reducing overweight. PMID:25814191

  3. Recent sediment transport and deposition in the Cap-Ferret Canyon, South-East margin of Bay of Biscay

    Science.gov (United States)

    Schmidt, Sabine; Howa, Hélène; Diallo, Amy; Martín, Jacobo; Cremer, Michel; Duros, Pauline; Fontanier, Christophe; Deflandre, Bruno; Metzger, Edouard; Mulder, Thierry

    2014-06-01

    The Cap-Ferret Canyon (CFC), a major morphologic feature of the eastern margin of the Bay of Biscay, occupies a deep structural depression that opens about 60 km southwest of the Gironde Estuary. Detailed depth profiles of the particle-reactive radionuclides 234Th and 210Pb in interface sediments were used to characterise the present sedimentation (bioturbation, sediment mass accumulation, and focusing) in the CFC region. Two bathymetric transects were sampled along the CFC axis and the southern adjacent margin. Particle fluxes were recorded from the nearby Landes Plateau by means of sediment traps in 2006 and 2007. This dataset provides a new and comprehensive view of particulate matter transfer in the Cap-Ferret Canyon region, through a direct comparison of the canyon with the adjacent southern margin. Radionuclide profiles (234Th and 210Pb) and mass fluxes demonstrate that significant particle dynamics occur on the SE Aquitanian margin in comparison with nearby margins. The results also suggest show three distinct areas in terms of sedimentary activity. In the upper canyon (2000 m) can be considered inactive at annual or decadal scales. In contrast with the slow and continuous accumulation of relatively fresh material that characterises the middle canyon, the lower canyon receives pulses of sediment via gravity flows on longer time scales. At decadal scale, the CFC can be considered as a relatively quiescent canyon. The disconnection of the CFC from major sources of sediment delivery seems to limit its efficiency in particle transfer from coastal areas to the adjacent ocean basin.

  4. Beryllium Concentrations at European Workplaces: Comparison of 'Total' and Inhalable Particulate Measurements.

    Science.gov (United States)

    Kock, Heiko; Civic, Terence; Koch, Wolfgang

    2015-07-01

    A field study was carried out in order to derive a factor for the conversion of historic worker exposure data on airborne beryllium (Be) obtained by sampling according to the 37-mm closed faced filter cassette (CFC) 'total' particulate method into exposure concentration values to be expected when sampling using the 'Gesamtstaubprobenahmesystem' (GSP) inhalable sampling convention. Workplaces selected to represent the different copper Be work processing operations that typically occur in Germany and the EU were monitored revealing a broad spectrum of prevailing Be size distributions. In total, 39 personal samples were taken using a 37-mm CFC and a GSP worn side by side for simultaneous collection of the 'total' dust and the inhalable particulates, respectively. In addition, 20 static general area measurements were carried out using GSP, CFC, and Respicon samplers in parallel, the latter one providing information on the extra-thoracic fraction of the workplace aerosol. The study showed that there is a linear relationship between the concentrations measured with the CFC and those measured with the GSP sampler. The geometric mean value of the ratios of time-weighted average concentrations determined from GSP and CFC samples of all personal samples was 2.88. The individual values covered a range between 1 and 17 related to differences in size distributions of the Be-containing particulates. This was supported by the area measurements showing that the conversion factor increases with increasing values of the extra-thoracic fraction covering a range between 0 and 79%. PMID:25808693

  5. Chemistry of unsaturated zone gases sampled in open boreholes at the crest of Yucca Mountain, Nevada: Data and basic concepts of chemical and physical processes in the mountain

    Science.gov (United States)

    Thorstenson, Donald C.; Weeks, Edwin P.; Haas, Herbert; Busenberg, Eurybiades; Plummer, L. Niel; Peters, Charles A.

    Boreholes open to the unsaturated zone at the crest of Yucca Mountain, Nevada, were variously sampled for CO2 (including 13C and 14C), CH4, N2, O2, Ar, CFC-11, CFC-12, and CFC-113 from 1986 to 1993. Air enters the mountain in outcrops, principally on the eastern slope, is enriched in CO2 by mixing with soil gas, and is advected to the mountain crest, where it returns to the atmosphere. The CFC data indicate that travel times of the advecting gas in the shallow Tiva Canyon hydrogeologic unit are <=5 years. The 14C activities are postbomb to depths of 100 m, indicating little retardation of 14CO2 in the shallow flow systems. The 14C activities from 168 to 404 m in the Topopah Spring hydrogeologic unit are 85-90 pMC at borehole USW-UZ6. The CFC data show that the drilling of USW-UZ6 in 1984 has altered the natural system by providing a conduit through the Paintbrush Nonwelded unit, allowing flow from Topopah Spring outcrops in Solitario Canyon on the west to USW-UZ6, upward in the borehole through the Paintbrush, to the shallow Tiva Canyon flow systems, and out of the mountain.

  6. Age-distribution estimation for karst groundwater: Issues of parameterization and complexity in inverse modeling by convolution

    Science.gov (United States)

    Long, A.J.; Putnam, L.D.

    2009-01-01

    Convolution modeling is useful for investigating the temporal distribution of groundwater age based on environmental tracers. The framework of a quasi-transient convolution model that is applicable to two-domain flow in karst aquifers is presented. The model was designed to provide an acceptable level of statistical confidence in parameter estimates when only chlorofluorocarbon (CFC) and tritium (3H) data are available. We show how inverse modeling and uncertainty assessment can be used to constrain model parameterization to a level warranted by available data while allowing major aspects of the flow system to be examined. As an example, the model was applied to water from a pumped well open to the Madison aquifer in central USA with input functions of CFC-11, CFC-12, CFC-113, and 3H, and was calibrated to several samples collected during a 16-year period. A bimodal age distribution was modeled to represent quick and slow flow less than 50 years old. The effects of pumping and hydraulic head on the relative volumetric fractions of these domains were found to be influential factors for transient flow. Quick flow and slow flow were estimated to be distributed mainly within the age ranges of 0-2 and 26-41 years, respectively. The fraction of long-term flow (>50 years) was estimated but was not dateable. The different tracers had different degrees of influence on parameter estimation and uncertainty assessments, where 3H was the most critical, and CFC-113 was least influential.

  7. Flow Boiling of Pure and Oil Contaminated Carbon Dioxide as Refrigerant

    DEFF Research Database (Denmark)

    Mohamed, A.-R. Mohamed

    2003-01-01

    The refrigerant mostly use until now (CFC, HCFC and HFC refrigerant) has a negative influence on the environment and therefore it is wanted to find alternative refrigerant without any negative influence on the environment. A change to natural refrigerant like Carbon Dioxide (CO2) is therefore of...... high reduced pressure with CO2 compared to the reduced pressure using CFC, HCFC and HFC. CO2 has greater heat conductivity than CFC, HCFC and HFC so the influence of oil in the refrigeration system is expected to have a greater influence on the system performance. The main result of the project...... 40 kW/m2 and evaporation temperature from -10°C to -35°C corresponding to a reduced pressure between0.35 and .16. The conclusion from the measurements is that oil gives a reduction in heat transfer coefficient compared to pure CO2. The reduction in heat transfer coefficient is greater at high...

  8. Experimental Realization of High-Efficiency Counterfactual Computation

    Science.gov (United States)

    Kong, Fei; Ju, Chenyong; Huang, Pu; Wang, Pengfei; Kong, Xi; Shi, Fazhan; Jiang, Liang; Du, Jiangfeng

    2015-08-01

    Counterfactual computation (CFC) exemplifies the fascinating quantum process by which the result of a computation may be learned without actually running the computer. In previous experimental studies, the counterfactual efficiency is limited to below 50%. Here we report an experimental realization of the generalized CFC protocol, in which the counterfactual efficiency can break the 50% limit and even approach unity in principle. The experiment is performed with the spins of a negatively charged nitrogen-vacancy color center in diamond. Taking advantage of the quantum Zeno effect, the computer can remain in the not-running subspace due to the frequent projection by the environment, while the computation result can be revealed by final detection. The counterfactual efficiency up to 85% has been demonstrated in our experiment, which opens the possibility of many exciting applications of CFC, such as high-efficiency quantum integration and imaging.

  9. Lesion-symptom mapping of a complex figure copy task: A large-scale PCA study of the BCoS trial.

    Science.gov (United States)

    Chen, Haobo; Pan, Xiaoping; Lau, Johnny King Lam; Bickerton, Wai-Ling; Pradeep, Boddana; Taheri, Maliheh; Humphreys, Glyn; Rotshtein, Pia

    2016-01-01

    Complex figure copying is a commonly used neuropsychological test. Here we explored the neural basis of the factors underlying complex figure copying (CFC), using data from the Birmingham Cognitive Screen (BCoS) in a large group of sub-acute, ischemic stroke patients (239). We computed two analyses: in the first we assessed the contribution of co-morbid deficits (i.e. in gesture processing, object use, visual neglect, pictures naming and sustained attention) to the lesions associated with CFC. In a second analysis a Principle Component Analysis (PCA) was used to isolate different underlying task components and to link to clinical neuroimaging scans. A voxel-based morphometry (VBM) analysis showed that poor CFC performance was associated with lesions to bi-lateral thalamus, lingual, right fusiform and right inferior parietal cortices (rIPC). The latter association with the posterior parietal cortex was diminished after controlling for neglect. Follow up analysis showed the neglect partially mediated the correlation of CFC and rIPC. The PCA revealed three main underlying components: (1) a component associated with high-level motor control common to different measures of apraxia and linked to the left postcentral gyrus, the right thalamus and middle frontal gyrus; (2) a visuo-motor transformation component unique to the CFC and associated with lesions to the posterior occipital and sensory cortices; (3) a component associated with multistep object use tasks which was correlated with lesions to the left inferior frontal orbital gyrus, the right fusiform and cerebellum. Using clinical symptoms, cognitive profiles and lesion mapping we showed that beyond visual perception, CFC performance is supported by three functional networks: one for high-level motor control, a visuo-motor transformation component, and multistep object use network. PMID:27182489

  10. Monoclonal origin of B lymphocyte colony-forming cells in spleen colonies formed by multipotential hemopoietic stem cells

    Science.gov (United States)

    Lala, PK; Johnson, GR

    1978-01-01

    Spleen colonies produced by transplanting lethally irradiated mice with either 12 day fetal liver or adult bone marrow cells were found to contain B- lymphocyte colony-forming cells (BL-CFC) . The proportion of BL-CFC positive spleen colonies did not increase substantially between 8 and 14 days after transplantation, the range being 18-45 percent. However, the absolute number of BL-CFC per spleen colony varied considerably (between 1 and 10,318), although the majority of colonies contained less than 200 BL-CFC. Irrespective of the time after transplantation, smaller spleen colonies were found to have a higher frequency of BL-CFC than larger spleen colonies. To determine the possible clonal origin of BL-CFC from spleen colony- forming unit (CFU-S), CBA mice were injected with equal numbers of CBA and CBA T(6)/T(6) fetal liver or adult bone marrow cells. Analysis of 7-15-day spleen colonies demonstrated that 90 percent were either exclusively T(6) positive or T(6) negative and approximately equal numbers ofboth colony types were observed. B-lymphocyte colonies were grown and successfully karyotyped from 19 spleen colonies. When compared with the original spleen colony karyotype the B-lymphocyte colony cells karyotype was identical in all 19 cases. In 3 of the 19 colonies analyzed a mixture of T(6) positive and T(6) negative karyotypes was present and identical proportions of the karyotypes were present in the pooled B-lymphocyte colony cells and spleen colony cells. The data indicate that the B-lymphocyte colony-forming cells detected in spleen colonies are genuine members of the hemopoietic clone derived from the initiating hemopoietic stem cell (CFU-S). PMID:309918

  11. Lesion-symptom mapping of a complex figure copy task: A large-scale PCA study of the BCoS trial

    Science.gov (United States)

    Chen, Haobo; Pan, Xiaoping; Lau, Johnny King Lam; Bickerton, Wai-Ling; Pradeep, Boddana; Taheri, Maliheh; Humphreys, Glyn; Rotshtein, Pia

    2016-01-01

    Complex figure copying is a commonly used neuropsychological test. Here we explored the neural basis of the factors underlying complex figure copying (CFC), using data from the Birmingham Cognitive Screen (BCoS) in a large group of sub-acute, ischemic stroke patients (239). We computed two analyses: in the first we assessed the contribution of co-morbid deficits (i.e. in gesture processing, object use, visual neglect, pictures naming and sustained attention) to the lesions associated with CFC. In a second analysis a Principle Component Analysis (PCA) was used to isolate different underlying task components and to link to clinical neuroimaging scans. A voxel-based morphometry (VBM) analysis showed that poor CFC performance was associated with lesions to bi-lateral thalamus, lingual, right fusiform and right inferior parietal cortices (rIPC). The latter association with the posterior parietal cortex was diminished after controlling for neglect. Follow up analysis showed the neglect partially mediated the correlation of CFC and rIPC. The PCA revealed three main underlying components: (1) a component associated with high-level motor control common to different measures of apraxia and linked to the left postcentral gyrus, the right thalamus and middle frontal gyrus; (2) a visuo-motor transformation component unique to the CFC and associated with lesions to the posterior occipital and sensory cortices; (3) a component associated with multistep object use tasks which was correlated with lesions to the left inferior frontal orbital gyrus, the right fusiform and cerebellum. Using clinical symptoms, cognitive profiles and lesion mapping we showed that beyond visual perception, CFC performance is supported by three functional networks: one for high-level motor control, a visuo-motor transformation component, and multistep object use network. PMID:27182489

  12. Outgassing of plasma facing antenna front for lower hybrid wave launcher

    Energy Technology Data Exchange (ETDEWEB)

    Maebara, Sunao E-mail: maebara@felsunl.tokai.jaeri.go.jp; Goniche, Marc; Kazarian, Fabienne; Seki, Masami; Ikeda, Yoshitaka; Imai, Tsuyoshi; Bibet, Philippe; Froissard, Philippe; Rey, Guy

    2000-11-01

    A 3.7 GHz mock-up antenna module using carbon fiber composite (CFC) was fabricated and tested for the development of a heat-resistive front of the lower hybrid current drive (LHCD) antenna. This module has four waveguides and a water cooling channel, the length is 206 mm. The CFC surface was coated with a thin titanium layer and was plated with copper in order to reduce RF losses, to bond rods and septum plates and to assemble them with cooling channel. The RF losses and the outgassing rates of this CFC module at high RF power were measured during long pulses. When the injected power varies between 30 and 100 kW, the RF losses measured by calorimetery, were found to be in the range of 1.0-1.2%. It is found that this experimental value is 2.5-3.0 times higher than the theoretical value of pure copper. Stationary operation of the CFC module with water cooling is performed at the RF power density of 45 MW m{sup -2} during 1000 s. The outgassing rates from the CFC module are in the range of 0.93{approx}1.3x10{sup -6} Pam{sup -3} s{sup -1} m{sup -2} at the module temperature of 120 deg. C, it is low enough for an antenna material. No significant bonding defects occurred during the steady-state operation. It is assessed that a CFC module is an attractive candidate for a heat-resistive front of LHCD antenna.

  13. Transport and mixing in the Tropical Tropopause Layer

    OpenAIRE

    Homan, Carine

    2011-01-01

    The TTL is the transition layer between the tropical troposphere and stratosphere, and is the main region where tropospheric air enters the stratosphere. In this thesis different transport processes are studied by using in situ measurements of tracers. Long-lived tracers were measured with the High Altitude Gas Analyzer (HAGAR) on board the M55 Geophysica aircraft. The instrument was developed by the University of Frankfurt and measures the long-lived tracers CO2, N2O, CFC-12, CFC-11, H-1211,...

  14. Impacts of greenhouse gases and aerosol direct and indirect effects on clouds and radiation in atmospheric GCM simulations of the 1930-1989 period

    OpenAIRE

    Quaas, Johannes; Dufresne, Jean-Louis; Boucher, Olivier; Le Treut, Hervé

    2015-01-01

    Among anthropogenic perturbations of the Earth\\'s atmosphere, greenhouse gases and aerosols are considered to have a major impact on the energy budget through their impact on radiative fluxes. We use three ensembles of simulations with the LMDZ general circulation model to investigate the radiative impacts of five species of greenhouse gases (CO2, CH4, N2O, CFC-11 and CFC-12) and sulfate aerosols for the period 1930-1989. Since our focus is on the atmospheric changes in clouds and radiation f...

  15. Ultrasonic test of carbon composite/copper joints in the ITER divertor

    International Nuclear Information System (INIS)

    Highlights: • ENEA developed and tested a specimen for the simulation of defects at the interface between CFC and copper. • The use of an ultrasonic technique properly set permitted to highlight and size with high accuracy the defects. • The technology developed could be employed successfully in the production of these components for high heat flux applications. -- Abstract: The vertical targets of the ITER divertor consist of high flux units (HFU) actively cooled: CuCrZr tubes armoured by tungsten and carbon/carbon fibre composite (CFC). The armour is obtained with holed parallelepiped blocks, called monoblocks, previously prepared and welded onto the tubes by means diffusion bonding. The monoblock preparation consists in the casting of a layer of copper oxygen free (Cu OFHC) inside the monoblock hole. Each HFU is covered with more than 100 monoblocks that have to be joined simultaneously to the tube. Therefore, it is very important to individuate any defects present in the casting of Cu OFHC or at the interface with the CFC before the monoblocks are installed on the units. This paper discusses the application of non-destructive testing by ultrasound (US) method for the control of the joining interfaces between CFC monoblocks and Cu OFHC, before the brazing on the CrCrZr tube. In ENEA laboratory an ultrasonic technique (UT) suitable for the control of these joints with size and geometry according to the ITER specifications has been developed and widely tested. Real defects in this type of joints are, however, still hardly detected by UT. The CFC surface has to be machined to improve the mechanical strength of the joint. This results in a surface not perpendicular to the ultrasonic wave. Moreover, CFC is characterized by high acoustic attenuation of the ultrasonic wave and then it is not easy to get information regarding the Cu/CFC bonding. Nevertheless, the UT sharpness and simplicity pushes to perform some further study. With this purpose, a sample with

  16. Improvement of the SCC resistance of FCC alloys: influence of pre-fatigue on the SCC resistance of the austenitic stainless steel-316L in a MgCl{sub 2} boiling solution at 117 deg C; Recherche d'une amelioration du comportement en CSC d'alliages de structure CFC: influence d'une pre-deformation en fatigue oligocyclique sur le comportement en CSC de l'acier inoxydable austenitique 316L dans une solution bouillante de MgCl{sub 2} a 117 deg C

    Energy Technology Data Exchange (ETDEWEB)

    Curiere, I. de

    2000-12-01

    The aim of this study is to analyse the effect of pre-fatigue of FCC materials on their mechanical and electrochemical response to better understand and delay the SCC damage. The material/environment couple tested is the 316L polycrystalline austenitic stainless steel in boiling MgCl{sub 2} at 30% mass. Samples are pre-strained in low cycle fatigue under plastic strain control, with a p/2 value of 0.4%, for various number of cycles (25%, 75% and at the number of cycles to reach saturation during pre-fatigue). It was found that only pre-fatigue at saturation improves the SCC resistance of the material, both on SSRT and constant load tests. A delayed crack initiation up to 10% of strain. which increases strain to failure by half. mostly accounts for this beneficial effect, during SSRT tests. Furthermore, other pre-straining only resulted in loss of strain to fracture and no delay in crack initiation. We related the crack initiation delay to the surface strain state due to pre-fatigue. It provides fine parallel slip bands. homogeneously located at the surface of the samples. This surface state induces an increasing anodic surface-cathodic surface ratio which lowers the kinetics of localised corrosion. thus that of crack initiation. We also show some experiments implying that pre-fatigue at saturation decreases the SCC crack growth velocity which can be understood through the CEP (Corrosion Enhanced Plasticity) Model. We also show that this beneficial effect is probably available on other fcc material/environment couples, such as OFHC Cu/ 1 M NaNO{sub 2} at pH 9. (author)

  17. Potent Attenuation of Context Fear by Extinction Training Contiguous with Acquisition

    Science.gov (United States)

    Bernier, Brian E.; Lacagnina, Anthony F.; Drew, Michael R.

    2015-01-01

    Studies on the behavioral mechanisms underlying contextual fear conditioning (CFC) have demonstrated the importance of preshock context exposure in the formation of aversive context memories. However, there has been comparatively little investigation of the effects of context exposure immediately after the shock. Some models predict that…

  18. COP improvement of refrigerator/freezers, air-conditioners, and heat pumps using nonazeotropic refrigerant mixtures

    Science.gov (United States)

    Westra, Douglas G.

    1993-01-01

    With the February, 1992 announcement by President Bush to move the deadline for outlawing CFC (chloro-fluoro-carbon) refrigerants from the year 2000 to the year 1996, the refrigeration and air-conditioning industries have been accelerating their efforts to find alternative refrigerants. Many of the alternative refrigerants being evaluated require synthetic lubricants, are less efficient, and have toxicity problems. One option to developing new, alternative refrigerants is to combine existing non-CFC refrigerants to form a nonazeotropic mixture, with the concentration optimized for the given application so that system COP (Coefficient Of Performance) may be maintained or even improved. This paper will discuss the dilemma that industry is facing regarding CFC phase-out and the problems associated with CFC alternatives presently under development. A definition of nonazeotropic mixtures will be provided, and the characteristics and COP benefits of nonazeotropic refrigerant mixtures will be explained using thermodynamic principles. Limitations and disadvantages of nonazeotropic mixtures will be discussed, and example systems using such mixtures will be reviewed.

  19. Using Water To Analyze Greasy Residues

    Science.gov (United States)

    Hoppesch, Charles W.

    1994-01-01

    Water found useful as substitute for chlorofluorocarbon (CFC) solvents in tests to measure amounts of nonvolatile residues of contaminants (e.g., hydrocarbon greases) on equipment after it has been cleaned. Water does not harm environment and much cheaper than CFCs.

  20. TRENDS 1991: A compendium of data on global change

    International Nuclear Information System (INIS)

    This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO2) and methane (CH4), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N2) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N2O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO2 emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO2 emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center

  1. Situation and perspectives in refrigerating and air-conditioning. The point of view of Elf Atochem; Situation et perspectives en refrigeration et air conditionne. Point de vue d`Elf Atochem

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This paper is a series of transparencies which explains the engagements of Elf Atochem company in the replacement of chlorofluorocarbons (CFCs): development of HFCs, production of FORANE, safety and environmental criteria, main refrigerants and their application in new installations, perspectives in reconversion, replacement of R-22, CFC-12 and R-502 fluids with respect to their applications. (J.S.)

  2. 5 CFR 950.201 - National/international eligibility.

    Science.gov (United States)

    2010-01-01

    ....201 Section 950.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) SOLICITATION OF FEDERAL CIVILIAN AND UNIFORMED SERVICE PERSONNEL FOR CONTRIBUTIONS TO... accordance with these regulations. The Charity List will include each organization's CFC code and...

  3. Procedural pain in children with Cystic Fibrosis: an international survey on the methods used by CF centres to prevent and reduce it

    DEFF Research Database (Denmark)

    Festini, Filippo; Bregnballe, Vibeke

    2006-01-01

    Procedural pain is an additional burden for children with CE If not adequately prevented and treated procedural pain may result in anxiety and fear bound to the visits at the CF Centre (CFC) and it may affect patients' future compliance to treatments. Aim: To collect data on what CFCs in the world...

  4. The technical viability of alternative blowing agents in polyisocyanurate roof insulation: A cooperative industry/government project

    Energy Technology Data Exchange (ETDEWEB)

    Christian, J.E.; Courville, G.E.; Desjarlais, A.O.; Graves, R.S.; Linkous, R.L.; McElroy, D.L.; Weaver, F.J.; Wendt, R.L.; Yarbrough, D.W.

    1993-06-01

    This report is a summary of the cooperative industry/government program to establish the viability of alternative blowing agents to chlorofluorocarbons (CFCs). The project was initiated in 1989 following two workshops that focused on needed research on thermal insulation blown with substitutes for CFC-11 and CFC-12. The project is directed by a steering committee of representatives of the sponsors and of Oak Ridge National Laboratory (ORNL). The purpose of the project is to determine if the performance of polyisocyanurate (PIR) roof insulation foam boards blown with alternate agents differs from the performance of boards blown with CFC-1. This report describes apparent thermal conductivity (k) results obtained from field and laboratory tests from 1989 to 1992 on a set of experimental PIR laminate boardstock produced to evaluate the viability of alternative hydrochlorofluorocarbons (HCFCs) as blowing agents. All boardstock was manufactured from similar formulations that were not optimized for thermal performance. Commercial broadstock made in the future may differ in performance from this set. The PIR boards were prepared with CFC-11, HCFC-123, HCFC-141b, and 50/50 and 65/35 blends of HCFC-123/HCFC-141b.

  5. 铆钉联接

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    A new approach to hybrid front-end systems;A versatile riveting system for metal/CFC structures;Achieving low-porosity laser welds in aerospace aluminium alloy;Affordable reconfigurable tooling;;Design and evaluation of novel composite aircraft repairs;Enhancement of fatigue life of self-piercing riveted joints by coining……

  6. PERFORMANCE OF HYDROCARBONS IN A HOUSEHOLD REFRIGERATOR/FREEZER

    Science.gov (United States)

    The paper discusses the performance of hydrocarbons in a household refrigerator/freezer (R/F). t focuses on the utilization of specific hydrocarbons (propane and isobutane) as drop-in replacements for CFC-12 in household R/Fs. esults, from this experimental work can be extrapolat...

  7. An evaluation on the environmental consequences of residual CFCs from obsolete household refrigerators in China

    International Nuclear Information System (INIS)

    Chlorofluorocarbons (CFCs) contained in household refrigerators consist mainly of CFC-11 and CFC-12, which will be eventually released into the environment. Consequentially, environmental releases of these refrigerants will lead to ozone depletion and contribute significantly to the greenhouse effect, if waste refrigerators are not disposed of properly. In the present paper, the potential release of residual CFCs and their substitutes from obsolete household refrigerators in China is examined, and their contributions to ozone depletion and greenhouse effect are compared with those of other recognized ozone-depleting substances (ODS) and greenhouse gases (GHGs). The results imply that annual potential amounts of released residual CFC-11 and CFC-12 will reach their maximums at 4600 and 2300 tons, respectively in 2011, and then decrease gradually to zero until 2020. Meanwhile, the amounts of their most widely used substitutes HCFC-141b and HFC-134a will keep increasing. Subsequently, the contribution ratio of these CFCs and their substitutes to ozone depletion will remain at 25% through 2011, and reach its peak value of 34% by 2018. The contribution to greenhouse effect will reach its peak value of 0.57% by 2010. Moreover, the contribution ratio of these CFCs to the total global release of CFCs will steadily increase, reaching its peak of 15% by 2018. Thus, this period from 2010 to 2018 is a crucial time during which residual CFCs and their substitutes from obsolete household refrigerators in China will contribute significantly to ozone depletion.

  8. 40 CFR Appendix B to Subpart G of... - Substitutes Subject to Use Restrictions and Unacceptable Substitutes

    Science.gov (United States)

    2010-07-01

    .... Additional Comments 1—Must conform with OSHA 29 CFR 1910 Subpart L Section 1910.160 of the U.S. Code. You..., 5. Additional comments: 1—Must conform with relevant OSHA requirements, including 29 CFR 1910... safely in this end-use. CFC-12 Household Refrigerators (Retrofit and New Equipment/NIKs)...

  9. 26 CFR 1.952-1 - Subpart F income defined.

    Science.gov (United States)

    2010-04-01

    ... limitation deficit=50u reduction). All of CFC's post-1986 foreign income taxes with respect to passive... had not been repealed by the Tax Reduction Act of 1975) in computing a minimum distribution, for any...-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME...

  10. Non-destructive methods for the defect detection in the ITER high heat flux components

    Energy Technology Data Exchange (ETDEWEB)

    Roccella, S., E-mail: selanna.roccella@enea.it [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy); Burrasca, G.; Cacciotti, E. [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy); Castillo, A. [Associazione Euratom-ENEA sulla Fusione, C.R.Casaccia, Via Anguillarese 301-00123 S. Maria di Galeria, RM (Italy); Universidad Politecnica de Valencia, Valencia (Spain); Mancini, A.; Pizzuto, A. [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy); Tati, A. [Associazione Euratom-ENEA sulla Fusione, C.R.Casaccia, Via Anguillarese 301-00123 S. Maria di Galeria, RM (Italy); Visca, E. [Associazione ENEA-Euratom sulla Fusione C.R.Frascati - 00044-Frascati, RM (Italy)

    2011-10-15

    This paper discusses the application of non-destructive testing (NDT) by ultrasonic technique for the control of the joining interfaces of the ITER divertor vertical target plasma facing units. The defect detection capability has to be proved for both metal to metal and metal to carbon/carbon fibre composite (CFC) joints because these two types of joints have to be realized for the manufacturing of the high heat flux units. In this paper the UT results coming from the investigation performed during the manufacturing, but also after the thermal fatigue testing (up to 20 MW/m{sup 2}) of six mock-ups manufactured using the Hot Radial Pressure technology (HRP) in ENEA labs are presented and compared with the evidences from the final destructive examination. Regarding the Cu/CFC joint, the effectiveness of the ultrasonic test has been deeply studied due to the high acoustic attenuation of CFC to ultrasonic waves. To investigate the possibility to use the ultrasonic technique for this type of joint, an 'ad hoc' flat Cu/CFC joint sample, that reproduces the actual annular joint interfaces, was manufactured. This flat sample has the advantage of being easily tested by probes with different geometry and frequency. UT results are compared with X-ray and eddy current testing of the same sample.

  11. 3F: A Leading Fluorine Chemical Company

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Shanghai 3F New Materials Co., Ltd.(3F, SH: 600636) is a company mainlyengaged in the research, development,production and operation of fluorine-containing materials. It owns a complete fluorine chemical industrial chain.Products include CFCs, CFC substitutes,fluorine-containing polymers and fluo-rine-containing fine chemicals.

  12. Question No. 5: What Role Can Satellites Take, as a Complement to Ground Based Measurement Systems, to Provide Sustained Observations to Monitor GHG Emissions?

    Science.gov (United States)

    Chahine, Moustafa; Olsen, Edward

    2011-01-01

    What role can satellites take, as a complement to ground based measurement systems, to provide sustained observations to monitor GHG emissions (e.g., CO2, CH4, O3, N2O, CFC s, NH3, and NF3) that contribute to global warming?

  13. Using a Hybrid Approach to Facilitate Learning Introductory Programming

    Science.gov (United States)

    Cakiroglu, Unal

    2013-01-01

    In order to facilitate students' understanding in introductory programming courses, different types of teaching approaches were conducted. In this study, a hybrid approach including comment first coding (CFC), analogy and template approaches were used. The goal was to investigate the effect of such a hybrid approach on students' understanding in…

  14. 76 FR 40850 - Glymes; Proposed Significant New Use Rule

    Science.gov (United States)

    2011-07-12

    ... diglyme in printing inks is less certain, but any additional use would increase the existing exposure to... used as a solvent in printing inks for consumer products and industrially as a solvent in a variety of... consumer printing inks, as a coalescing agent in consumer paints, and as an HFC/CFC lubricant which may...

  15. 26 CFR 4.954-2 - Foreign personal holding company income; taxable years beginning after December 31, 1986.

    Science.gov (United States)

    2010-04-01

    ... holding that gold in physical form for sale to customers. During taxable year 3, CFC sells the entire 1000... quarter of the current taxable year if the activities connected with its use or exploitation are conducted... in part in other countries. If the activities connected with the use or exploitation of an item...

  16. Non-destructive methods for the defect detection in the ITER high heat flux components

    International Nuclear Information System (INIS)

    This paper discusses the application of non-destructive testing (NDT) by ultrasonic technique for the control of the joining interfaces of the ITER divertor vertical target plasma facing units. The defect detection capability has to be proved for both metal to metal and metal to carbon/carbon fibre composite (CFC) joints because these two types of joints have to be realized for the manufacturing of the high heat flux units. In this paper the UT results coming from the investigation performed during the manufacturing, but also after the thermal fatigue testing (up to 20 MW/m2) of six mock-ups manufactured using the Hot Radial Pressure technology (HRP) in ENEA labs are presented and compared with the evidences from the final destructive examination. Regarding the Cu/CFC joint, the effectiveness of the ultrasonic test has been deeply studied due to the high acoustic attenuation of CFC to ultrasonic waves. To investigate the possibility to use the ultrasonic technique for this type of joint, an 'ad hoc' flat Cu/CFC joint sample, that reproduces the actual annular joint interfaces, was manufactured. This flat sample has the advantage of being easily tested by probes with different geometry and frequency. UT results are compared with X-ray and eddy current testing of the same sample.

  17. InterProScan Result: CK523618 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK523618 CK523618_6_ORF1 9340A0F489CFC86C PANTHER PTHR18866 CARBOXYLASE:PYRUVATE/AC...ETYL-COA/PROPIONYL-COA CARBOXYLASE 2.1e-14 T IPR005482 unintegrated Molecular Function: ligase activity (GO:0016874) ...

  18. Water filtration of the forearm in short- and long-term diabetes mellitus

    DEFF Research Database (Denmark)

    Poulsen, H L; Nielsen, S L

    1976-01-01

    Blood flow and capillary filtration coefficient (CFC) were measured by strain-gauge plethysmography on the upper and lower third of the forearm in 9 normal subjects and 29 well regulated patients with diabetes mellitus of varying duration (less than 10 years, 10 to 20 years, and more than 20 years...

  19. Thermal simulation and analysis of flat surface flip-chip high power light-emitting diodes

    International Nuclear Information System (INIS)

    Conventional GaN-based flip-chip light-emitting diodes (CFC-LEDs) use Au bumps to contact the LED chip and Si submount, however the contact area is constrained by the number of Au bumps, limiting the heat dissipation performance. This paper presents a flat surface high power GaN-based flip-chip light emitting diode (SFC-LED), which can greatly improve the heat dissipation performance of the device. In order to understand the thermal performance of the SFC-LED thoroughly, a 3-D finite element model (FEM) is developed, and ANSYS is used to simulate the thermal performance. The temperature distributions of the SFC-LED and the CFC-LED are shown in this article, and the junction temperature simulation values of the SFC-LED and the CFC-LED are 112.80 °C and 122.97 °C, respectively. Simulation results prove that the junction temperature of the new structure is 10.17 °C lower than that of the conventional structure. Even if the CFC-LED has 24 Au bumps, the thermal resistance of the new structure is still far less than that of the conventional structure. The SFC-LED has a better thermal property. (semiconductor devices)

  20. Principals' Sensemaking of Coaching for Ambitious Reading Instruction in a High-Stakes Accountability Policy Environment

    Science.gov (United States)

    Matsummura, Lindsay Clare; Wang, Elaine

    2014-01-01

    In the present exploratory qualitative study we examine the contextual factors that influenced the implementation of a multi-year comprehensive literacy-coaching program (Content-Focused Coaching, CFC). We argue that principals' sensemaking of the dialogic instructional strategies promoted by the program in light of high-stakes accountability…

  1. Extreme 13C depletion of CCl2F2 in firn air samples from NEEM, Greenland

    Directory of Open Access Journals (Sweden)

    T. Blunier

    2012-07-01

    Full Text Available A series of 12 high volume air samples collected from the S2 firn core during the North Greenland Eemian Ice Drilling (NEEM 2009 campaign have been measured for mixing ratio and stable carbon isotope composition of the chlorofluorocarbon CFC-12 (CCl2F2. While the mixing ratio measurements compare favorably to other firn air studies, the isotope results show extreme 13C depletion at the deepest measurable depth (65 m, to values lower than δ13C = −80‰ vs. VPDB (the international stable carbon isotope scale, compared to present day surface tropospheric measurements near −40‰. Firn air modeling was used to interpret these measurements. Reconstructed atmospheric time series indicate even larger depletions (to −120‰ near 1950 AD, with subsequent rapid enrichment of the atmospheric reservoir of the compound to the present day value. Mass-balance calculations show that this change must have been caused by a large change in the isotopic composition of anthropogenic CFC-12 emissions, probably due to technological changes in the CFC production process over the last 80 yr. Propagating the mass-balance calculations into the future demonstrates that as emissions decrease to zero, isotopic fractionation by the stratospheric sinks will lead to continued 13C enrichment in atmospheric CFC-12.

  2. HEAT TRANSFER EVALUATION OF HFC-236FA IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...

  3. Effects of cadmium on haemopoiesis in irradiated and non-irradiated mice: 1. Relationship to the number of myeloid progenitor cells

    International Nuclear Information System (INIS)

    The effects of a single subcutaneous injection of cadmium chloride on hemopoiesis in normal (non-irradiated) or irradiated mice were investigated. The cadmium doses ranged from 1 to 8 mg/kg body weight. Twenty-four hours after treatment with cadmium (3 to 8 mg/kg) there were no significant changes in the bone marrow cellularity or the granulocyte-macrophage progenitor cell (GM-CFC) number per femur in non-irradiated female ICR mice. Similarly, during the 30-day postinjection period, the bone marrow cellularity and marrow GM-CFC number in mice treated with a cadmium dose of 5 mg/kg were not significantly different from the control values. Cadmium reduced the lethal effects of gamma rays significantly. In addition, increasing the doses of cadmium administered 24 h prior to sublethal irradiation increased the number of endogenous hemopoietic stem cells (endoCFU-S) in a concentration-dependent manner. Pretreatment with cadmium also decreased the radiation damage to endoCFU-S and hemopoietic progenitor cells committed to granulocyte/macrophage development (GM-CFC). The survival of stem cells was higher and the regeneration of cellularity and GM-CFC of irradiated bone marrow was accelerated in mice pretreated with 5 mg Cd/kg body weight in comparison with saline-injected mice. 1 tab., 7 figs., 28 refs

  4. 40 CFR Appendix I to Subpart A of... - Global Warming Potentials (Mass Basis), Referenced to the Absolute GWP for the Adopted Carbon...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Global Warming Potentials (Mass Basis..., App. I Appendix I to Subpart A of Part 82—Global Warming Potentials (Mass Basis), Referenced to the... formula Global warming potential (time horizon) 20 years 100 years 500 years CFC-11 CFCl3 5000 4000...

  5. TRENDS 1991: A compendium of data on global change

    Energy Technology Data Exchange (ETDEWEB)

    Boden, T.A.; Sepanski, R.J.; Stoss, F.W. (eds.)

    1991-12-01

    This document is a source of frequently used global-change data. This second issue of the Trends series expands the coverage of sites recording atmospheric concentrations of carbon dioxide (CO{sub 2}) and methane (CH{sub 4}), and it updates records reported in the first issue. New data for other trace atmospheric gases have been included in this issue; historical data on nitrous oxide (N{sub 2}) from ice cores, modern records of atmospheric concentrations of chlorofluorocarbons (CFC-11 and CFC-12) and N{sub 2}O, and estimates of global estimates of CFC-11 and CFC-12. The estimates for global and national CO{sub 2} emissions from the burning of fossil fuels, the production of cement, and gas flaring have been revised and updated. Regional CO{sub 2} emission estimates have been added, and long-term temperature records have been updated and expanded. Data records are presented in four- to six-page formats, each dealing with a specific site, region, or emissions species. The data records include tables and graphs; discussion of methods for collecting, measuring, and reporting the data; trends in the data; and references to literature that provides further information. All data appearing in the document are available on digital media from the Carbon Dioxide Information Analysis Center.

  6. Are New Technologies Safe?

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen

    2004-01-01

    The question is raised to what extend new technologies should - before released on the market - be subjected to a principle of precaution, including the relevance of the product. The issue is illustrated by examples from the past like asbestos and CFC gasses, as well as new cases like mobile phon...

  7. Ozone depletion and skin cancer incidence: an integrated modelling approach

    NARCIS (Netherlands)

    Slaper H; den Elzen MGJ; de Woerd HJ; de Greef J

    1992-01-01

    A decrease in stratospheric ozone, probably caused by chlorofluorocarbon (CFC) emissions, has been observed over large parts of the globe. The incidence of skin cancer is expected to increase due to ozone depletion. An integrated source-risk model is developed and applied to evaluate the increased

  8. Milieurapportage 1993. II. Integratierapport, 'Aantasting ozonlaag en blootstelling UV'

    NARCIS (Netherlands)

    Aben JMM; Aldenkamp FJ; Bordewijk JA; Eggink GJ; Garssen J; Heij GJ; van Liere L; van Loveren H; Matthijsen AJCM; Olivier JGJ; Pruppers MJM; Reinen H; Slaper H; Thomas R; Veen A; Verweij W; van der Woerd H; LLO; LSO; PAT; LWD; LAE

    1994-01-01

    The report deals with compounds which are known or supposed to deplete the stratospheric ozone layer (such as CFC's). The entire chain is discussed, starting with production and emission of these compounds. Emissions are followed by dispersion in the atmosphere which results in depletion of t

  9. 10 CFR 300.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... means, with respect to a small emitter, any single category of anthropogenic production, consumption or... fossil fuels or other materials, such as HFC leaks from refrigeration, SF6 from electrical power..., C6F14) (6) Sulfur hexafluoride (SF6) (7) Chlorofluorocarbons (CFC-11 , CCl2F2, CClF3, CCl2FCClF2,...

  10. Characterisation of the aggregation behaviour in a salmeterol and fluticasone propionate inhalation aerosol system.

    Science.gov (United States)

    Michael, Y; Snowden, M J; Chowdhry, B Z; Ashurst, I C; Davies-Cutting, C J; Riley, T

    2001-06-19

    The nature of the drug-drug aggregation phenomena between salmeterol xinafoate and fluticasone propionate used in a metered-dose inhaler system has been examined. Interactions between the drugs in the solvents 1,1,2-trichlorotrifloroethane (CFC-113) and 1,1,1,2-tetrafluoroethane (HFA-134a) have been characterised using a focused beam reflectance measurement probe by measuring the average floc size of the drug particles individually and in combination as a function of stirrer rate. The floc composition in the CFC-113 system, where the drug particles cream, was determined by high-performance liquid chromatography analysis. The aggregation behaviour of the individual drugs was shown to depend on the physical and chemical properties of both the drug substance and the media. Larger flocs were observed for salmeterol xinafoate compared with fluticasone propionate, while both drugs formed larger aggregates in HFA-134a compared with in CFC-113. The floc composition studies demonstrated that, in the combined formulation in CFC-113, salmeterol xinafoate and fluticasone propionate aggregate together to form hetero-flocs. The interaction between the two drugs was such that they did not separate on creaming, despite having different densities. The average floc size of the combined drug suspension was also found to depend on the dispersion medium. PMID:11397578

  11. Effects of drugs inhibiting prostaglandin or leukotriene biosynthesis on postirradiation haematopoiesis in mouse

    Energy Technology Data Exchange (ETDEWEB)

    Kozubik, A.; Hofmanova, J.; Pospisil, M.; Netikova, J.; Hola, J.; Lojek, A. (Ceskoslovenska Akademie Ved, Brno (Czech Republic). Biofysikalni Ustav)

    1994-03-01

    Two non-steroidal anti-inflammatory drugs, i.e. indomethacin (INDO), an inhibitor of prostaglandin production, and esculetin (ESCUL), an inhibitor of leukotriene production, were tested for their ability to modify haematopoiesis in three experimental systems: (a) in vitro clonal proliferation of marrow GM-CFC from the irradiated mouse was found to be augmented by addition of INDO at a low concentration, and inhibited by ESCUL in a dose-dependent manner; (b) in the lethally irradiated and bone marrow-transplanted mice treated with the drugs in the postirradiation period, stimulatory effects of INDO on CFU-S and GM-CFC populations and an inhibitory effect of ESCUL on GM-CFC were observed; and (c) when the drugs were administered i.p. to mice 1 h before 5-Gy irradiation, INDO enhanced the postirradiation recovery of haematopoietic indices such the numbers of CFU-S, GM-CFC, peripheral blood granuloctyes, and nucleated bone marrow cells, while ESCUL had no effect or even inhibited the recovery of these indices. (author).

  12. 75 FR 6338 - Protection of Stratospheric Ozone: New Substitute in the Motor Vehicle Air Conditioning Sector...

    Science.gov (United States)

    2010-02-09

    ...EPA issued a proposed rule in the Federal Register of October 19, 2009, proposing to find HFO-1234yf acceptable, subject to use conditions as a substitute for CFC-12 in motor vehicle air conditioning. The proposed substitute is a non-ozone-depleting substance and consequently does not contribute to stratospheric ozone depletion. In response to requests from several stakeholders and to allow......

  13. Power handling of the JET ITER-like wall

    NARCIS (Netherlands)

    Arnoux, G.; Balboa, I.; Clever, M.; Devaux, S.; P. de Vries,; Eich, T.; M Firdaouss,; Jachmich, S.; Lehnen, M.; Lomas, P. J.; Matthews, G. F.; Mertens, P.; Nunes, I.; Riccardo, V.; Ruset, C.; Sieglin, B.; D F Valcárcel,; J Wilson,; Zastrow, K. D.; JET-EFDA Contributors,

    2014-01-01

    The ITER-like wall (ILW) at JET provides a unique opportunity to study the combination of material (beryllium and tungsten) that will be used for the plasma facing components (PFCs) in ITER. Both the limiters (Be) and divertor (CFC W coated and bulk W) have been designed to maximize their power hand

  14. Treatment of low level radioactive liquid wastes using composite ion-exchange resins based on polyurethane foam

    International Nuclear Information System (INIS)

    Composite ion-exchange resins were prepared by coating copper-ferrocyanide (CFC) and hydrous manganese oxide (HMO) powders on polyurethane (PU) foam. Polyvinyl acetate/Acetone was used as a binder. The foam was loaded with about five times its weight with CFC and HMO powders. The distribution coefficients of CFC-PU foam and HMO-PU foam for cesium and strontium respectively were estimated. Under similar conditions the HMO-PU foam showed higher capacity as well as better kinetics for removal of strontium than CFC-PU foam for Cs. The pilot plant scale studies were conducted using a mixed composite ion-exchange resin bed. About 1000 bed volumes could be passed before attaining a DF of 10 from an initial value of 60-80. The spent resin was digested in alkaline KMnO4 and the digested liquid was fixed in cement matrix. The matrices were characterized with respect to compressive strength and leach resistance. (author)

  15. Defective in vitro granulopoiesis in patients with anorexia nervosa.

    Science.gov (United States)

    Vaisman, N; Barak, Y; Hahn, T; Karov, Y; Malach, L; Barak, V

    1996-07-01

    Patients with anorexia nervosa (AN) frequently suffer from a mild degree of anemia and from moderate leukopenia on top of their undernourished state and metabolic disarrangements. To evaluate in vitro granulopoiesis and its relationship to cytokine production and undernutrition, we have studied 10 adolescent girls with moderate AN (age range, 13.5-18.0). Study methods included assessment of peripheral blood (PB) granulocyte-macrophage colony-forming cells (GM-CFC) of the patients and age-matched controls, and determination of plasma and conditioned medium (CM) of mononuclear cells levels of IL-1, IL-3, IL-6, granulocyte-macrophage colony-stimulating factor (GM-CSF) and tumor necrosis factor (TNF), all of which may play a role in GM-CFC growth regulation. GM-CFC numbers were significantly lower in AN patients compared with the normal controls (13.09 +/- 11.15 versus 39.33 +/- 26.61 colonies/5 x 10(5) cells, p bone marrow GM-CFC targets, the number of colonies stimulated by the CM of patients with AN was significantly lower than those stimulated by the CM of the controls (73.5 +/- 20.1 versus 113.0 +/- 11.6, p changes are the result of the basic disease process or are they due to malnutrition. PMID:8798255

  16. Methods development for measuring and classifying flammability/combustibility of refrigerants. Interim report, task 2 - test plan

    Energy Technology Data Exchange (ETDEWEB)

    Heinonen, E.W.; Tapscott, R.E. [Univ. of New Mexico, Albuquerque, NM (United States)

    1994-07-01

    Regulations on alternative refrigerants and concerns for the environment are forcing the refrigeration industry to consider the use of potentially flammable fluids to replace CFC fluids currently in use. The objectives of this program are to establish the conditions under which refrigerants and refrigerant blends exhibit flammability and to develop appropriate methods to measure flammability.

  17. Application of environmental tracers to mixing, evolution, and nitrate contamination of ground water in Jeju Island, Korea

    Science.gov (United States)

    Koh, Dong-Chan; Niel Plummer, L.; Kip Solomon, D.; Busenberg, Eurybiades; Kim, Yong-Je; Chang, Ho-Wan

    2006-07-01

    SummaryTritium/helium-3 ( 3H/ 3He) and chlorofluorocarbons (CFCs) were investigated as environmental tracers in ground water from Jeju Island (Republic of Korea), a basaltic volcanic island. Ground-water mixing was evaluated by comparing 3H and CFC-12 concentrations with lumped-parameter dispersion models, which distinguished old water recharged before the 1950s with negligible 3H and CFC-12 from younger water. Low 3H levels in a considerable number of samples cannot be explained by the mixing models, and were interpreted as binary mixing of old and younger water; a process also identified in alkalinity and pH of ground water. The ground-water CFC-12 age is much older in water from wells completed in confined zones of the hydro-volcanic Seogwipo Formation in coastal areas than in water from the basaltic aquifer. Major cation concentrations are much higher in young water with high nitrate than those in uncontaminated old water. Chemical evolution of ground water resulting from silicate weathering in basaltic rocks reaches the zeolite-smectite phase boundary. The calcite saturation state of ground water increases with the CFC-12 apparent (piston flow) age. In agricultural areas, the temporal trend of nitrate concentration in ground water is consistent with the known history of chemical fertilizer use on the island, but increase of nitrate concentration in ground water is more abrupt after the late 1970s compared with the exponential growth of nitrogen inputs.

  18. Reduction of chlorofluorocarbon emissions from refrigeration systems

    International Nuclear Information System (INIS)

    Recently enacted State and Federal legislation, (The Clean Air Act and Colorado Senate Bill 77), and the implementation of regulations for each, forbid the intentional release of ozone depleting chlorofluorocarbons(CFCs) from refrigeration and air conditioning systems to the atmosphere. In addition, an international agreement (The Montreal Protocol), calls for CFC manufacturing reductions, which began in 1991, and eventual discontinuation. The declining supply and resultant escalating costs of CFCs are additional driving forces toward conservation and reuse of present refrigerant resources. Rocky Flats Plant (RFP) currently has an estimated 42,000 pounds of CFCs in refrigeration and air conditioning systems. The purpose of this paper is to discuss steps being taken at RFP toward the abatement of CFC releases. The main thrust of our efforts is the use of a refrigerant management system, used to recover and recycle our current CFC stock. Additional methods of further reducing CFC emissions will also be discussed. These include the installation of state-of-the-art oil filtration systems on major chiller units, installation of spring-loaded pressure relief valves and the retrofitting of major chiller units to accept less harmful, alternative refrigerants

  19. Decline of deep and bottom water ventilation and slowing down of anthropogenic carbon storage in the Weddell Sea, 1984-2011

    NARCIS (Netherlands)

    Huhn, Oliver; Rhein, Monika; Hoppema, Mario; van Heuven, Steven

    2013-01-01

    We use a 27 year long time series of repeated transient tracer observations to investigate the evolution of the ventilation time scales and the related content of anthropogenic carbon (C-ant) in deep and bottom water in the Weddell Sea. This time series consists of chlorofluorocarbon (CFC) observati

  20. Characterization, test and interpretative simulations of one-dimensional Carbon Fiber Composite prototype for SPIDER experiment

    International Nuclear Information System (INIS)

    Highlights: • Prototype ITER neutral beam injector to study the beam source behavior requires beam characterization. • Among several types of diagnostic, a calorimeter made of fiber carbon composite (CFC) tiles will be used. • The CFC thermal behaviour is study by laser beam and will be characterize in particel beam. • Experiments and simulations results are discussed. • Designs for tests in particle beams are presented. -- Abstract: For ITER operations, additional heating systems are required. One of these systems is the neutral beam injector (NBI). The SPIDER experiment, a small-scale NBI, is going to be built with the aim to optimize the beam source. For this reason it is provided with several diagnostics, among which the Short-Time Retractable Instrumented Kalorimeter Experiment (STRIKE). In this contribution, a characterization of the Carbon Fiber Composite (CFC) tiles, which are the main component of the diagnostic, is presented. Such analyses include tests with a power laser, exposure to particle beams and thermal stress tests. The results are discussed, which will drive the definition of the acceptance tests of the final supply of CFC tiles

  1. Neuronal Oscillations with Non-sinusoidal Morphology Produce Spurious Phase-to-Amplitude Coupling and Directionality.

    Science.gov (United States)

    Lozano-Soldevilla, Diego; Ter Huurne, Niels; Oostenveld, Robert

    2016-01-01

    Neuronal oscillations support cognitive processing. Modern views suggest that neuronal oscillations do not only reflect coordinated activity in spatially distributed networks, but also that there is interaction between the oscillations at different frequencies. For example, invasive recordings in animals and humans have found that the amplitude of fast oscillations (>40 Hz) occur non-uniformly within the phase of slower oscillations, forming the so-called cross-frequency coupling (CFC). However, the CFC patterns might be influenced by features in the signal that do not relate to underlying physiological interactions. For example, CFC estimates may be sensitive to spectral correlations due to non-sinusoidal properties of the alpha band wave morphology. To investigate this issue, we performed CFC analysis using experimental and synthetic data. The former consisted in a double-blind magnetoencephalography pharmacological study in which participants received either placebo, 0.5 or 1.5 mg of lorazepam (LZP; GABAergic enhancer) in different experimental sessions. By recording oscillatory brain activity with during rest and working memory (WM), we were able to demonstrate that posterior alpha (8-12 Hz) phase was coupled to beta-low gamma band (20-45 Hz) amplitude envelope during all sessions. Importantly, bicoherence values around the harmonics of the alpha frequency were similar both in magnitude and topographic distribution to the cross-frequency coherence (CFCoh) values observed in the alpha-phase to beta-low gamma coupling. In addition, despite the large CFCoh we found no significant cross-frequency directionality (CFD). Critically, simulations demonstrated that a sizable part of our empirical CFCoh between alpha and beta-low gamma coupling and the lack of CFD could be explained by two-three harmonics aligned in zero phase-lag produced by the physiologically characteristic alpha asymmetry in the amplitude of the peaks relative to the troughs. Furthermore, we showed

  2. Finite Element Based Design Optimization of WENDELSTEIN 7-X Divertor Targets

    International Nuclear Information System (INIS)

    In the fusion experiment WENDELSTEIN 7-X divertor plasma facing components have to withstand severe loading conditions. In general thermally induced mechanical stressing turns out to be most critical with respect to life time predictions of the component. In the specific case flat tiles of CFC grade NB31 are joined to the precipitation hardened CuCrZr heat sink by employing an active metal cast (AMC)-Cu as an interlayer between CFC and CuCrZr. Residual stresses resulting from the manufacturing process act as initial stresses in the subsequent operational heat flux loading. For the latter loading regime these stresses intrinsically are generated due to the large contrast in the CTE for CFC and Cu. Different design variants of those CFC flat tile armoured target elements have been analysed via the finite element package ABAQUS aiming at derivation of an optimized component design. The numerical study comprises variants with different degrees of tessellation of the CFC flat tile section, orientation of the CFC, lamellar design of the AMC-interlayer, and different designs of the cooling channels. The thermo-mechanical material characteristics are accounted for the finite element models with elastic-plastic properties being assigned to the metallic sections CuCrZr and AMC-Cu, respectively, and orthotropic nonlinear-elastic properties being used to the CFC section. The latter has been realized in form of a user-defined material subroutine that is used at the integration point level of the finite element model. In particular, twelve scalar-type damage parameters obeying their own evolution equations with respect to the loading history account for specific stress-strain relationships in the three principal material directions and planes with six damage parameters being used for normal loading under tensile and compressive stress states, respectively, and six parameters being used for shear loading. For the aim of model verification calculated surface temperatures, global

  3. Seasonal variability in the Deep Western Boundary Current around the Eastern tip of Brazil

    Science.gov (United States)

    Rhein, Monika; Stramma, Lothar

    2005-08-01

    The spreading of recently ventilated North Atlantic Deep Water (NADW) from the formation region to the equatorial Atlantic occurs mainly in the Deep Western Boundary Current (DWBC). When crossing the equator between 44°W and 35°W, the DWBC is split in two velocity cores through a chain of seamounts around the Atoll das Rocas at 3.5°S. Further eastward the DWBC contributes to the zonally oriented equatorial current system. The circulation of the NADW in the crucial region around the eastern tip of Brazil is examined using 8 CTD and Chlorofluorocarbon (CFC) sections along 35°W and along 5°S, respectively, taken mainly in spring and fall in the years 1990-2002. As expected from the short direct flow path between the two sections, the CFC concentrations in the upper NADW (1400-2200 m) were similar at 35°W and 5°S during boreal autumn. In spring, however, a significant downstream CFC decrease was observed. If one attributes the decrease solely to the older age of water further downstream, the CFC concentration age difference between 35°W and 5°S in May 2002 would be 3-5 years. We interpret the aging to be caused by an eastward detour of the flow with the deep equatorial circulation before reaching 5°S in spring. Another conspicuous anomaly was found in the middle NADW (2200-3400 m) with downstream decreasing salinities in boreal spring, but not in autumn. This variability might also be caused by differences in the deep equatorial circulation, but in contrast to the uNADW, one cannot exclude enhanced mixing with water of South Atlantic origin in spring to be the cause of that variability. No seasonal difference was observed in the hydrography or the CFC concentrations for the lower NADW. The weaker CFC decrease along the equator compared with that in the DWBC downstream of 35°W, and the topographic features along the downstream path, point to a predominantly eastward flow of the deep lNADW core. The lNADW CFC core is no longer observed at 11°S. Repeated

  4. Climate control of decadal-scale increases in apparent ages of eogenetic karst spring water

    Science.gov (United States)

    Martin, Jonathan B.; Kurz, Marie J.; Khadka, Mitra B.

    2016-09-01

    Water quantity and quality in karst aquifers may depend on decadal-scale variations in recharge or withdrawal, which we hypothesize could be assessed through time-series measurements of apparent ages of spring water. We tested this hypothesis with analyses of various age tracers (3H/3He, SF6, CFC-11, CFC-12, CFC-113) and selected solute concentrations [dissolved oxygen (DO), NO3, Mg, and SO4] from 6 springs in a single spring complex (Ichetucknee springs) in northern Florida over a 16-yr period. These springs fall into two groups that reflect shallow short (Group 1) and deep long (Group 2) flow paths. Some tracer concentrations are altered, with CFC-12 and CFC-113 concentrations yielding the most robust apparent ages. These tracers show a 10-20-yr monotonic increase in apparent age from 1997 to 2013, including the flood recession that followed Tropical Storm Debby in mid-2012. This increase in age indicates most water discharged during the study period recharged the aquifer within a few years of 1973 for Group 2 springs and 1980 for Group 1 springs. Inverse correlations between apparent age and DO and NO3 concentrations reflect reduced redox state in older water. Positive correlations between apparent age and Mg and SO4 concentrations reflect increased water-rock reactions. Concentrated recharge in the decade around 1975 resulted from nearly 2 m of rain in excess of the monthly average that fell between 1960 and 2014, followed by a nearly 4 m deficit to 2014. This excess rain coincided with two major El Niño events during the maximum cool phase in the Atlantic Multidecadal Oscillation. Although regional water withdrawal increased nearly 5-fold between 1980 and 2005, withdrawals represent only 2-5% of Ichetucknee River flow and are less important than decadal-long variations in precipitation. These results suggest that groundwater management should consider climate cycles as predictive tools for future water resources.

  5. Combination of low O(2) concentration and mesenchymal stromal cells during culture of cord blood CD34(+) cells improves the maintenance and proliferative capacity of hematopoietic stem cells.

    Science.gov (United States)

    Hammoud, Mohammad; Vlaski, Marija; Duchez, Pascale; Chevaleyre, Jean; Lafarge, Xavier; Boiron, Jean-Michel; Praloran, Vincent; Brunet De La Grange, Philippe; Ivanovic, Zoran

    2012-06-01

    The physiological approach suggests that an environment associating the mesenchymal stromal cells (MSC) and low O(2) concentration would be most favorable for the maintenance of hematopoietic stem cells (HSCs) in course of ex vivo expansion of hematopoietic grafts. To test this hypothesis, we performed a co-culture of cord blood CD34(+) cells with or without MSC in presence of cytokines for 10 days at 20%, 5%, and 1.5% O(2) and assessed the impact on total cells, CD34(+) cells, committed progenitors (colony-forming cells-CFC) and stem cells activity (pre-CFC and Scid repopulating cells-SRC). Not surprisingly, the expansion of total cells, CD34(+) cells, and CFC was higher in co-culture and at 20% O(2) compared to simple culture and low O(2) concentrations, respectively. However, co-culture at low O(2) concentrations provided CD34(+) cell and CFC amplification similar to classical culture at 20% O(2) . Interestingly, low O(2) concentrations ensured a better pre-CFC and SRC preservation/expansion in co-culture. Indeed, SRC activity in co-culture at 1.5% O(2) was higher than in freshly isolated CD34(+) cells. Interleukin-6 production by MSC at physiologically low O(2) concentrations might be one of the factors mediating this effect. Our data demonstrate that association of co-culture and low O(2) concentration not only induces sufficient expansion of committed progenitors (with respect to the classical culture), but also ensures a better maintenance/expansion of hematopoietic stem cells (HSCs), pointing to the oxygenation as a physiological regulatory factor but also as a cell engineering tool. PMID:21913190

  6. Age-Related Changes in Population of Stromal Precursor Cells in Hematopoietic and Lymphoid Organs.

    Science.gov (United States)

    Gorskaya, Yulia F.; Latzinik, Natalia V.; Shuklina, Ekaterina U.; Nesterenko, Vladimir G.

    2000-07-01

    It is shown that the content of precursor cells of stromal tissue (CFC-F) in the hemopoietic and lymphoid organs of SAMP (rapidly-ageing mice) and SAMR mice (mice with a normal ageing rate) decreases as the animals grow older. However the decrease in the content of CFC-F in SAMP mice begins substantially earlier - in the age group of 9-11 months, while in the SAMR mice - only in the age group of 16-19 months. It was found that the age reduction of the number to an equal degree relates to the whole population of CFC-F, in particular both the fraction of weakly-linked CFC-F, which is isolated by means of mechanical disaggregation of the tissue, and the fraction which may only be isolated using trypsin. It is shown that the concentration of inducible osteogenic precursor cells (IOPC) in the spleen of guinea pigs does not change with age, but their content in that organ in old animals (2-3 years old) drops by two times. It was found that in elderly animals the mass of the ectopic osseous tissue, formed by the implantation of an osteoinductor (autologous epithelium of the urinary bladder) in a system open for entrance of cells, decreases by two times. After curettage of the medullary cavity of guinea pig tibia (i.e. under conditions of an increased demand for osteogenic cells) the mass of induced ectopic osseous tissue decreases by 4 times, which indicates to the possible functional relationship between the pool of determined and inducible osteogenic precursor cells. On the whole, the obtained data show that during ageing there is a reduction in the number of stromal precursor cells (CFC-F and IOPC), which form a specific microenvironment for hemopoietic and lymphoid organs, which is important to understand the role of these cells in the development of age pathologies, in particular senile osteoporosis. PMID:12687170

  7. Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA) data processing and atmospheric temperature and trace gas retrieval

    Science.gov (United States)

    Riese, M.; Spang, R.; Preusse, P.; Ern, M.; Jarisch, M.; Offermann, D.; Grossmann, K. U.

    1999-07-01

    The Cryogenic Infrared Spectrometers and Telescopes for the Atmosphere (CRISTA) experiment aboard the Shuttle Pallet Satellite (SPAS) was successfully flown in early November 1994 (STS 66) and in August 1997 (STS 85). This paper focuses on the first flight of the instrument, which was part of the Atmospheric Laboratory for Application and Science 3 (ATLAS 3) mission of NASA. During a free flying period of 7 days, limb scan measurements of atmospheric infrared emissions were performed in the 4 to 71 μm wavelength region. For improved horizontal resolution, three telescopes (viewing directions) were used that sensed the atmosphere simultaneously. Atmospheric pressures, temperatures, and volume mixing ratios of various trace gases were retrieved from the radiance data by using a fast onion-peeling retrieval technique. This paper gives an overview of the data system including the raw data processing and the temperature and trace gas profile retrieval. Examples of version 1 limb radiance data (level 1 product) and version 1 mixing ratios (level 2 product) of ozone, ClONO2, and CFC-11 are given. A number of important atmospheric transport processes can already be identified in the level 1 limb radiance data. Radiance data of the lower stratosphere (18 km) indicate strong upwelling in some equatorial regions, centered around the Amazon, Congo, and Indonesia. Respective data at the date line are consistent with convection patterns associated with El Niño. Very low CFC-11 mixing ratios occur inside the South Polar vortex and cause low radiance values in a spectral region sensitive to CFC-11 emissions. These low values are a result of considerable downward transport of CFC-11 poor air that occurred during the winter months. Limb radiance profiles and retrieved mixing ratio profiles of CFC-11 indicate downward transport over ˜5 km. The accuracy of the retrieved version 1 mixing ratios is rather different for the various trace gases. In the middle atmosphere the estimated

  8. Simulations of material damage to divertor and first wall armour under ITER transient loads by modelling and experiments

    International Nuclear Information System (INIS)

    Operation of ITER at high fusion gain is assumed to be the H-mode. A characteristic feature of this regime is the transient energy release (TE) from the confined plasma onto plasma facing components (PFCs), which can play a determining role in lifetime of these components. The expected fluxes on the ITER PFCs during transients are: Type I ELM Q = 0.5 - 4 MJ/m2 in timescales t = 0.3 - 0.6 ms, and thermal quench Q = 2 - 13 MJ/m2 with t = 1 - 3 ms. CFC and tungsten macrobrush armour are foreseen as PFCs for ITER divertor and Be - as FW armour. During the intense TE in ITER the evaporation (CFC, W, Be) and surface melting and melt splashing (W and Be) are seen as the main mechanisms of PFC erosion. A noticeable erosion of CFC PAN fibres and rather intense crack formation for the W targets were observed in plasma gun experiments at rather small heat loads at which the melt damage to W armour is not substantial. The expected erosion of the ITER PFCs TE can be properly estimated by numerical simulations validated against erosion experiments at the plasma gun facilities QSPA-T, MK- 200UG and QSPA-Kh50. Within collaboration between EU fusion programme and Russian Federation, CFC and W macrobrush targets manufactured in EU were exposed to multiple ITER TE-like loads with Q = 0.5 - 2.2 MJ/m2 and t = 0 .5 ms at the QSPA-T. The measured erosion was used to validate the modelling codes developed in FZK (PEGASUS, MEMOS, and others), which are then applied to model the erosion of the divertor and main chamber ITER PFCs under expected transient loads in ITER. Numerical simulations performed for the expected ITER-like loads predicted: a significant erosion of the CFC target for Q > 0.5 MJ/m2 was caused by the inhomogeneous structure of the CFC; the W macrobrush structure is effective in preventing gross melt layer displacement. Optimization of macrobrush geometry to minimize melt splashing is done. Different mechanisms of melt splashing are compared with the results obtained in QSPA

  9. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Tétard

    2008-02-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and CFC-12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10%, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences probably remain

  10. Assessment of Halon-1301 as a groundwater age tracer

    Science.gov (United States)

    Beyer, M.; van der Raaij, R.; Morgenstern, U.; Jackson, B.

    2015-06-01

    Groundwater dating is an important tool to assess groundwater resources in regards to their dynamics, i.e. direction and timescale of groundwater flow and recharge, contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However, ambiguous age interpretations are often faced, due to a limited set of available tracers and their individual restricted application ranges. For more robust groundwater dating multiple tracers need to be applied complementarily (or other characterisation methods need to be used to complement tracer information). It is important that additional, groundwater age tracers are found to ensure robust groundwater dating in future. We have recently suggested that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate, but its behaviour in water and suitability as a groundwater age tracer had not yet been assessed in detail. In this study, we determined Halon-1301 and inferred age information in 17 New Zealand groundwater samples and various modern (river) water samples. The samples were simultaneously analysed for Halon-1301 and SF6, which allowed for identification of issues such as contamination of the water with modern air during sampling. All analysed groundwater sites had also been previously dated with tritium, CFC-12, CFC-11 and SF6, and exhibited mean residence times ranging from modern (close to 0 years) to over 100 years. The investigated groundwater samples ranged from oxic to highly anoxic. All samples with available CFC data were degraded and/or contaminated in one or both of CFC-11 and CFC-12. This allowed us to make a first attempt of assessing the conservativeness of Halon-1301 in water, in terms of presence of local sources and its sensitivity towards degradation, which could affect the suitability of Halon-1301 as groundwater age tracer. Overall we found Halon-1301

  11. HFC-134A and HCFC-22 supermarket refrigeration demonstration and laboratory testing. Phase I. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Aspen Systems and a team of nineteen agencies and industry participants conducted a series of tests to determine the performance of HFC-134a, HCFC-22, and CFC-502 for supermarket application. This effort constitutes the first phase of a larger project aimed at carrying out both laboratory and demonstration tests of the most viable HFC refrigerants and the refrigerants they replace. The results of the Phase I effort are presented in the present report. The second phase of the project has also been completed. It centered on testing all viable HFC replacement refrigerants for CFC-502. These were HFC-507, HFC-404A, and HFC-407A. The latter results are published in the Phase II report for this project. As part of Phase I, a refrigeration rack utilizing a horizontal open drive screw compressor was constructed in our laboratory. This refrigeration rack is a duplicate of one we have installed in a supermarket in Clifton Park, NY.

  12. NSE与视频脑电图在儿童热性惊厥的相关研究%THE CORRELATION BETWEEN SERUM NEURON SPECIFIC ENOLASE AND VIDEO EEG IN FEBRILE CONVULSION OF CHILDREN

    Institute of Scientific and Technical Information of China (English)

    刘秀琴; 于树红; 孙若鹏

    2002-01-01

    Objective:To evaluate the diagnostic value of serum neuron specific enolase and Video EEG in Febrile Convulsion of childen. Method:Serum NSE was detected by RIA on the first day and the seventh day after seizure in 40 children with simple febrile convulsion and 18 with complex febrile convulsion. Video EEG was performed at 1st, 7th and 30th day in all the patients. Results: There were significant differences between NSE levels at 24th hour and on 7th day after convulsion (P<0.01). NSE concentrations in patients with SFC and CFC were also different (P < 0.01). The more slowly NSE restored, the higher the abnormal ratio of EGG was . Conclusion: NSE increased in patients within 24hours after seizure, especially in CFC patients. The abnormal ratio of VideoEEG was related to the change of NSE concentration.

  13. Experimental performance of ozone-safe alternative refrigerants: Experimental performance comparisons of R32, R125, R143a, R218, R134a, R152a, R124, R142b, RC318 and R143 in a refrigeration circuit

    Science.gov (United States)

    Sand, James R.; Vineyard, Edward A.; Nowak, Richard J.

    1990-02-01

    Several compounds proposed as near term or longer range substitutes for the regulated chlorofluorocarbon (CFC) refrigerants were tested in a breadboard vapor-compression circuit, and their performance was evaluated relative to more commonly used refrigerants. The limited physical property information available in the literature for these alternative compounds was used to fit an equation of state so coefficients of performance (COPs) and capacities calculated from refrigerant property subroutines could be compared to those obtained experimentally. Comparisons of measured and modeled performance are given for 11 alternatives and for R22, R12, and R114. Estimates of compressor efficiency with each refrigerant are provided. Several of the alternatives exhibited better performance than the more widely used refrigerants at some or all of the conditions tested. Ozone-safe, alternative refrigerants that performed better than CFC counterparts at selected conditions are R152a, R143a, R134a, R134, and R142b.

  14. Experimental study of PFCs erosion under ITER-like transient loads at plasma gun facility QSPA

    International Nuclear Information System (INIS)

    This paper is concerned with investigation of an erosion of the ITER-like divertor castellated targets of pure tungsten, lanthanum tungsten and CFC under plasma heat loads expected during the Type I ELMs and disruptions in ITER. These experiments were carried out on a plasma gun QSPA-T at the SRC RF TRINITI under EU/RF collaboration. The targets were exposed by series repeated plasma pulses with heat loads in the range of 0.2-2.5 MJ/m2 and a pulse duration of 0.5 ms. The erosion value as a function of pulse number and energy density were obtained. The erosion of lanthanum tungsten started at the lower energy density as compared with pure tungsten and was mainly due to a melt layer movement and a droplets ejection. Characteristics of ejected droplets were measured. The erosion of CFC macrobrushes under ELM and disruption heat loads was determined mainly by damage of PAN-fibers.

  15. Chlorofluorocarbons and ~3H/~3He in groundwater——Applications in tracing and dating young groundwater

    Institute of Scientific and Technical Information of China (English)

    秦大军; 王浩

    2001-01-01

    Based on the CFC concentration, the fraction of young groundwater in a mixture with old groundwater can be defined if the age of the young component is known. The authors argued that the ratio of [3HeJ/[3Ht] in a young water is independent of its mixing with old waters. Hence, the 3H-3He can be used to determine age of the young groundwater, though mixing with old ground-water may occur. CFC concentrations are susceptible to change by mixing of young and old water. The combination of CFCs and tritium/helium can provide confidential apparent age of the young groundwater and fraction of the young water in the mixture with old groundwater.

  16. Degradation of tetrafluoroethane using three-phase gliding arc plasma

    International Nuclear Information System (INIS)

    The use of many chlorofluorocarbons (CFC's) has negatively impacted the ozone layer. The Montreal Protocol was implemented, as a temporary solution for this problem by replacing CFC's by hydrofluorocarbons (HFC's). These kinds of gases have the propriety to be free of chlorine. However, in a next future, the Montreal Protocol also considers the replacement of HFC's because they have a high global warming potential when they enter in contact with the atmosphere. One of the methods to remove those compounds is the gliding arc plasma because it presents some advantages. The inlet system works near the atmospheric pressure and has a transition region from plasma at thermodynamic local partial equilibrium to non-thermal plasma; allowing high gas and electronic temperatures. Results present a promissory possibility to be scaled and to give an industrial service.

  17. Risk analysis and safety management of an industrial-scale refrigerator converted from R22 to ammonia, with a volume of 18 to of ammonia; Risikoanalyse und Sicherheitsmanagement einer von R 22 auf Ammoniak umgestellten Grosskaelteanlage mit einer Fuellmenge von 18 to Ammoniak

    Energy Technology Data Exchange (ETDEWEB)

    Jung, H. [Nestle Deutschland AG, Werk Mainz, Mainz (Germany)

    2005-07-01

    In the context of the international ban on CFC and H-CFC refrigerants, a 30 year-old industrial refrigerator for freeze drying of coffee was converted to ammonia. Apart from compliance with the detailed catalogue of rules, the properties of the new refrigerant itself had to be studied. All staff members were trained in handling and hazards of ammonia. After a risk analysis, the protective systems and safety measures were specified, and an alarm and safety plan and an explosion protection document were drawn up. After completion and commissioning of the plant, an internal safety audit was carried out, and safety drills - alarm, evacuation of buildings, crisis management group, cooperation of safety experts - were carried out. (orig.)

  18. Application of energy conservation policies and strategies: their effects on environment protection

    International Nuclear Information System (INIS)

    The french energy policy settled after the oil crisis was aimed at reducing fossil energy consumption; statistics show that it was a success, particularly in industry but of lower importance for automobiles as traffic problems around cities increased. Some examples are given (steel, sugar and cement, new buildings, and cars). Rational use of energy and nuclear energy utilization induced a decrease in carbon dioxide emission, one of the most important greenhouse effect gases; the various causes of greenhouse gas emissions are evaluated and compared : energy (residential and commercial buildings, industry, transport), agriculture, putrefying wastes, deforestation, CFC. Cost and emission abatement potential of various policies are compared: fossil energy conservation, high-efficiency wood combustion, substitution of CFC, reforestation, catalytic converters, renewable energies, etc. Potentials of renewable energies are assessed

  19. Carbon Dioxide, Hydrographic, and Chemical Data Obtained During the R/V Thomas G. Thompson Cruise in the Pacific Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Sabine, C.L.; Key, R.M.; Hall, M.; Kozyr, A.

    1999-08-01

    This data documentation discusses the procedures and methods used to measure total carbon dioxide (TCO2), total alkalinity (TALK), and radiocarbon (delta 14C), at hydrographic stations, as well as the underway partial pressure of CO2 (pCO2) during the R/V Thomas G. Thompson oceanographic cruise in the Pacific Ocean (Section P10). Conducted as part of the World Ocean Circulation Experiment (WOCE), the cruise began in Suva, Fiji, on October 5, 1993, and ended in Yokohama, Japan, on November 10, 1993. Measurements made along WOCE Section P10 included pressure, temperature, salinity [measured by conductivity temperature, and depth sensor (CTD)], bottle salinity, bottle oxygen, phosphate, nitrate, silicate, chlorofluorocarbons (CFC-11, CFC-12), TCO2, TALK, delta 14C, and underway pCO2.

  20. Deformation of ductile braze layer in a joint element under cyclic thermal loads

    International Nuclear Information System (INIS)

    The structural lifetime of a brazed joint is affected by the plastic behavior of ductile filler metal. In this work, elastoplastic analysis is performed on a CFC/Cu/TZM bonded joint for different thermal loading cases. The evolution of strains in the braze layer during the brazing process is analyzed. It is shown that the temperature dependence of the flow curves exerts considerable influence on the deformation behavior of the filler metal interlayer. The deformation characteristics of the braze layer under thermal cycling are investigated. The effect of thermal gradient on the plastic deformation of the braze is discussed. The fatigue lifetime of the copper braze layer is estimated. High heat flux (HHF) cycling tests are conducted on a CFC/Cu/TZM brazed joint in an electron beam facility. The microstructure of the deformed copper braze is presented. The flow morphologies and corresponding slip mechanisms are discussed. (orig.)

  1. Failure modes of vacuum plasma spray tungsten coating created on carbon fibre composites under thermal loads

    International Nuclear Information System (INIS)

    Vacuum plasma spray tungsten (VPS-W) coating created on a carbon fibre reinforced composite (CFC) was tested under two thermal load schemes in the electron beam facility to examine the operation limits and failure modes. In cyclic ELM-like short transient thermal loads, the VPS-W coating was destroyed sub-layer by sub-layer at 0.33 GW/m2 for 1 ms pulse duration. At longer single pulses, simulating steady-state thermal loads, the coating was destroyed at surface temperatures above 2700 deg. C by melting of the rhenium containing multilayer at the interface between VPS-W and CFC. The operation limits and failure modes of the VPS-W coating in the thermal load schemes are discussed in detail.

  2. Damage structure in divertor armor materials exposed to multiple ITER relevant ELM loads

    International Nuclear Information System (INIS)

    The damage threshold and damage mechanisms of divertor armor materials, i.e. CFC and tungsten, were studied under the impact of ITER relevant ELM-like loads. These experiments were carried out in a Quasi-Stationary Plasma Accelerator applying repetitive pulses of 500 μs up to 100 cycles. CFC showed preferential erosion of the PAN fiber-bundles above 0.6 MJ/m2 and cracking of pitch fiber-bundles. Tungsten showed cracking already at 0.2 MJ/m2 and melting at flat surfaces above 1 MJ/m2. Cracks in tungsten were identified as primary and secondary cracks which all propagated in the vertical direction, which was considered to be less critical. At an energy density of 1.5 MJ/m2, the melt-layer completely covered the surface and bridged the castellation slots.

  3. Recent results in plasma facing materials studied at SWIP

    International Nuclear Information System (INIS)

    it is focuses on that multi-elements doped carbon base materials, tungsten coating and innovation liquid metal free surface for plasma facing materials (PFMs) researches at Southwestern Institute of Physics (SWIP), China. To reduce chemical sputtering and resist thermal shock of materials, it is developed using B4C, Ti and Si doped graphite and C/C fiber composite (CFC), and their properties are investigated by experiments with special devices and HL-M Tokamak. For high Z PFM, Tungsten coatings on carbon and copper substrates are also developed. To understand the acting of substrate with different interface layers as the diffusion barrier of substrate, three different type tungsten coatings are compared studies on the investigation. They are the vacuum plasma spray tungsten coated (VPS-W) on CX2002U CFC with multi-layer tungsten and rhenium interface, inert gas plasma spray coating (IPS-W) on SMF700 graphite and IPS-W coatings coppers. (author)

  4. Conformal Fermi Coordinates

    CERN Document Server

    Dai, Liang; Schmidt, Fabian

    2015-01-01

    Fermi Normal Coordinates (FNC) are a useful frame for isolating the locally observable, physical effects of a long-wavelength spacetime perturbation. Their cosmological application, however, is hampered by the fact that they are only valid on scales much smaller than the horizon. We introduce a generalization that we call Conformal Fermi Coordinates (CFC). CFC preserve all the advantages of FNC, but in addition are valid outside the horizon. They allow us to calculate the coupling of long- and short-wavelength modes on all scales larger than the sound horizon of the cosmological fluid, starting from the epoch of inflation until today, by removing the complications of the second order Einstein equations to a large extent, and eliminating all gauge ambiguities. As an application, we present a calculation of the effect of long-wavelength tensor modes on small scale density fluctuations. We recover previous results, but clarify the physical content of the individual contributions in terms of locally measurable ef...

  5. Radioprotection of hemopoiesis conferred by aqueous extract from chlorococcal algae (Ivastimul) administered to mice before irradiation

    International Nuclear Information System (INIS)

    In experiments on mice, single i.p. injections of aqueous extract from chlorococcal freshwater algae (Ivastimul) were found to increase their radioresistance. During the same period the number of spleen colony-forming units (CFUs) in the bone marrow and spleen and their proliferation activity increased. The amount of granulocyte-macrophage colony-forming cells (GM-CFC) in the bone marrow grows and the colony-stimulating activity (CSA) of the blood serum of mice is elevated at an early period after injection of the substance. The recovery of the CFUs and GM-CFC pools in femoral bone marrow after irradiation proceeds at a faster rate in Ivastimul-treated animals than in control groups. The activation of the pool of hemopoietic stem cells and stimulatory effects of Ivastimul on granulocytopoiesis act favorably on the repair of radiation damage and on increased percentage of animals surviving lethal doses of gamma radiation

  6. Methane oxidation and degradation of organic compounds in landfill soil covers

    DEFF Research Database (Denmark)

    Scheutz, Charlotte; Kjeldsen, Peter

    -order kinetics and occurred in parallel with the oxidation of methane. TeCM, CFC-11, and CFC-12 were not degradable in presence of oxygen and degradation of these compounds in the oxidative zone in landfill top covers is therefore expected to be limited. However these compounds were found degradable in the......High rates of methane oxidation and degradation of the lowed halogenated methanes (TCM and DCM) and HCFCs (HCFC-21 and HCFC-22) were found in an investigation of the oxidation of methane and halogenated organic compunds (HOCs) in landfill gas affected soil. The degradation followed zero...... anaerobic zone in the lower part of soil columns permeated with artificial landfill gas. The lesser-chlorinated compounds were degraded in the upper oxic zone with overlapping gradients of methane and oxygen. Methane oxidation and degradation of HOCs in the top-soils may play a very important role in...

  7. ECR ion and plasma source having new magnetic field for diverse applications

    International Nuclear Information System (INIS)

    The ECR ion and plasma source (ECRIPS) does not need any filament or electrode for plasma discharge rendering the least requirement of maintenance and uninterrupted operation for long time. The traditional ECRIPS use magnetic min-B field for plasma containment and energizing electrons based on the principle of the ECR process. Some new cusp field configurations (CFC) have been simulated to generate large volume uniform plasma of high density making it very appropriate for producing wide beam for low as well as high charged ion beam. The new cusp field, which is magneto-hydrodynamic (MHD) stable produce modified min-B or 0-B field. It can be designed corresponding to any RF frequency. Confinement feature of the field is assessed by electron simulation and found to contain the particles for longer time in comparison to the traditional similar field configuration (TFC). The CFC can be used to construct a new genre of ECRIPS for various applications. (author)

  8. Nobel Prize in Chemistry 1995 "for their work in atmospheric chemistry, particularly concerning the formation and decomposition of ozone" : Paul J Crutzen, Mario J Molina and F Sherwood Rowland

    CERN Multimedia

    1997-01-01

    Prof. Paul J Crutzen presents "The stratospheric ozone hole : a man-caused chemical instability".The discovery of the spring time stratospheric ozone hole by scientists of the British Antarctic Survey, led by Joe Farman, was one of the greatest surprises in the history of the atmospheric sciences and global change studies. After intensive research efforts by many international scientific teams it has clearly been demonstrated that the observed rapid ozone depletions are due to catalytic reactions involving CIO radicals, more than 80571130f which are produced by the photochemical breakdown of the industrial chlorofluorocarbon (CFC) gases. In this lecture I will present the course of events leading to the rapid ozone depletions. International agreements have been reached to forbid the production of the CFC gases. However, despite these measures, it will take almost 50 years before the ozone hole will have disappeared. I will also show that mankind has indeed been very lucky and that things could have been far w...

  9. A new environment-friendly refrigerant

    Institute of Scientific and Technical Information of China (English)

    赵晓宇; 史琳; 朱明善; 韩礼钟

    1999-01-01

    CFCs and HCFCs, widely used in refrigeration and air-conditioning equipment, have been or will be phased out according to the revisions of the Montreal Protocol because they deplete the ozone layer. Many substitutes have been proposed, but no one has perfectly replaced the CFC end HCFC refrigerants. New generation alternatives are being investigated worldwide. According to the industrial and environmental requirements, many factors should be considered in the screening and evaluation of refrigerant alternatives. A new method is proposed using the soft algebra method——fuzzy multiple evaluation. The weights for different factors are determined mathematically and criteria values for all the objects are made dimensionless to quantitatively compare the different alternatives. A new long-term drop-in mixture alternative THR02 is developed and evaluated in a series of theoretical and experimental evaluations.THR02 is proved to be an environment-friendly, nontoxic, inflammable, drop-in alternative to CFC-12 a

  10. Investigation of flushing and clean-out methods for refrigeration equipment to ensure system compatibility

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, J.J.; Shows, M.; Abel, M.W. [Integral Sciences Inc., Columbus, OH (United States)

    1996-04-24

    SECTION 608 of the Clean Air Act Amendments has altered much of the refrigeration service contracting industry. MCLR Project Number 660-52502 was established to examine two areas where the Amendments are influencing contractors to determine if more cost-effective service procedures might be developed. One area where existing service procedures are being revisited involves the removal of contaminants from a refrigeration system after a motor burnout. At one time, a Class 1 substance such as CFC-11 or CFC-113 was used as a flushing agent for cleaning a system after a burnout. On large systems, the compressor was disassembled, and the parts were cleaned using 1,1,1-trichloroethane (TCA) or a TCA-containing mixture. Such alternatives are seldom possible today, as the manufacture of Class 1 substances was banned on January 1, 1996. This report describes processes for mineral oil removal, process alternatives for servicing burnouts, solvents, and laboratory retrofit tests.

  11. Ag-nanoparticle-decorated porous ZnO-nanosheets grafted on a carbon fiber cloth as effective SERS substrates

    Science.gov (United States)

    Wang, Zhiwei; Meng, Guowen; Huang, Zhulin; Li, Zhongbo; Zhou, Qitao

    2014-11-01

    We report on the large-scale synthesis of Ag-nanoparticle (Ag-NP) decorated ZnO-mesoporous-nanosheets (NSs) grafted on a flexible carbon fiber cloth (CFC), as sensitive and reproducible surface enhanced Raman scattering (SERS) substrates with excellent flexibility. The composite SERS-substrates are achieved by a combination of atomic layer deposition of ZnO-seeds on each fiber of the CFC (denoted as ZnO-seeds@CFC), chemical bath deposition and subsequent pyrolysis for the creation of ZnO-mesoporous-NSs grafted on ZnO-seeds@CFC, and ion-sputtering of Ag-NPs on the ZnO-mesoporous-NSs. As abundant SERS ``hot spots'' are generated from the electromagnetic coupling of the densely distributed Ag-NPs, and the semiconducting ZnO-mesoporous-NSs also have chemical supporting enhancement and distinct molecule adsorbing abilities, the composite SERS-substrates demonstrate high SERS-sensitivity with good signal reproducibility. As a trial for potential applications, the composite SERS-substrates were used to identify pesticides and highly toxic polychlorinated biphenyls (PCBs), and low concentrations down to 10-7 M for methyl parathion and 5 × 10-6 M for PCB-77 were reached, respectively, showing promising potential for the SERS-based rapid detection of toxic organic pollutants in the environment.We report on the large-scale synthesis of Ag-nanoparticle (Ag-NP) decorated ZnO-mesoporous-nanosheets (NSs) grafted on a flexible carbon fiber cloth (CFC), as sensitive and reproducible surface enhanced Raman scattering (SERS) substrates with excellent flexibility. The composite SERS-substrates are achieved by a combination of atomic layer deposition of ZnO-seeds on each fiber of the CFC (denoted as ZnO-seeds@CFC), chemical bath deposition and subsequent pyrolysis for the creation of ZnO-mesoporous-NSs grafted on ZnO-seeds@CFC, and ion-sputtering of Ag-NPs on the ZnO-mesoporous-NSs. As abundant SERS ``hot spots'' are generated from the electromagnetic coupling of the densely

  12. The stratospheric ozone hole a man-caused chemical instability

    CERN Document Server

    Crutzen, P J

    1997-01-01

    The discovery of the spring time stratospheric ozone hole by scientists of the British Antarctic Survey, led by Joe Farman, was one of the greatest surprises in the history of the atmospheric sciences and global change studies. After intensive research efforts by many international scientific teams it has clearly been demonstrated that the observed rapid ozone depletions are due to catalytic reactions involving CIO radicals, more than 80571130f which are produced by the photochemical breakdown of the industrial chlorofluorocarbon (CFC) gases. In this lecture I will present the course of events leading to the rapid ozone depletions. International agreements have been reached to forbid the production of the CFC gases. However, despite these measures, it will take almost 50 years before the ozone hole will have disappeared. I will also show that mankind has indeed been very lucky and that things could have been far worse.

  13. Kinetics of the reaction of hydroxyl radicals with ethane and a series of Cl- and F-substituted methanes at 300-400degK

    International Nuclear Information System (INIS)

    Gas phase reactions of hydroxyl radicals with ethane and a series of Cl- and F-substituted methanes were studied at atmospheric pressure and over the temperature range 300-400degK. Hydroxyl radicals were produced by pulse radiolysis of water vapour and the decay rate was studied by monitoring the transient light absorption at 3090 A. Arrhenius parameters (A,Esub(a)) for the reaction RH + OH arrow R + HOH were obtained for the reactants RH = C2H6,CH3Cl,CH2Cl2,CHFCl2. CF2Cl2 (CFC-12) which contains no C-H bonds was found to be inert toward attack by hydroxyl radicals. Since no other tropospheric sink reactions have been reported for CFC-12 its possible impact on the stratospheric ozone remains a controversial problem. (author)

  14. Halon-1301, a new Groundwater Age Tracer

    Science.gov (United States)

    Beyer, Monique; van der Raaij, Rob; Morgenstern, Uwe; Jackson, Bethanna

    2015-04-01

    Groundwater dating is an important tool to assess groundwater resources in regards to direction and time scale of groundwater flow and recharge and to assess contamination risks and manage remediation. To infer groundwater age information, a combination of different environmental tracers, such as tritium and SF6, are commonly used. However ambiguous age interpretations are often faced, due to a limited set of available tracers and limitations of each tracer method when applied alone. There is a need for additional, complementary groundwater age tracers. We recently discovered that Halon-1301, a water soluble and entirely anthropogenic gaseous substance, may be a promising candidate [Beyer et al, 2014]. Halon-1301 can be determined along with SF6, SF5CF3 and CFC-12 in groundwater using a gas chromatography setup with attached electron capture detector developed by Busenberg and Plummer [2008]. Halon-1301 has not been assessed in groundwater. This study assesses the behaviour of Halon-1301 in water and its suitability as a groundwater age tracer. We determined Halon-1301 in 17 groundwater and various modern (river) waters sites located in 3 different groundwater systems in the Wellington Region, New Zealand. These waters have been previously dated with tritium, CFC-12, CFC-11 and SF6 with mean residence times ranging from 0.5 to over 100 years. The waters range from oxic to anoxic and some show evidence of CFC contamination or degradation. This allows us to assess the different properties affecting the suitability of Halon-1301 as groundwater age tracer, such as its conservativeness in water and local contamination potential. The samples are analysed for Halon-1301 and SF6simultaneously, which allows identification of issues commonly faced when using gaseous tracers such as contamination with modern air during sampling. Overall we found in the assessed groundwater samples Halon-1301 is a feasible new groundwater tracer. No sample indicated significantly elevated

  15. Spurious cross-frequency amplitude-amplitude coupling in nonstationary, nonlinear signals

    Science.gov (United States)

    Yeh, Chien-Hung; Lo, Men-Tzung; Hu, Kun

    2016-07-01

    Recent studies of brain activities show that cross-frequency coupling (CFC) plays an important role in memory and learning. Many measures have been proposed to investigate the CFC phenomenon, including the correlation between the amplitude envelopes of two brain waves at different frequencies - cross-frequency amplitude-amplitude coupling (AAC). In this short communication, we describe how nonstationary, nonlinear oscillatory signals may produce spurious cross-frequency AAC. Utilizing the empirical mode decomposition, we also propose a new method for assessment of AAC that can potentially reduce the effects of nonlinearity and nonstationarity and, thus, help to avoid the detection of artificial AACs. We compare the performances of this new method and the traditional Fourier-based AAC method. We also discuss the strategies to identify potential spurious AACs.

  16. Between prohibition and proof of need

    International Nuclear Information System (INIS)

    This article discusses the consequences of new Swiss legislation on the use of chloro-fluoro-carbons (CFC) in refrigeration and air-conditioning units. In particular, the initial replacement of refrigerants that deplete the ozone layer with CFC products is discussed and the climate warming issues associated with global warming potential of these CFCs are examined. The measures set out in the new materials decree that bans substances with a long-term stability in certain appliances and that demands the adherence to the newest technical standards for operation and maintenance are described. The options of refraining from using cooling apparatus at all or the use of other possible solutions for meeting cooling needs using natural working fluids are discussed and the associated problems are discussed. The article is completed with a table giving figures on ecological impact of various substances and a summary of current regulations

  17. Upgrading of refrigeration units in nuclear power plant: An optimized approach to do justice to governmental restrictions

    International Nuclear Information System (INIS)

    Stringent regulations to reduce the use of chlorofluorocarbons (CFC) and halogenated chlorofluorocarbons (HCFC) have been set into force by many European countries. A ban for new plants containing HCFCs in 2005 and a total ban of HCFCs in 2020 are discussed within the European Community. Siemens-KWU and Sulzer Escher Wyss have developed a well-proofed procedure to solve the CFC problem for existing refrigeration systems in nuclear power plants. The new refrigerants are fluorinated hydrocarbons and for the centrifugal water chiller R134a is best suited. Prior to the market introduction toxicity, short and long term health effects, inflammability and stability of R134a have been investigated. The mechanical examination included wear, corrosion, lubrication and resistance to decomposition. A well-proven procedure was established which ensures the owner of the plant and the supplier best results

  18. AcEST: BP921485 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|A5CER5|MURA_ORITB UDP-N-acetylglucosamine 1-carboxyvinyltrans... 30 8.3 sp|A8...9 >sp|A8MCK2|PURL_CALMQ Phosphoribosylformylglycinamidine synthase 2 OS=Caldivirga maquilingensis (strain...... 35 1.6 tr|Q2CFC7|Q2CFC7_9RHOB Probable aminotransferase OS=Oceanicola g... 35 2.1 tr|Q6T... OS=Mus m... 32 2.2 sp|A8MCK2|PURL_CALMQ Phosphoribosylformylglycinamidine synthase ... 32 2.2 sp|Q86WK7|AMGO3_HUMAN Amphoterin...ic region OS=Sorang... 34 4.5 tr|A1ZW22|A1ZW22_9SPHI Protein tyrosine kinase OS=Microscilla ma... 33 5.8 tr|

  19. Relationship between the merit factor of thermoelectric materials and the air conditioning unit of urban electric cars

    International Nuclear Information System (INIS)

    The main benefit of electric cars is to reduce air pollution in cities that is thus desirable to equip them with non polluting air conditioning units and this rules out frigorific compressors operating with CFC. The planned replacement of CFC by HFC is at best an interim solution. The best solution is certainly to use thermoelectric air conditioning units, which are inherently pollution-free. However, these have a fairly low COPF when compared to traditional compressor units. We study the relationship between the cooling of the interior of urban electric cars and the merit factor of the thermoelectric material in their Peltier unit. This should help provide concrete target properties of future T E materials. copyright 1995 American Institute of Physics

  20. Upgrading of refrigeration units in nuclear power plant: An optimized approach to do justice to governmental restrictions

    Energy Technology Data Exchange (ETDEWEB)

    Gregor, Klaus [Siemens-KWU, Erlangen (Germany); Reinhart, Anton [Sulzer Escher Wyss, Lindau (Germany)

    1998-07-01

    Stringent regulations to reduce the use of chlorofluorocarbons (CFC) and halogenated chlorofluorocarbons (HCFC) have been set into force by many European countries. A ban for new plants containing HCFCs in 2005 and a total ban of HCFCs in 2020 are discussed within the European Community. Siemens-KWU and Sulzer Escher Wyss have developed a well-proofed procedure to solve the CFC problem for existing refrigeration systems in nuclear power plants. The new refrigerants are fluorinated hydrocarbons and for the centrifugal water chiller R134a is best suited. Prior to the market introduction toxicity, short and long term health effects, inflammability and stability of R134a have been investigated. The mechanical examination included wear, corrosion, lubrication and resistance to decomposition. A well-proven procedure was established which ensures the owner of the plant and the supplier best results.

  1. 氟利昂替代后吸入气雾剂(MDIs)的研究要求和进展Ⅱ抛射剂替代的MDIs的技术挑战和工业化生产%Transition of Propellants in Metered Dose Inhalers (MDIs) Ⅱ.Technical Challenge and Industrial Manufacture of Alternative Propellant MDIs

    Institute of Scientific and Technical Information of China (English)

    侯曙光; 魏农农; 金方

    2009-01-01

    吸入气雾剂(MDIs)中抛射剂氟利昂(CFC)的替代并非制剂中简单的辅料替换.综述了氢氟烷烃(HFA)替代CFC过程中所涉及的处方组成改变、工艺参数优化、给药装置的选择、制药设备的更新以及产业化过程中的特殊要求.%The propellant transition in metered dose inhalers (MDIs) is not a simple replacement of CFC by HFA in the formulations. This paper reviews the technical challenges for the development of alternative propellant MDIsincluding changes of formulation composition, optimization of product process, selection of container closure system,improvement of manufacture equipment, and requirements for industrial manufacture.

  2. Chapter 2. Chlorofluorocarbons in the atmosphere

    International Nuclear Information System (INIS)

    CFCs were predominantly consumed and released by industrialized nations between the latitudes of 30 deg. N and 70 deg. N (Hartley et al., 1996); therefore, the troposphere mixing ratios in the northern hemisphere historically have been higher than those of the southern hemisphere. However, with the phasing out of CFC production by the developed countries (Montreal Protocol on Substances that Deplete the Ozone Layer), the interhemispheric differences in the mixing ratios have appreciably decreased. Near urban areas, some CFC mixing ratios are often raised relative to background air composition. If these differences are neglected, then the calculated age of the water from these urban or densely populated sites will appear contaminated or younger than the actual recharge age of the groundwater

  3. Desiccant Cooling System for Thermal Comfort: A Review

    OpenAIRE

    HEMANT PARMAR; D.A. HINDOLIYA

    2011-01-01

    Desiccant cooling system (DCS) is alternate suitable option against conventional cooling system in humid climates. A typical system combines a dehumidifier that uses dry desiccant wheel, with direct or indirect evaporative systems and a sensible cooling system. DCS is the environmental protection technique for cooling purpose of the building. This system reduces the CFC level in the environment because it restricts the use of conventional refrigerant. In this paper, all the working principles...

  4. Memory reconsolidation allows the consolidation of a concomitant weak learning through a synaptic tagging and capture mechanism.

    Science.gov (United States)

    Cassini, Lindsey F; Sierra, Rodrigo O; Haubrich, Josué; Crestani, Ana P; Santana, Fabiana; de Oliveira Alvares, Lucas; Quillfeldt, Jorge A

    2013-10-01

    Motivated by the synaptic tagging and capture (STC) hypothesis, it was recently shown that a weak learning, only able to produce short-term memory (STM), can succeed in establishing long-term memory (LTM) with a concomitant, stronger experience. This is consistent with the capture, by the first-tagged event, of the so-called plasticity-related proteins (PRPs) provided by the second one. Here, we describe how a concomitant session of reactivation/reconsolidation of a stronger, contextual fear conditioning (CFC) memory, allowed LTM to result from a weak spatial object recognition (wSOR) training. Consistent with an STC process, the effect was observed only during a critical time window and was dependent on the CFC reconsolidation-related protein synthesis. Retrieval by itself (without reconsolidation) did not have the same promoting effect. We also found that the inactivation of the NMDA receptor by AP5 prevented wSOR training to receive this support of CFC reconsolidation (supposedly through the production of PRPs), which may be the equivalent of blocking the setting of a learning tag in the dorsal CA1 region for that task. Furthermore, either a Water Maze reconsolidation, or a CFC extinction session, allowed the formation of wSOR-LTM. These results suggest for the first time that a reconsolidation session can promote the consolidation of a concomitant weak learning through a probable STC mechanism. These findings allow new insights concerning the influence of reconsolidation in the acquisition of memories of otherwise unrelated events during daily life situations. PMID:23733489

  5. Recent development of ceria-based (nano)composite materials for low temperature ceramic fuel cells and electrolyte-free fuel cells

    OpenAIRE

    Fan, Liangdong; Wang, Chengyang; Chen, Mingming; Zhu, Bin

    2013-01-01

    In the last ten years, the research of solid oxide fuel cells (SOFCs) or ceramic fuel cells (CFC) had focused on reducing the working temperature through the development of novel materials, especially the high ionic conductive electrolyte materials. Many progresses on single-phase electrolyte materials with the enhanced ionic conductivity have been made, but they are still far from the criteria of commercialization. The studies of ceria oxide based composite electrolytes give an alternative s...

  6. Ex vivo expansions and transplantations of mouse bone marrow-derived hematopoietic stem/progenitor cells

    Institute of Scientific and Technical Information of China (English)

    WANG Jin-fu(王金福); WU Yi-fan(吴亦凡); HARRINTONG Jenny; McNIECE Ian K.

    2004-01-01

    To examine the effects of co-culture with bone marrow mesenchymal stem cells on expansion of hematopoietic stem/progenitor cells and the capacities of rapid neutrophil engraftment and hematopoietic reconstitution of the expanded cells, we expanded mononuclear cells (MNCs) and CD34+/c-kit+ cells from mouse bone marrow and transplanted the expanded cells into the irradiated mice. MNCs were isolated from mouse bone marrow and CD34+/c-kit+ cells were selected from MNCs by using MoFlo Cell Sorter. MNCs and CD34+/c-kit+ cells were co-cultured with mouse bone marrow-derived mesenchymal stem cells (MSCs) under a two-step expansion. The expanded cells were then transplanted into sublethally irradiated BDF1 mice. Results showed that the co-culture with MSCs resulted in expansions of median total nucleated cells,CD34+ cells, GM-CFC and HPP-CFC respectively by 10.8-, 4.8-, 65.9- and 38.8-fold for the mononuclear cell culture, and respectively by 76.1-, 2.9-, 71.7- and 51.8-fold for the CD34+/c-kit+ cell culture. The expanded cells could rapidly engraft in the sublethally irradiated mice and reconstitute their hematopoiesis. Co-cultures with MSCs in conjunction with two-step expansion increased expansions of total nucleated cells, GM-CFC and HPP-CFC, which led us to conclude MSCs may create favorable environment for expansions of hematopoietic stem/progenitor cells. The availability of increased numbers of expanded cells by the co-culture with MSCs may result in more rapid engraftment ofneutrophils following infusion to transplant recipients.

  7. Ex vivo expansions and transplantations of mouse bone marrow-derived hematopoietic stem/progenitor cells

    Institute of Scientific and Technical Information of China (English)

    王金福; 吴亦凡; HARRINTONGJenny; McNIECEIanK.

    2004-01-01

    To examine the effects of co-culture with bone marrow mesenchymal stem cells on expansion of hematopoietic tem/progenitor cells and the capacities of rapid neutrophil engraftment and hematopoietic reconstitution of the expanded ells, we expanded mononuclear cells (MNCs) and CD34+/c-kit+ cells from mouse bone marrow and transplanted the expanded cells into the irradiated mice. MNCs were isolated from mouse bone marrow and CD34+/c-kit+ cells were selected from MNCs by using MoFlo Cell Sorter. MNCs and CD34+/c-kit+ cells were co-cultured with mouse bone marrow-derived mesenchymal stem cells (MSCs) under a two-step expansion. The expanded cells were then transplanted into sublethally irradiated BDF 1 mice. Results showed that the co-culture with MSCs resulted in expansions of median total nucleated cells, CD34+ cells, GM-CFC and HPP-CFC respectively by 10.8-, 4.8-, 65.9- and 38.8-fold for the mononuclear cell culture, and respectively by 76.1-, 2.9-, 71.7- and 51.8-fold for the CD34+/c-kit+ cell culture. The expanded cells could rapidly engraft in the sublethally irradiated mice and reconstitute their hematopoiesis. Co-cultures with MSCs in conjunction with two-step expansion increased expansions of total nucleated cells, GM-CFC and HPP-CFC, which led us to conclude MSCs may create favorable environment for expansions of hematopoietic stem/progenitor cells. The availability of increased numbers of expanded ceils by the co-culture with MSCs may result in more rapid engraftment ofneutrophils following infusion to transplant recipients.

  8. Real-time Information, Uncertainty and Quantum Feedback Control

    OpenAIRE

    QI, BO; Dong, Daoyi; Chen, Chunlin; Liu, Lijun; Xi, Zairong

    2014-01-01

    Feedback is the core concept in cybernetics and its effective use has made great success in but not limited to the fields of engineering, biology, and computer science. When feedback is used to quantum systems, two major types of feedback control protocols including coherent feedback control (CFC) and measurement-based feedback control (MFC) have been developed. In this paper, we compare the two types of quantum feedback control protocols by focusing on the real-time information used in the f...

  9. Examination of Bacterial Characteristics of Anaerobic Membrane Bioreactors in Three Pilot-Scale Plants for Treating Low-Strength Wastewater by Application of the Colony-Forming-Curve Analysis Method

    OpenAIRE

    Kataoka, Naoaki; Tokiwa, Yutaka; Tanaka, Yasuo; Fujiki, Kiichi; Taroda, Hiroyuki; Takeda, Kiyoshi

    1992-01-01

    Characteristic sludge ecosystems arising in anaerobic membrane bioreactors of three pilot-scale plants treating low-strength (less than 1 g of biological oxygen demand per liter) sewage or soybean-processing wastewater were examined by analysis of the colony-forming-curves (CFC) obtained by counting colonies at suitable intervals. The wastewaters, containing high amounts of suspended solids (SS) (SS/chemical oxygen demand ratio, 0.51 to 0.80), were treated by using two types of bioreactors: (...

  10. Ulerythema ophryogenes: updates and insights.

    Science.gov (United States)

    Morton, Christopher M; Bhate, Chinmoy; Janniger, Camila K; Schwartz, Robert A

    2014-02-01

    Ulerythema ophryogenes is a rare cutaneous atrophic disorder that occasionally is associated with Noonan syndrome, de Lange syndrome, Rubinstein-Taybi syndrome, and cardiofaciocutaneous (CFC) syndrome. Often presenting in pediatric patients, the pathogenesis of ulerythema ophryogenes remains unclear, though several genetic causes have been suggested. Treatment recommendations remain anecdotal, but clearance has been noted as the patient ages. Although topical agents have been the mainstay of therapy, recent advancement in laser intervention for treatment of ulerythema ophryogenes is promising. PMID:24605344

  11. Experimental Investigation and Mathematical Modeling of Commercially Available R744 Compressors

    OpenAIRE

    Kurtulus, Orkan; Olgun, Burak; Oguz, Emre

    2012-01-01

    The vapor compression cycle using refrigerant CFC (chlorofluorocarbon) and HCFC (hydrochlorofluorocarbon) is widely used in refrigeration, air-conditioning and water heating industries. Utilization of these gases are prohibited by the Montreal Protocol. The critical temperature of carbon dioxide (CO2) is much lower than that of the other refrigerants, namely 31.06°C. The gas cooling process occurs at a constant pressure but at variable temperatures takes the place of the condensation process ...

  12. Development of a youth elixir; La mise en oeuvre d`un elixir de jouvence

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    This short paper presents a new refrigerant developed by Quiri Refrigeration company in collaboration with Electricite de France (EdF), which can replace the no-longer produced R-12 CFC. This substitute, called `youth elixir` is a mixture of HCFCs and has similar physical characteristics, is compatible with the R-12 and can be used in a similar pressure range. Its use requires to modify the existing installation but with a reasonable cost. (J.S.)

  13. INVESTIGATIONS ON THE PERFORMANCE OF VAPOUR COMPRESSION SYSTEM RETROFITTED WITH ZEOTROPIC REFRIGERANT R404A

    OpenAIRE

    A. Lovelin Jerald; D. SenthilKumaran

    2014-01-01

    The environmental impacts like global warming and ozone depletion has become a challenge to the refrigeration and air conditioning industry. Chloro Fluoro Carbons (CFCs) and Hydro Flouro Carbons (HCFCs) are referred to as an Ozone Depleting Substances (ODS) because once these gases are released into the environment and reach the stratosphere, depletes the ozone layer. This research paper aims to study the performance characteristics of an R12 (CFC) vapour compression refrigeration system retr...

  14. The Design and Performance Analysis of Refrigeration System Using R12 & R134a Refrigerants

    OpenAIRE

    K. Nagalakshmi; G. Marurhiprasad Yadav

    2014-01-01

    The design and performance analysis of refrigeration system using R12 & R134a refrigerants are presented in this report. The design calculations of the suitable and necessary refrigerator equipment and their results are also reported here. CFC-12 is the most widely used refrigerant. It serves both in residential and commercial applications, from small window units to large water chillers, and everything in between. Its particular combination of efficiency, capacity and pressur...

  15. EU Development of High Heat Flux Components

    OpenAIRE

    Linke, J.; Lorenzetto, P.; Majerus, P.; Merola, M.; Pitzer, D.; Rödig, M.

    2005-01-01

    The development of plasma facing components for next step fusion devices in Europe is strongly focused to ITER. Here a wide spectrum of different design options for the divertor target and the first wall have been investigated with tungsten, CFC, and beryllium armor. Electron beam simulation experiments have been used to determine the performance of high heat flux components under ITER specific thermal loads. Beside thermal fatigue loads with power density levels up to 20MWm(-2), off normal e...

  16. A STUDY OF THE REQUIRED PUBLIC ACCOUNTING PROGRAM IN PUBLIC COMPETITIVE EXAMINATIONS HELD BY CESPE

    OpenAIRE

    Fátima de Souza Freire; Thaise Corcino da Nóbrega; Matheus de Mendonça Marques; Ednei Morais Pereira

    2012-01-01

    With a view to standardizing the contents offered to future Accounting professionals, the Federal Accounting Council (CFC) elaborated the National Proposal for Undergraduate Accountancy Program Contents. Thus, the curriculum that Higher Education Institutions (HEI) adopt serves as an ally for students’ professional conquests. Stability and favorable job conditions attract many people to the dispute for a public function, with a growing Braz ilian public competitive examination market. Accordi...

  17. CRIPTO1 expression in EGFR-mutant NSCLC elicits intrinsic EGFR-inhibitor resistance

    OpenAIRE

    Park, Kang-Seo; Raffeld, Mark; Moon, Yong Wha; Xi, Liqiang; Bianco, Caterina; Van Pham, Trung; Lee, Liam C.; Mitsudomi, Tetsuya; Yatabe, Yasushi; Okamoto, Isamu; Subramaniam, Deepa; Mok, Tony; Rosell, Rafael; Luo, Ji; Salomon, David S.

    2014-01-01

    The majority of non–small cell lung cancer (NSCLC) patients harbor EGFR-activating mutations that can be therapeutically targeted by EGFR tyrosine kinase inhibitors (EGFR-TKI), such as erlotinib and gefitinib. Unfortunately, a subset of patients with EGFR mutations are refractory to EGFR-TKIs. Resistance to EGFR inhibitors reportedly involves SRC activation and induction of epithelial-to-mesenchymal transition (EMT). Here, we have demonstrated that overexpression of CRIPTO1, an EGF-CFC protei...

  18. PEMANASAN GLOBAL

    Directory of Open Access Journals (Sweden)

    Vivi Triana

    2008-03-01

    Full Text Available Pemanasan global (global warming pada dasarnya merupakan fenomena peningkatan temperature global dari tahun ke tahun karena terjadinya efek rumah kaca (greenhouse effect yang disebabkan oleh meningkatnya emisi gas-gas seperti karbondioksida (CO2, metana (CH4, dinitrooksida (N2O dan CFC sehingga energy matahari terperangkap dalam atmosfer bumi. Berbagai literatur menunjukkan kenaikan temperatur global termasuk Indonesia yang terjadi pada kisaran 1,5 – 40 °C pada akhir abad 21.

  19. Greenhouse effect: an issue for the refrigeration and air conditioning sector; Effet de serre: quelle problematique pour le froid et le conditionnement de l`air?

    Energy Technology Data Exchange (ETDEWEB)

    Billiard, F. [Institut International du Froid, 75 - Paris (France)

    1997-12-31

    The principles of greenhouse effect and the greenhouse gas main direct and indirect emission sources due to refrigeration and air conditioning systems are first reviewed. Evolution scenarios from 1992 to 2020 and 2100 for the emissions of CFC, HCFC and HFC are presented and related to the Kyoto protocol project limitations; technical improvements in refrigerating and air conditioning systems (lower refrigerant utilization, fluid confinement, alternative technologies, natural refrigerant utilization, etc.) could lead to substantial diminutions of these greenhouse gases

  20. A novel biomarker of amnestic MCI based on dynamic Cross-Frequency Coupling patterns during cognitive brain responses

    Directory of Open Access Journals (Sweden)

    Stavros I Dimitriadis

    2015-10-01

    Full Text Available The detection of mild cognitive impairment (MCI, the transitional stage between normal cognitive changes of aging and the cognitive decline caused by AD, is of paramount clinical importance, since MCI patients are at increased risk of progressing into AD. Electroencephalographic (EEG alterations in the spectral content of brainwaves and connectivity at resting state have been associated with early-stage AD. Recently, cognitive event-related potentials (ERPs have entered into the picture as an easy to perform screening test. Motivated by the recent findings about the role of cross-frequency coupling (CFC in cognition, we introduce a relevant methodological approach for detecting MCI based on cognitive responses from a standard auditory oddball paradigm. By using the single trial signals recorded at Pz sensor and comparing the responses to target and non-target stimuli, we first demonstrate that increased CFC is associated with the cognitive task. Then, considering the dynamic character of CFC, we identify instances during which the coupling between particular pairs of brainwave frequencies carries sufficient information for discriminating between normal subjects and patients with MCI. In this way, we form a multiparametric signature of impaired cognition. The new composite biomarker was tested using data from a cohort that consists of 25 amnestic MCI patients and 15 age-matched controls. Standard machine-learning algorithms were employed so as to implement the binary classification task. Based on leave-one-out cross-validation, the measured classification rate was found reaching very high levels (95%. Our approach compares favorably with the traditional alternative of using the morphology of averaged ERP response to make the diagnosis and the usage of features from spectro-temporal analysis of single-trial response. This further indicates that task-related CFC measurements can provide invaluable analytics in AD diagnosis and prognosis.

  1. Isolation and characterization of antimicrobial proteins produced by a potential probiotic strain of human Lactobacillus rhamnosus 231 and its effect on selected human pathogens and food spoilage organisms

    OpenAIRE

    Ambalam, P. S.; Prajapati, J. B.; Dave, J. M.; Nair, Baboo M.; Ljungh, Åsa; Vyas, B. R. M.

    2011-01-01

    Objective: To study in vitro properties of potential probiotics and the antimicrobial activity of Lactobacillus rhamnosus 231 isolated from human faeces. Methods and Results: Lact. rhamnosus 231 isolated from human faeces tolerated bile salt (4%), phenol (0.5%), and NaCl (4%) and retained viability at low pH (2.5). The cell-free culture (CFC) fi ltrate and extracellular protein concentrate (EPC) of Lact. rhamnosus 231 contained antimicrobial substances active against Pseudomonas aeruginosa, E...

  2. Dynamical spacetimes and gravitational radiation in a Fully Constrained Formulation

    Energy Technology Data Exchange (ETDEWEB)

    Cordero-Carrion, Isabel; Ibanez, Jose MarIa [Departamento de Astronomia y Astrofisica, Universidad de Valencia, C/ Dr. Moliner 50, E-46100 Burjassot, Valencia (Spain); Cerda-Duran, Pablo, E-mail: isabel.cordero@uv.e, E-mail: cerda@mpa-garching.mpg.d, E-mail: jose.m.ibanez@uv.e [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Strasse 1, D-85741 Garching (Germany)

    2010-05-01

    This contribution summarizes the recent work carried out to analyze the behavior of the hyperbolic sector of the Fully Constrained Formulation (FCF) derived in Bonazzola et al. 2004. The numerical experiments presented here allows one to be confident in the performances of the upgraded version of CoCoNuT's code by replacing the Conformally Flat Condition (CFC) approximation of the Einstein equations by the FCF.

  3. Gravitational waves in Fully Constrained Formulation in a dynamical spacetime with matter content

    Energy Technology Data Exchange (ETDEWEB)

    Cordero-Carrion, Isabel; Cerda-Duran, Pablo [Max-Planck-Institut fuer Astrophysik, Karl-Schwarzschild-Str. 1, D-85741, Garching (Germany); Ibanez, Jose MarIa, E-mail: chabela@mpa-garching.mpg.de, E-mail: cerda@mpa-garching.mpg.de, E-mail: jose.m.ibanez@uv.es [Departamento de AstronomIa y Astrofisica, Universidad de Valencia, C/ Dr. Moliner 50, E-46100 Burjassot, Valencia (Spain)

    2011-09-22

    We analyze numerically the behaviour of the hyperbolic sector of the Fully Constrained Formulation (FCF) (Bonazzola et al. 2004). The numerical experiments allow us to be confident in the performances of the upgraded version of the CoCoNuT code (Dimmelmeier et al. 2005) by replacing the Conformally Flat Condition (CFC), an approximation of Einstein equations, by FCF. First gravitational waves in FCF in a dynamical spacetime with matter content will be shown.

  4. New Delivery Systems and Propellants

    Directory of Open Access Journals (Sweden)

    Myrna Dolovich

    1999-01-01

    Full Text Available The removal of chlorofluorocarbon (CFC propellants from industrial and household products has been agreed to by over 165 countires of which more than 135 are developing countries. The timetable for this process is outlined in the Montreal Protocol on Substances that Deplete the Ozone Layer document and in several subsequent amendments. Pressured metered dose inhalers (pMDIs for medical use have been granted temporary exemptions until replacement formulations, providing the same medication via the same route, and with the same efficacy and safety profiles, are approved for human use. Hydrofluoroalkanes (HFAs are the alternative propellants for CFCs-12 and -114. Their potential for damage to the ozone layer is nonexistent, and while they are greenhouse gases, their global warming potential is a fraction (one-tenth of that of CFCs. Replacement formulations for almost all inhalant respiratory medications have been or are being produced and tested; in Canada, it is anticipated that the transition to these HFA or CFC-free pMDIs will be complete by the year 2005. Initially, an HFA pMDI was to be equivalent to the CFC pMDI being replaced, in terms of aerosol properties and effective clinical dose. However, this will not necessarily be the situation, particularly for some corticosteroid products. Currently, only one CFC-free formulation is available in Canada – Airomir, a HFA salbutamol pMDI. This paper discusses the in vitro aerosol characteristics, in vivo deposition and clinical data for several HFA pMDIs for which there are data available in the literature. Alternative delivery systems to the pMDI, namely, dry powder inhalers and nebulizers, are briefly reviewed.

  5. Factors Associated with Parental Perception of Child Vulnerability 12 months After Abnormal Newborn Screening Results

    OpenAIRE

    Tluczek, Audrey; McKechnie, Anne Chevalier; Brown, Roger L

    2011-01-01

    We identified factors associated with elevated parental perceptions of child vulnerability (PPCV) 12 months after newborn screening (NBS) of 136 children: healthy, normal results (H, n=37), cystic fibrosis carriers (CF-C, n=40), congenital hypothyroidism (CH, n=36), and cystic fibrosis (CF, n=23). Controlling for infant and parent characteristics, mixed logit structural equation modeling showed direct paths to PPCV included parent female sex, CF diagnosis, and high documented illness frequenc...

  6. Risk communication: Anthropogenically induced climatic changes

    International Nuclear Information System (INIS)

    In order to reduce the risk of the greenhouse effect, conventional thermal power plants should be substituted by maximum energy conservation, use of renewable energies, and low-risk, high-tech nuclear power plants. Motor traffic exhausts could be eliminated by alternative fuels, and trace gas reducers, such as tropical rain forests, preserved by financial adjustments. CFC's are to be reduced in any case in order to lower the ozone risk. (DG)

  7. Hematological effects of unilateral and bilateral exposures of dogs to 300-kVp X rays

    International Nuclear Information System (INIS)

    Accidental exposures to ionizing radiation from external sources usually result in an inhomogeneous dose distribution rather than a homogeneous total-body irradiation (TBI). To study the hematological effects of an inhomogeneous dose distribution, dogs were unilaterally exposed to a beam of 300 kVp X rays (HVL = 3.8 mm Cu) with their left side directed to the source. The entrance and exit surface doses were 3.8 Gy and 0.9 Gy, respectively. Dose measurements performed in bone marrow spaces of various bones revealed a maximum of 3.1 Gy in the head of the left humerus and a minimum of 0.9 Gy in the right iliac crest. Based on survival for granulocyte-macrophage progenitor cells (GM-CFC) determined in different bone marrow sites 24 h after the exposure, the dose-dependent reduction ranged from 0.44 to 16% of the control values. The regeneration of the GM-CFC compartments in the various bone marrow spaces showed patterns which were independent of each other up to Day 28. Values were normal again at Day 125 after exposure. For comparative purposes, three dogs were exposed bilaterally to achieve a homogeneous dose distribution. They received a TBI of 2.4 Gy, which according to previous calculations should have caused the same systemic damage to the GM-CFC compartment as the unilateral exposure. The peripheral blood cell changes, including the GM-CFC, and the colony stimulating activity in the serum showed a similar pattern for both exposures. These findings support the hypothesis that the overall survival fraction of progenitor cells in the bone marrow is the main determinant of the blood cell changes, independent of the anatomical distribution

  8. Hats off to CERN's Master of Apprenticeships ! Roland Gay of the HR Department (at right) recently received a special diploma from the Geneva Industrial Union (UIG).

    CERN Multimedia

    2004-01-01

    Presented by Carlo Lamprecht, Head of the Department of Economy, Employment and External Affairs of the State of Geneva, the diploma was awarded in recognition of the 199 CERN apprentices Roland has guided through the Certificat Fédéral de Capacité (CFC), an end-of-apprenticeship certificate awarded by the Cantonal authorities. Roland will be retiring in December 2004 after 37 years of service, 32 of which he spent in the role of apprenticeship supervisor.

  9. Oikeushenkilön asuinvaltio verotuksessa ja yrityksen kansainvÀlistyminen

    OpenAIRE

    Malmgrén, Marianne

    2008-01-01

    1 Aim of the study and research methods The purpose of this study is to review the essential corporate income tax issues related to expanding the business of a company abroad from four basic points of view. These are: - State of residence as the basis for tax liability; - Permanent establishment ( PE ) and tax liability; - The tax liability of a CFC; and - The impact of tax liability and the change in tax liability on the taxation of a company. In the study, resi...

  10. Mechanisms and Kinetics of Reactions of the O (1D,3p) + CF3Cl System

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ In the stratosphere, CF3Cl (CFC 13) can either photodecompose or react directly with atomic oxygen to generate ozone-depleting agents such as Cl and ClO in the gas phase[1-3]. Since the 1970s, attention has been focused on the effects of these compounds on the destruction of ozone in the stratosphere and on global warming[4,5].

  11. The Design and Performance Analysis of Refrigeration System Using R12 & R134a Refrigerants

    Directory of Open Access Journals (Sweden)

    K. Nagalakshmi

    2014-02-01

    Full Text Available The design and performance analysis of refrigeration system using R12 & R134a refrigerants are presented in this report. The design calculations of the suitable and necessary refrigerator equipment and their results are also reported here. CFC-12 is the most widely used refrigerant. It serves both in residential and commercial applications, from small window units to large water chillers, and everything in between. Its particular combination of efficiency, capacity and pressure has made it a popular choice for equipment designers. Nevertheless, it does have some ODP, so international law set forth in the Montreal Protocol has put CFC-12 on a phase out schedule.HFC-134a has been established as a drop-in alternative for CFC-12 in the industry due to their zero Ozone Depletion Potential (ODP and similarities in thermodynamic properties and performance. However, when a system is charged with a HFC-134a compressor oil has to be changed.Not enough research has been done to cover all aspects of alternative refrigerants applications in the systems. This project intended to explore behavior of this alternative refrigerants compare to CFC-12 and challenges the industry is facing in design, operation services and maintenance of these equipments.The purpose of this project is to investigate behavior of R134a refrigerant. This includes performance and efficiency variations when it replaces R12 in an existing system as well as changes involved in maintaining the system charged with R134a. This project is intended to address challenges faced in the real world and some practical issues. Theoretical and experimental approaches used as a methodology in this work.

  12. Proliferation, differentiation, and possible radiation-induced chromosome abnormalities in circulating hemopoietic stem cells

    International Nuclear Information System (INIS)

    The effects of atomic bomb radiation on hemopoietic stem cells were studied cytogenetically and from the aspect of differentiation and proliferation, using single colonies derived from human hemopoietic stem cells. The subjects studied were A-bomb survivors in the high dose exposure group (T65D 100 + rad) with a high incidence (10 % or more) of radiation-induced chromosome abnormalities in their peripheral lymphocytes, and their controls. Examinations were performed on 21 A-bomb survivors (10 males and 11 females) and 11 controls (5 males and 6 females). Colony formation of hemopoietic stem cells (granulocyte/monocyte-colony-forming cells, GM-CFC and burst-forming unit-erythrocytes, BFU-E) was made by the methylcellulose method patterned after the methods of Iscove et al and Ogawa et al using 5 - 10 ml of peripheral blood. Chromosome specimens were prepared from single colonies by the micromethod which we have reported elsewhere. The total number of colonies analyzed in the exposed group was 131 GM-CFC and 75 BFU-E. Chromosome abnormalities were observed in 15 (11.5 %) and 9 (12.0 %) colonies, respectively. In the control group, the total number of colonies analyzed was 61 GM-CFC and 41 BFU-E, but none of the colonies showed chromosome abnormalities. A highly significant difference in chromosome abnormalities was demonstrated by an exact test with a probability of 0.3 % for GM-CFC and 1.7 % for BFU-E. The karyotypes of chromosome abnormalities obtained from the colonies of hemopoietic stem cells in the exposed group were mostly translocations, but deletion and marker chromosomes were also observed. In two individuals, such karyotypic abnormalities as observed in the peripheral lymphocytes were seen also in the hemopoietic precursor cells. This finding suggests that radiation may produce an effect even on relatively undifferentiated hemopoietic stem cells. (author)

  13. Modelling of electromagnetic material properties at microwave frequencies

    OpenAIRE

    Alsadi, Majid Hamid Nassar

    2012-01-01

    In recent years, electromagnetic interference (EMI) has raised serious issues in terms of the unintentional radiation that disrupts the near proximity equipment from working properly. One solution to reduce the effects of EMI is the use of electromagnetic shielding. Carbon fibre composite (CFC) material is a promising customised product that has entered numerous industrial areas due to its attractive properties like high strength, low weight, and the resistance to chemical substances and corr...

  14. The CoCoNuT code: from neutron star oscillations to supernova explosions

    Science.gov (United States)

    Cerdá-Durán, P.; Gabler, M.; Müller, E.; Font, J. A.; Stergioulas, N.; Obergaulinger, M.; Aloy, M. A.; DeBrye, N.; Cordero-Carrión, I.; Ibáñez, J. M.

    2013-05-01

    CoCoNuT is a numerical code, that evolves the General relativistic magneto-hydrodynamics equations coupled to the Einstein equations in the CFC approximation. Its main purpose is to simulate astrophysical scenarios in which strong gravity is important such as the collapse of massive stars and the evolution of neutron stars. I review recent results of the numerical code regarding neutron star oscillations and core collapse supernova and its observational consequences.

  15. Dynamical spacetimes and gravitational radiation in a Fully Constrained Formulation

    CERN Document Server

    Cordero-Carrión, Isabel; Ibáñez, José María

    2010-01-01

    This contribution summarizes the recent work carried out to analyze the behavior of the hyperbolic sector of the Fully Constrained Formulation (FCF) derived in Bonazzola et al. 2004. The numerical experiments presented here allows one to be confident in the performances of the upgraded version of CoCoNuT's code by replacing the Conformally Flat Condition (CFC) approximation of the Einstein equations by the FCF.

  16. Re-evaluation of the lifetimes of the major CFCs and CH3CCl3 using atmospheric trends

    OpenAIRE

    J. W. Elkins; Krummel, P.B.; Mondeel, D. J.; D. Nance; G. S. Dutton; Hall, B D; P. G. Simmonds; Young, D.; Weiss, R. F.; P. K. Salameh; Mühle, J.; C. M. Harth; McCulloch, A; Montzka, S. A.; S. O'Doherty

    2012-01-01

    Since the Montreal Protocol on substances that deplete the ozone layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements beg...

  17. Past changes in the vertical distribution of ozone - Part 1: Measurement techniques, uncertainties and availability

    OpenAIRE

    Hassler, B.; Petropavlovskikh, I; J. Staehelin; August, T.; Bhartia, P. K.; Clerbaux, Cathy; Degenstein, D.; De Mazière, M.; DINELLI, B. M.; Dudhia, A.; Dufour, G.; Frith, S. M.; Froidevaux, L.; Godin-Beekmann, Sophie; Granville, J.

    2014-01-01

    Peak stratospheric chlorofluorocarbon (CFC) and other ozone depleting substance (ODS) concentrations were reached in the mid to late 1990s. Detection and attribution of the expected recovery of the stratospheric ozone layer in an atmosphere with reduced ODSs as well as efforts to understand the evolution of stratospheric ozone in the presence of increasing greenhouse gases are key current research topics. These require a critical examination of the ozone changes with an accurate knowledge of ...

  18. Past changes in the vertical distribution of ozone - Part 1: Measurement techniques, uncertainties and availability

    OpenAIRE

    Hassler, B.; Petropavlovskikh, I; J. Staehelin; August, T.; Bhartia, P. K.; Clerbaux, C.; Degenstein, D.; De Mazière, M.; DINELLI, B. M.; Dudhia, A.; Dufour, G.; Frith, S. M.; Froidevaux, L.; S. Godin-Beekmann; Granville, J.

    2014-01-01

    Peak stratospheric chlorofluorocarbon (CFC) and other ozone depleting substance (ODS) concentrations were reached in the mid- to late 1990s. Detection and attribution of the expected recovery of the stratospheric ozone layer in an atmosphere with reduced ODSs as well as efforts to understand the evolution of stratospheric ozone in the presence of increasing greenhouse gases are key current research topics. These require a critical examination of the ozone ch...

  19. Re-evaluation of the lifetimes of the major CFCs and CH[subscript 3]CCl[subscript 3] using atmospheric trends

    OpenAIRE

    Rigby, M.; R. G. Prinn; S. O'Doherty; Montzka, S. A.; McCulloch, A; C. M. Harth; Mühle, J.; P. K. Salameh; Weiss, R. F.; Young, D.; P. G. Simmonds; Hall, B D; G. S. Dutton; D. Nance; Mondeel, D. J.

    2013-01-01

    Since the Montreal Protocol on Substances that Deplete the Ozone Layer and its amendments came into effect, growth rates of the major ozone depleting substances (ODS), particularly CFC-11, -12 and -113 and CH3CCl3, have declined markedly, paving the way for global stratospheric ozone recovery. Emissions have now fallen to relatively low levels, therefore the rate at which this recovery occurs will depend largely on the atmospheric lifetime of these compounds. The first ODS measurements began ...

  20. Human response to global change

    International Nuclear Information System (INIS)

    Alertness of the global climate and environment change triggered by the effects of the economy of waste of industrial modern society has been raised to governments and populations. World-wide agreements and protocols have been established; they will be improved for action in two major issues: limitation (elimination of CFC's use, reductions of CO2 emissions, increasing energy efficiency, etc.) and adaptation (socio economic impacts, human behaviour, enhancement of predictive models, etc.)

  1. Boilers, evaporators, and condensers

    International Nuclear Information System (INIS)

    This book reports on the boilers, evaporators and condensers that are used in power plants including nuclear power plants. Topics included are forced convection for single-phase side heat exchangers, heat exchanger fouling, industrial heat exchanger design, fossil-fuel-fired boilers, once through boilers, thermodynamic designs of fossil fuel-first boilers, evaporators and condensers in refrigeration and air conditioning systems (with respect to reducing CFC's) and nuclear steam generators

  2. Ozone friendly HFC134a/HC mixture compatible with mineral oil in refrigeration system improves energy efficiency of a walk in cooler

    International Nuclear Information System (INIS)

    In the event of chloro fluorocarbon (CFC) phase out, identifying a long term alternative to meet all our requirements in respect of system performance and service is an important area for research in the refrigeration and air conditioning (RAC) sector. Even though HFC134a and the HC blend (containing 55.2% HC600a and 44.8% HC290) have been reported to be substitutes for CFC12, they have their own drawbacks in energy efficiency, flammability and serviceability aspects of the system. HFC134a is not miscible with mineral oil, and hence, polyol ester oil is recommended, which is highly hygroscopic in nature. This hygroscopicity demands stringent service practices, which otherwise results in moisture entry into the system. On the other hand, the HC blend has flammability issues, and hence, the charge quantity in systems is limited by safety standards. This work focuses on experimentally studying the performance of an ozone friendly refrigerant mixture (containing HFC134a/HC600a/HC290) in a walk in cooler, operating with an open type compressor with mineral oil as lubricant. To have a realistic comparison of the new mixture performance, tests were conducted with the conventional refrigerant (CFC12) for the system behaviour, such as no load pull down time, motor power, energy consumption, ON and OFF cycle time, temperature distribution along the coil and COP. The performance of the system with the new mixture was studied and compared. The oil miscibility of the new mixture with mineral oil was also studied and found to be good. It is observed that the mixture has better performance, resulting in 28.6% less energy consumption than CFC12. The enhancement in COP was 6-10%

  3. Operation plans for reducing greenhouse effect gas emissions

    International Nuclear Information System (INIS)

    The European Fluorocarbon Technical Committee (EFCTC) is presenting an operation project for air conditioning, refrigerating, foam, etc. industries that use fluorocarbons (CFC, HCFC, HFC), in order to market safe and high performance products, through various means: cooperation between industries and government for reducing greenhouse gas emissions (such as concerning leakage rate in refrigeration or gas inter-dependency effects), energy conservation measures, thermal insulation measures in building, and technological cooperation with developing countries

  4. CMSAF products Cloud Fraction Coverage and Cloud Type used for solar global irradiance estimation

    Science.gov (United States)

    Badescu, Viorel; Dumitrescu, Alexandru

    2016-08-01

    Two products provided by the climate monitoring satellite application facility (CMSAF) are the instantaneous Cloud Fractional Coverage (iCFC) and the instantaneous Cloud Type (iCTY) products. Previous studies based on the iCFC product show that the simple solar radiation models belonging to the cloudiness index class n CFC = 0.1-1.0 have rRMSE values ranging between 68 and 71 %. The products iCFC and iCTY are used here to develop simple models providing hourly estimates for solar global irradiance. Measurements performed at five weather stations of Romania (South-Eastern Europe) are used. Two three-class characterizations of the state-of-the-sky, based on the iCTY product, are defined. In case of the first new sky state classification, which is roughly related with cloud altitude, the solar radiation models proposed here perform worst for the iCTY class 4-15, with rRMSE values ranging between 46 and 57 %. The spreading error of the simple models is lower than that of the MAGIC model for the iCTY classes 1-4 and 15-19, but larger for iCTY classes 4-15. In case of the second new sky state classification, which takes into account in a weighted manner the chance for the sun to be covered by different types of clouds, the solar radiation models proposed here perform worst for the cloudiness index class n CTY = 0.7-0.1, with rRMSE values ranging between 51 and 66 %. Therefore, the two new sky state classifications based on the iCTY product are useful in increasing the accuracy of solar radiation models.

  5. A novel biomarker of amnestic MCI based on dynamic cross-frequency coupling patterns during cognitive brain responses.

    Science.gov (United States)

    Dimitriadis, Stavros I; Laskaris, Nikolaos A; Bitzidou, Malamati P; Tarnanas, Ioannis; Tsolaki, Magda N

    2015-01-01

    The detection of mild cognitive impairment (MCI), the transitional stage between normal cognitive changes of aging and the cognitive decline caused by AD, is of paramount clinical importance, since MCI patients are at increased risk of progressing into AD. Electroencephalographic (EEG) alterations in the spectral content of brainwaves and connectivity at resting state have been associated with early-stage AD. Recently, cognitive event-related potentials (ERPs) have entered into the picture as an easy to perform screening test. Motivated by the recent findings about the role of cross-frequency coupling (CFC) in cognition, we introduce a relevant methodological approach for detecting MCI based on cognitive responses from a standard auditory oddball paradigm. By using the single trial signals recorded at Pz sensor and comparing the responses to target and non-target stimuli, we first demonstrate that increased CFC is associated with the cognitive task. Then, considering the dynamic character of CFC, we identify instances during which the coupling between particular pairs of brainwave frequencies carries sufficient information for discriminating between normal subjects and patients with MCI. In this way, we form a multiparametric signature of impaired cognition. The new composite biomarker was tested using data from a cohort that consists of 25 amnestic MCI patients and 15 age-matched controls. Standard machine-learning algorithms were employed so as to implement the binary classification task. Based on leave-one-out cross-validation, the measured classification rate was found reaching very high levels (95%). Our approach compares favorably with the traditional alternative of using the morphology of averaged ERP response to make the diagnosis and the usage of features from spectro-temporal analysis of single-trial responses. This further indicates that task-related CFC measurements can provide invaluable analytics in AD diagnosis and prognosis. PMID:26539070

  6. Beryllium Concentrations at European Workplaces: Comparison of ‘Total’ and Inhalable Particulate Measurements

    OpenAIRE

    Kock, Heiko; Civic, Terence; Koch, Wolfgang

    2015-01-01

    A field study was carried out in order to derive a factor for the conversion of historic worker exposure data on airborne beryllium (Be) obtained by sampling according to the 37-mm closed faced filter cassette (CFC) ‘total’ particulate method into exposure concentration values to be expected when sampling using the ‘Gesamtstaubprobenahmesystem’ (GSP) inhalable sampling convention. Workplaces selected to represent the different copper Be work processing operations that typically occur in Germa...

  7. Cripto-1 overexpression is involved in the tumorigenesis of nasopharyngeal carcinoma

    OpenAIRE

    Li Xiangping; Weng Desheng; Wu Lirong; Li Gang; Wu Zhengrong; Yao Kaitai

    2009-01-01

    Abstract Background Human Cripto-1, a member of the EGF-CFC family, is indispensable for early embryonic development. Cripto-1 plays an important oncogenic role during tumorigenesis and is overexpressed in a wide range of epithelial carcinomas, yet little is known about Cripto-1 in nasopharyngeal carcinoma (NPC). The aim of this study was to analyze the roles of Cripto-1 in the progression and clinical characteristics in NPC clinical samples and cell lines. Methods The expression of Cripto-1 ...

  8. Greenhouse effect of chlorofluorocarbons and other trace gases

    OpenAIRE

    Hansen, James; Lacis, Andrew; Prather, Michael

    1989-01-01

    We compare the radiative (greenhouse) forcing of the climate system due to changes of atmospheric chlorofluorocarbons and other trace gases. We find that CFCs, defined to include chlorofluorocarbons, chlorocarbons, and fluorocarbons, now provide about one-quarter of current annual increases in anthropogenic greenhouse climate forcing. If the growth rates of CFC production in the early 1970s had continued to the present, current annual growth of climate forcing due to CFCs would exceed that du...

  9. Greenhouse effect of chlorofluorocarbons and other trace gases

    Science.gov (United States)

    Hansen, James; Lacis, Andrew; Prather, Michael

    1989-01-01

    A comparison is made of the radiative (greenhouse) forcing of the climate system due to changes of atmospheric chlorofluorocarbons and other trace gases. It is found that CFCs, defined to include chlorofluorocarbons, chlorocarbons, and fluorocarbons, now provide about one-quater of current annual increases in anthropogenic greenhouse climate forcing. If the growth rates of CFC production in the early 1970s had continued to the present, current annual growth of climate forcing due to CFCs would exceed that due to CO2.

  10. Use of inflammable refrigerants - fire protection aspects; Einsatz von brennbaren Kaeltemitteln - Damit nichts anbrennt

    Energy Technology Data Exchange (ETDEWEB)

    Hainbach, C.; Krug, N. [Institut fuer Kaelte-, Klima-, Energie-Technik GmbH, Essen (Germany)

    1998-12-07

    Even at the beginning of the CFC period, hydrocarbons were an alternative but they were displaced after 1930 because of their inflammability and higher cost. [Deutsch] Zu Beginn des Einsatzes von FCKW-Kaeltemitteln waren die Kohlenwasserstoffe immer schon eine Alternative. Aufgrund ihrer Brennbarkeit, aber auch durch die preiswertere Alternative der ab 1930 verwendeten sogenannten Sicherheitskaeltemittel gerieten die Kohlenwasserstoffe dann lange Zeit in Vergessenheit. (orig.)

  11. Effects of intra-infralimbic prefrontal cortex injections of cannabidiol in the modulation of emotional behaviors in rats: contribution of 5HT₁A receptors and stressful experiences.

    Science.gov (United States)

    Marinho, A L Z; Vila-Verde, C; Fogaça, M V; Guimarães, F S

    2015-06-01

    The infralimbic (IL) and prelimbic (PL) regions of the prefrontal cortex are involved in behavioral responses observed during defensive reactions. Intra-PL or IL injections of cannabidiol (CBD), a major non-psychotomimetic cannabinoid present in the Cannabis sativa plant, result in opposite behavioral effects in the contextual fear conditioning (CFC) paradigm. The intra-PL effects of CBD are mediated by 5HT1A receptors and depend on previous stressful experiences but the mechanisms and effects of intra-IL CBD injected are unknown. To this aim the present work verified the effects of intra-IL administration of CBD on two animal models of anxiety, the elevated plus maze (EPM) and CFC. We also investigated if these effects were mediated by 5HT1A receptors and depended on previous stressful experience. Male Wistar rats received bilateral microinjections of vehicle, WAY100635 (5HT1A receptor antagonist, 0.37 nmol) and/or CBD (15, 30 or 60 nmol) before being submitted to the behavioral tests. Intra-IL CBD induced anxiolytic and anxiogenic in the EPM and CFC, respectively. To verify if these effects are influenced by the previous stressful experience (footshocks) in the CFC model, we tested the animals in the EPM 24h after a 2-h restraint period. The anxiolytic-like effect of CBD in the EPM disappeared when the animals were previously stressed. Both responses, i.e., anxiolytic and anxiogenic, were prevented by WAY100635, indicating that they involve local 5HT1A-mediated neurotransmission. Together these results indicate that CBD effects in the IL depend on the nature of the animal model, being influenced by previous stressful experiences and mediated by facilitation of 5HT1A receptors-mediated neurotransmission. PMID:25701682

  12. Autism traits in the RASopathies

    OpenAIRE

    Adviento, B; Corbin, IL; Widjaja, F; Desachy, G; Enrique, N.; Rosser, T.; Risi, S; Marco, EJ; Hendren, RL; Bearden, CE; Rauen, KA; Weiss, LA

    2013-01-01

    Background Mutations in Ras/mitogen-activated protein kinase (Ras/MAPK) pathway genes lead to a class of disorders known as RASopathies, including neurofibromatosis type 1 (NF1), Noonan syndrome (NS), Costello syndrome (CS), and cardio-facio-cutaneous syndrome (CFC). Previous work has suggested potential genetic and phenotypic overlap between dysregulation of Ras/MAPK signalling and autism spectrum disorders (ASD). Although the literature offers conflicting evidence for association of NF1 and...

  13. A manual for a Laboratory Information Management System (LIMS) for light stable isotopes

    Science.gov (United States)

    Coplen, Tyler B.

    1998-01-01

    The reliability and accuracy of isotopic data can be improved by utilizing database software to (i) store information about samples, (ii) store the results of mass spectrometric isotope-ratio analyses of samples, (iii) calculate analytical results using standardized algorithms stored in a database, (iv) normalize stable isotopic data to international scales using isotopic reference materials, and (v) generate multi-sheet paper templates for convenient sample loading of automated mass-spectrometer sample preparation manifolds. Such a database program is presented herein. Major benefits of this system include (i) an increase in laboratory efficiency, (ii) reduction in the use of paper, (iii) reduction in workload due to the elimination or reduction of retyping of data by laboratory personnel, and (iv) decreased errors in data reported to sample submitters. Such a database provides a complete record of when and how often laboratory reference materials have been analyzed and provides a record of what correction factors have been used through time. It provides an audit trail for stable isotope laboratories. Since the original publication of the manual for LIMS for Light Stable Isotopes, the isotopes 3 H, 3 He, and 14 C, and the chlorofluorocarbons (CFCs), CFC-11, CFC-12, and CFC-113, have been added to this program.

  14. Impact of cryopreservation on tetramer, cytokine flow cytometry, and ELISPOT

    Directory of Open Access Journals (Sweden)

    Morse Michael A

    2005-07-01

    Full Text Available Abstract Background Cryopreservation of PBMC and/or overnight shipping of samples are required for many clinical trials, despite their potentially adverse effects upon immune monitoring assays such as MHC-peptide tetramer staining, cytokine flow cytometry (CFC, and ELISPOT. In this study, we compared the performance of these assays on leukapheresed PBMC shipped overnight in medium versus cryopreserved PBMC from matched donors. Results Using CMV pp65 peptide pool stimulation or pp65 HLA-A2 tetramer staining, there was significant correlation between shipped and cryopreserved samples for each assay (p ≤ 0.001. The differences in response magnitude between cryopreserved and shipped PBMC specimens were not significant for most antigens and assays. There was significant correlation between CFC and ELISPOT assay using pp65 peptide pool stimulation, in both shipped and cryopreserved samples (p ≤ 0.001. Strong correlation was observed between CFC (using HLA-A2-restricted pp65 peptide stimulation and tetramer staining (p Conclusion We conclude that all three assays show concordant results on shipped versus cryopreserved specimens, when using a peptide-based readout. The assays are also concordant with each other in pair wise comparisons using equivalent antigen systems.

  15. Accelerated line-by-line calculations for the radiative transfer of trace gases related to climate studies

    International Nuclear Information System (INIS)

    In the present study we are studying the effects of including carbon dioxide, ozone, methane, and the halocarbons in addition to water vapor in the radiating atmosphere. The study has focused on two principal issues: the effect on the spectral fluxes and cooling rates of carbon dioxide, ozone and the halocarbons at 1990 concentration levels and the change in fluxes and cooling rates as a consequence of the anticipated ten year change in the profiles of these species. For the latter study the water vapor profiles have been taken as invariant in time. The radiative line-by-line calculations using LBLRTM (Line-By-Line Radiative Transfer Model) have been performed for tropical (TRP), mid-latitude winter (MLW) and mid-latitude summer (MLS) model atmospheres. The halocarbons considered in the present study are CCl4, CFC-11, CFC-12 and CFC-22. In addition to considering the radiative effects of carbon dioxide at 355 ppM, the assumed current level, we have also obtained results for doubled carbon dioxide at 710 ppM. An important focus of the current research effort is the effect of the ozone depletion profile on atmospheric radiative effects

  16. Composites for nuclear core application at temperatures above 800 deg

    International Nuclear Information System (INIS)

    Full text of publication follows. Composite materials, specifically carbon fibre/carbon matrix (CFC), and silicon carbide fibre/silicon carbide matrix (SiC/SiC) have been considered for both fusion and fission core applications for over a decade. Both the potential benefits, such as their very high operating temperatures, and their drawbacks, such as the lack of understanding of how to design using these materials, are well known. Less well known has been the performance under the extreme conditions of a reactor core, most importantly neutrons. For the past few decades the performance of both CFC's and SiC/SiC composites have been studied under low and intermediate temperature irradiation conditions and their properties are well understood. Moreover, a determined programme of materials development has produced materials which are fairly insensitive to irradiation. This paper will present a short review of the performance of the more irradiation-tolerant,, SiC/SiC and CFC materials at low and intermediate temperatures. Moreover it will present new information on the behaviour of these materials at temperatures greater than 900 deg C. (authors)

  17. Experimental verification of FOREV-2D simulations for the plasma shield

    International Nuclear Information System (INIS)

    Analysis of experiments in the MK-200UG facility dedicated to verify the FOREV-2D simulations of ITER core contamination with carbon vaporized during ELMs has been performed. In these experiments the carbon fibre composite (CFC) of NB31 grade have been treated with plasma heat fluxes relevant for ITER ELMs. The analysis revealed that thin layer of few hundred microns on CFC surface is damaged and its thermoconductivity effectively reduced approximately three times, but the CFC bulk has the reference thermoconductivity. Good agreement between the measured and the calculated profiles for carbon plasma electron density at various hydrogen plasma heat loads as well as the agreement between the measured and the simulated dependences of the absorbed energy density on the applied heat load provide reliable validation of the carbon plasma shields simulated with the FOREV-2D code. High carbon plasma shield densities of 1023-1024 m-3 predicted in the simulations for ELM-produced shields has been proved in these MK-200UG experiments.

  18. Recurrent fuzzy neural network by using feedback error learning approaches for LFC in interconnected power system

    International Nuclear Information System (INIS)

    In this study, a new adaptive controller based on modified feedback error learning (FEL) approaches is proposed for load frequency control (LFC) problem. The FEL strategy consists of intelligent and conventional controllers in feedforward and feedback paths, respectively. In this strategy, a conventional feedback controller (CFC), i.e. proportional, integral and derivative (PID) controller, is essential to guarantee global asymptotic stability of the overall system; and an intelligent feedforward controller (INFC) is adopted to learn the inverse of the controlled system. Therefore, when the INFC learns the inverse of controlled system, the tracking of reference signal is done properly. Generally, the CFC is designed at nominal operating conditions of the system and, therefore, fails to provide the best control performance as well as global stability over a wide range of changes in the operating conditions of the system. So, in this study a supervised controller (SC), a lookup table based controller, is addressed for tuning of the CFC. During abrupt changes of the power system parameters, the SC adjusts the PID parameters according to these operating conditions. Moreover, for improving the performance of overall system, a recurrent fuzzy neural network (RFNN) is adopted in INFC instead of the conventional neural network, which was used in past studies. The proposed FEL controller has been compared with the conventional feedback error learning controller (CFEL) and the PID controller through some performance indices

  19. Mothers’ Participation and Compliance toward the Improvement of the Infants’ Nutritional in Community Feeding Center Lagarutu Palu

    Directory of Open Access Journals (Sweden)

    Nurdin Rahman

    2016-06-01

    Full Text Available Nutrition is one of the indicators in building the qualified human resources. Nationally, the prevalence of malnutrition is 19,6%. This shows that the problem of malnutrition in Indonesia is still a public health problem. In Palu Province, malnutrition is also a health problem that continues to be handled. Community Feeding Center is a program of the government in tackling the cases of malnutrition through the supplementary feeding and education in the mothers. This study was aimed to determine the relationship between the mothers’ participation and compliance in giving supplementary feeding with improved nutritional status of infants in CFC Lagarutu. The type of this research is in the form of analytic survey with cross sectional approach with 31 samples taken by purposive sampling technique. The data were analyzed using Chi-square test with α 5%. The research was conducted in April-June 2015. The results show that no relationship between the participation (p=0,001 and the improvement of the infants’ nutritional status, where the more active of the mothers in the CFC program, the more improvement of the infants’ nutritional status. There is a relationship between the compliance and the improved nutritional status (p=0,000, where the more obedient of the mothers in giving supplementary feeding, the more improvement of the infants’ nutritional status. It is recommended to the mothers to always be active in the CFC program and dutifully provide supplementary food to their children in order to improve the nutritional status of infants.

  20. Release and fate of fluorocarbons in a shredder residue landfill cell: 1. Laboratory experiments.

    Science.gov (United States)

    Scheutz, Charlotte; Fredenslund, Anders M; Nedenskov, Jonas; Kjeldsen, Peter

    2010-11-01

    The shredder residues from automobiles, home appliances and other metal-containing products are often disposed in landfills, as recycling technologies for these materials are not common in many countries. Shredder waste contains rigid and soft foams from cushions and insulation panels blown with fluorocarbons. The objective of this study was to use laboratory experiments to estimate fluorocarbon release and attenuation processes in a monofill shredder residue (SR) landfill cell. Waste from the open SR landfill cell at the AV Miljø landfill in Denmark was sampled at three locations. The waste contained 1-3% metal and a relatively low fraction of rigid polyurethane (PUR) foam particles. The PUR waste contained less blowing agent (CFC-11) than predicted from a release model. However, CFC-11 was steadily released in an aerobic bench scale experiment. Anaerobic waste incubation bench tests showed that SRSR produced significant methane (CH(4)), but at rates that were in the low end of the range observed for municipal solid waste. Aerobic and anaerobic batch experiments showed that processes in SRSR potentially can attenuate the fluorocarbons released from the SRSR itself: CFC-11 is degraded under anaerobic conditions with the formation of degradation products, which are being degraded under CH(4) oxidation conditions prevailing in the upper layers of the SR. PMID:20435458

  1. Overview of the ITER-like wall project

    International Nuclear Information System (INIS)

    Work is in progress to completely replace, in 2008/9, the existing JET CFC tiles with a configuration of plasma facing materials consistent with the ITER design. The ITER-like wall (ILW) will be created with a combination of beryllium (Be), tungsten (W), W-coated CFC and Be-coated inconel tiles, with the material depending on the local anticipated heat flux and geometry. It is part of an integrated package of JET enhancements whose aim is to develop an understanding of the ITER materials issues and develop the techniques required to operate with inductive and advanced scenarios as close as possible to ITER parameters. Over 4000 tiles will be replaced and the ILW will accommodate additional heating up to at least 50 MW for 10 s. This paper describes the scientific background to the project, the technical objectives, the material configuration selected, the R and D behind the practical realization of the objectives and the generic problems associated with the Be tiles (power handling capacity and disruption induced eddy currents). One of the objectives is to maintain or improve the existing CFC tile power handling performance which has been achieved in most cases by hiding bolt holes, optimizing tile size and profile and introducing castellations on plasma facing surfaces

  2. Comparison of halocarbon measurements in an atmospheric dry whole air sample

    Directory of Open Access Journals (Sweden)

    George C. Rhoderick

    2015-11-01

    Full Text Available Abstract The growing awareness of climate change/global warming, and continuing concerns regarding stratospheric ozone depletion, will require continued measurements and standards for many compounds, in particular halocarbons that are linked to these issues. In order to track atmospheric mole fractions and assess the impact of policy on emission rates, it is necessary to demonstrate measurement equivalence at the highest levels of accuracy for assigned values of standards. Precise measurements of these species aid in determining small changes in their atmospheric abundance. A common source of standards/scales and/or well-documented agreement of different scales used to calibrate the measurement instrumentation are key to understanding many sets of data reported by researchers. This report describes the results of a comparison study among National Metrology Institutes and atmospheric research laboratories for the chlorofluorocarbons (CFCs dichlorodifluoromethane (CFC-12, trichlorofluoromethane (CFC-11, and 1,1,2-trichlorotrifluoroethane (CFC-113; the hydrochlorofluorocarbons (HCFCs chlorodifluoromethane (HCFC-22 and 1-chloro-1,1-difluoroethane (HCFC-142b; and the hydrofluorocarbon (HFC 1,1,1,2-tetrafluoroethane (HFC-134a, all in a dried whole air sample. The objective of this study is to compare calibration standards/scales and the measurement capabilities of the participants for these halocarbons at trace atmospheric levels. The results of this study show agreement among four independent calibration scales to better than 2.5% in almost all cases, with many of the reported agreements being better than 1.0%.

  3. Evidence for terrigenic SF6 in groundwater from basaltic aquifers, Jeju Island, Korea: Implications for groundwater dating

    Science.gov (United States)

    Koh, D.-C.; Plummer, L.N.; Busenberg, E.; Kim, Y.

    2007-01-01

    Measurements of the concentrations of dichlorodifluoromethane (CFC-12), tritium (3H), and sulfur hexafluoride (SF6) in groundwater from basaltic aquifers in Jeju Island, Korea, demonstrate a terrigenic source of SF6. Using a lumped-parameter dispersion model, groundwater was identified as young water (SF6 relative to CFC-12 and 3H concentrations for more than half of the samples. The non-atmospheric excess SF6 may have originated from terrigenic sources in relict volcanic fluids, which could have acquired SF6 from granites and basement rocks of the island during volcanic activity. Local excess anthropogenic sources of SF6 are unlikely. The SF6 age is biased young relative to the CFC-12 age, typically up to 20 years and as high as 30 years. This age bias is more pronounced in samples of groundwater older than 15 years. The presence of terrigenic SF6 can affect the entire dating range for groundwater in mixtures that contain a fraction of old water. ?? 2007 Elsevier B.V. All rights reserved.

  4. Extreme 13C depletion of CCl2F2 in firn air samples from NEEM, Greenland

    Directory of Open Access Journals (Sweden)

    T. Blunier

    2013-01-01

    Full Text Available A series of 12 high volume air samples collected from the S2 firn core during the North Greenland Eemian Ice Drilling (NEEM 2009 campaign have been measured for mixing ratio and stable carbon isotope composition of the chlorofluorocarbon CFC-12 (CCl2F2. While the mixing ratio measurements compare favorably to other firn air studies, the isotope results show extreme 13C depletion at the deepest measurable depth (65 m, to values lower than δ13C = −80‰ vs. VPDB (the international stable carbon isotope scale, compared to present day surface tropospheric measurements near −40‰. Firn air modeling was used to interpret these measurements. Reconstructed atmospheric time series indicate even larger depletions (to −120‰ near 1950 AD, with subsequent rapid enrichment of the atmospheric reservoir of the compound to the present day value. Mass-balance calculations show that this change is likely to have been caused by a large change in the isotopic composition of anthropogenic CFC-12 emissions, probably due to technological advances in the CFC production process over the last 80 yr, though direct evidence is lacking.

  5. Substitutes for potent green house gases. HFCs, PFCs and SF{sub 6}. Status report

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, P.H. [Dansk Teknologisk Institut (Denmark)

    1997-12-31

    CFCs (halogenated chlorofluorocarbons), HCFCs (hydrochlorofluorocarbons), HFCs (hydrofluorocarbons), PFCs (fluorocarbons) and SF{sub 6} (sulphur hexafluoride) are all artificial substances which were not to be found in nature until recently. In 1995 the Danish consumption of HFC substances was approximately 740 tonnes, where the corresponding amount of SF{sub 6} was about 17 tonnes. If the entire amount of these substances was released to to the atmosphere, the resulting impact would correspond to an increased emission of greenhouse gases, corresponding to approximately 1.5 million tonnes of CO{sub 2}. HFC substances would account for 73%, SF{sub 6} with 25% and PFC for 1%. This corresponds to approximately 2.6% of the Danish CO{sub 2} emission (nearly 60 million tonnes per year). This corresponds to about half of the aimed 6% reduction of CO{sub 2} emission attained by introduction of mandatory green taxes on CO{sub 2}. According to experience from the CFC programme it is possible to recover some CFC and send it to controlled destruction. From 1993 to 1996 the refrigeration industry, for instance, has returned a total amount of 163 tonnes of CFC refrigerant through the KMO organization (Koelebranchens Miljoe Ordning). Most of this has been destroyed and a small amount has been purified and recycled afterwards. Similarly, it is likely to believe that some HFC refrigerant will be returned through the KMO organization. (au) 11 refs., also published in Danish

  6. Ozone loss derived from balloon-borne tracer measurements and the SLIMCAT CTM

    Directory of Open Access Journals (Sweden)

    A. D. Robinson

    2004-11-01

    Full Text Available Balloon-borne measurements of CFC-11 (on flights of the DIRAC in situ gas chromatograph and the DESCARTES grab sampler, ClO and O3 were made during the 1999/2000 winter as part of the SOLVE-THESEO 2000 campaign. Here we present the CFC-11 data from nine flights and compare them first with data from other instruments which flew during the campaign and then with the vertical distributions calculated by the SLIMCAT 3-D CTM. We calculate ozone loss inside the Arctic vortex between late January and early March using the relation between CFC-11 and O3 measured on the flights, the peak ozone loss (1200 ppbv occurs in the 440–470 K region in early March in reasonable agreement with other published empirical estimates. There is also a good agreement between ozone losses derived from three independent balloon tracer data sets used here. The magnitude and vertical distribution of the loss derived from the measurements is in good agreement with the loss calculated from SLIMCAT over Kiruna for the same days.

  7. Precision Cleaning Verification of Nonvolatile Residues by Using Water, Ultrasonics, and Turbidity Analyses

    Science.gov (United States)

    Skinner, S. Ballou

    1991-01-01

    Chlorofluorocarbons (CFC's) in the atmosphere are believed to present a major environmental problem because they are able to interact with and deplete the ozone layer. NASA has been mandated to replace chlorinated solvents in precision cleaning, cleanliness verification, and degreasing of aerospace fluid systems hardware and ground support equipment. KSC has a CFC phase-out plan which provides for the elimination of over 90 percent of the CFC and halon use by 1995. The Materials Science Laboratory and KSC is evaluating four analytical methods for the determination of nonvolatile residues removal by water: (1) infrared analyses using an attenuated total reflectance; (2) surface tension analyses, (3) total organic content analyses, and (4) turbidity analyses. This research project examined the ultrasonic-turbidity responses for 22 hydrocarbons in an effect to determine: (1) if ultrasonics in heated water (70 C) will clean hydrocarbons (oils, greases, gels, and fluids) from aerospace hardware; (2) if the cleaning process by ultrasonics will simultaneously emulsify the removed hydrocarbons in the water; and (3) if a turbidimeter can be used successfully as an analytical instrument for quantifying the removal of hydrocarbons. Sixteen of the 22 hydrocarbons tested showed that ultrasonics would remove it at least 90 percent of the contaminated hydrocarbon from the hardware in 10 minutes or less giving a good ultrasonic-turbidity response. Six hydrocarbons had a lower percentage removal, a slower removal rate, and a marginal ultrasonic-turbidity response.

  8. Evaluation of non-azeotropic mixtures containing HFOs as potential refrigerants in refrigeration and high-temperature heat pump systems

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    With the increasing environmental concern on global warming, hydrofluoro-olefin (HFOs), possessing low GWP, has attracted great attention of many researchers recently. In this study, non-azeotropic mixtures composed of HFOs (HFO-1234yf, HFO-1234ze(z), HFO-1234ze(e) and HFO-1234zf) are developed to substitute for HFC-134a and CFC-114 in air-conditioning and high-temperature heat pump systems, respectively. The cycle performances were evaluated by an improved theoretical cy-cle evaluation methodology. The results showed that all the mixtures proposed herein were favorable refrigerants with excel-lent thermodynamic cycle performances. M1A presented lower discharge temperature and pressure ratio and higher COPc than that of HFC-134a. The volumetric cooling capacity was similar to HFC-134a. It can be served as a good environmentally friendly alternative to replace HFC-134a. M3H delivered similar discharge temperature as CFC-114 did. And the COPh was 3% higher. It exhibits excellent cycle performance in high-temperature heat pump and is a promising refrigerant to substitute for CFC-114. And the gliding temperature differences enable them to exhibit better coefficient of performance by matching the sink/source temperature in practice. Because the toxicity, flammability and other properties are not investigated in detail, ex-tensive toxicity and flammability testing needs to be conducted before they are used in a particular application.

  9. Design and Optimization of a Composite Canard Control Surface of an Advanced Fighter Aircraft under Static Loading

    Science.gov (United States)

    Shrivastava, Sachin; Mohite, P. M.

    2015-01-01

    The minimization of weight and maximization of payload is an ever challenging design procedure for air vehicles. The present study has been carried out with an objective to redesign control surface of an advanced all-metallic fighter aircraft. In this study, the structure made up of high strength aluminum, titanium and ferrous alloys has been attempted to replace by carbon fiber composite (CFC) skin, ribs and stiffeners. This study presents an approach towards development of a methodology for optimization of first-ply failure index (FI) in unidirectional fibrous laminates using Genetic-Algorithms (GA) under quasi-static loading. The GAs, by the application of its operators like reproduction, cross-over, mutation and elitist strategy, optimize the ply-orientations in laminates so as to have minimum FI of Tsai-Wu first-ply failure criterion. The GA optimization procedure has been implemented in MATLAB and interfaced with commercial software ABAQUS using python scripting. FI calculations have been carried out in ABAQUS with user material subroutine (UMAT). The GA's application gave reasonably well-optimized ply-orientations combination at a faster convergence rate. However, the final optimized sequence of ply-orientations is obtained by tweaking the sequences given by GA's based on industrial practices and experience, whenever needed. The present study of conversion of an all metallic structure to partial CFC structure has led to 12% of weight reduction. Therefore, the approach proposed here motivates designer to use CFC with a confidence.

  10. Modulation of Gene Expression in Contextual Fear Conditioning in the Rat

    Science.gov (United States)

    Macchi, Monica; Ciampini, Cristina; Bernardi, Rodolfo; Baldi, Elisabetta; Bucherelli, Corrado; Brunelli, Marcello; Scuri, Rossana

    2013-01-01

    In contextual fear conditioning (CFC) a single training leads to long-term memory of context-aversive electrical foot-shocks association. Mid-temporal regions of the brain of trained and naive rats were obtained 2 days after conditioning and screened by two-directional suppression subtractive hybridization. A pool of differentially expressed genes was identified and some of them were randomly selected and confirmed with qRT-PCR assay. These transcripts showed high homology for rat gene sequences coding for proteins involved in different cellular processes. The expression of the selected transcripts was also tested in rats which had freely explored the experimental apparatus (exploration) and in rats to which the same number of aversive shocks had been administered in the same apparatus, but temporally compressed so as to make the association between painful stimuli and the apparatus difficult (shock-only). Some genes resulted differentially expressed only in the rats subjected to CFC, others only in exploration or shock-only rats, whereas the gene coding for translocase of outer mitochondrial membrane 20 protein and nardilysin were differentially expressed in both CFC and exploration rats. For example, the expression of stathmin 1 whose transcripts resulted up regulated was also tested to evaluate the transduction and protein localization after conditioning. PMID:24278235

  11. On the age of stratospheric air and ozone depletion potentials in polar regions

    Science.gov (United States)

    Pollock, W. H.; Heidt, L. E.; Lueb, R. A.; Vedder, J. F.; Mills, M. J.; Solomon, S.

    1992-01-01

    Observations of the nearly inert, man-made chlorofluorocarbon CFC-115 obtained during January 1989 are used to infer the age of air in the lower stratosphere. These observations together with estimated release rates suggest an average age of high-latitude air at pressure altitudes near 17-21 km of about 3 to 5 yr. This information is used together with direct measurements of HCFC-22, HCFC-142b, CH3Br, H-1301, H-1211, and H-2402 to examine the fractional dissociation of these species within the Arctic polar lower stratosphere compared to that of CFC-11 and hence to estimate their local ozone depletion potentials in this region. It is shown that these HCFCs are much less efficiently dissociated within the stratosphere than CFC-11, lowering their ozone depletion potentials to only about 30-40 percent of their chlorine loading potentials. In contrast, the observations of CH3Br and the Halons considered confirm that they are rapidly dissociated within the stratosphere, with important implications for their ozone depletion potentials.

  12. Airborne gas chromatograph for in situ measurements of long-lived species in the upper troposphere and lower stratosphere

    Science.gov (United States)

    Elkins, J. W.; Fahey, D. W.; Gilligan, J. M.; Dutton, G. S.; Baring, T. J.; Volk, C. M.; Dunn, R. E.; Myers, R. C.; Montzka, S. A.; Wamsley, P. R.; Hayden, A. H.; Butler, J. H.; Thompson, T. M.; Swanson, T. H.; Dlugokencky, E. J.; Novelli, P. C.; Hurst, D. F.; Lobert, J. M.; Ciciora, S. J.; McLaughlin, R. J.; Thompson, T. L.; Winkler, R. H.; Fraser, P. J.; Steele, L. P.; Lucarelli, M. P.

    A new instrument, the Airborne Chromatograph for Atmospheric Trace Species IV (ACATS-IV), for measuring long-lived species in the upper troposphere and lower stratosphere is described. Using an advanced approach to gas chromatography and electron capture detection, the instrument can detect low levels of CFC-11 (CCl3F), CFC-12 (CCl2F2), CFC-113 (CCl2F-CClF2), methyl chloroform (CH3CCl3), carbon tetrachloride (CCl4), nitrous oxide (N2O), sulfur hexafluoride (SF6), Halon-1211 (CBrClF2), hydrogen (H2), and methane (CH4) acquired in ambient samples every 180 or 360 s. The instrument operates fully-automated onboard the NASA ER-2 high-altitude aircraft on flights lasting up to 8 hours or more in duration. Recent measurements include 24 successful flights covering a broad latitude range (70°S-61°N) during the Airborne Southern Hemisphere Ozone Experiment/Measurements for Assessing the Effects of Stratospheric Aircraft (ASHOE/MAESA) campaign in 1994.

  13. Balloonborne in situ gas chromatograph for measurements in the troposphere and stratosphere

    Science.gov (United States)

    Moore, F. L.; Elkins, J. W.; Ray, E. A.; Dutton, G. S.; Dunn, R. E.; Fahey, D. W.; McLaughlin, R. J.; Thompson, T. L.; Romashkin, P. A.; Hurst, D. F.; Wamsley, P. R.

    2003-03-01

    An in situ gas chromatograph (GC) instrument on a balloonborne package is described in detail and data from seven science deployments are presented. This instrument, the Lightweight Airborne Chromatograph Experiment (LACE), operates on the Observations of the Middle Stratosphere (OMS) in situ gondola and has taken data from the upper troposphere to near 32 km with a vertical resolution of better than 300 m. LACE chromatography has been developed to measure halon-1211, the chlorofluorocarbons (CFC-11, CFC-113, CFC-12), nitrous oxide (N2O), and sulfur hexafluoride (SF6) every 70 s and methyl chloroform (CH3CCl3), carbon tetrachloride (CCl4), hydrogen (H2), methane (CH4), and carbon monoxide (CO) every 140 s. In the introduction we present scientific motivation for choosing this suite of molecules and for the use of faster sample rates resulting in unprecedented vertical resolution from an in situ GC. Results from an intercomparison with the Airborne Chromatograph for Atmospheric Trace Species (ACATS-IV) instrument are shown to quantitatively connect this LACE data set to the complementary data set generated on board the NASA ER-2 aircraft.

  14. Estimated historic emissions of fluorocarbons from the European Union

    Science.gov (United States)

    McCulloch, A.; Midgley, P. M.

    Emissions of chlorofluorocarbons (CFCs), hydrochlorofluorocarbons (HCFCs) and one hydrofluorocarbon (HFC-134a) from Europe have been estimated for the years 1986-1996 with a precision in most cases better than ±20%. During that period, sales of CFCs have reduced to virtually zero but they are still being emitted from the "bank" in use in equipment. These emissions are calculated to have fallen dramatically; however the largest releases are still of CFC-11, at 44,000 tonnes in 1996. Significant contributions to the total emission of ozone depleting substances from the European Union during 1996 were also made by HCFC-22 (35,000 tonnes) and CFC-12 (9000 tonnes); releases of other CFCs and HCFCs into the atmosphere from the EU are markedly less. On the other hand, emissions of HFC-134a (which is not an ozone depleting substance) would appear to be growing rapidly and could have reached 12,000 tonnes yr -1 in 1996. HFC-134a is a replacement for CFC-12, releases of which are calculated to have declined much more than the growth in HFC-134a. This leads to the conclusion that substitution of one by the other has been much less than 100% and is actually smaller than had been projected by market research in the early 1990s.

  15. Design and Optimization of a Composite Canard Control Surface of an Advanced Fighter Aircraft under Static Loading

    Directory of Open Access Journals (Sweden)

    Shrivastava Sachin

    2015-01-01

    Full Text Available The minimization of weight and maximization of payload is an ever challenging design procedure for air vehicles. The present study has been carried out with an objective to redesign control surface of an advanced all-metallic fighter aircraft. In this study, the structure made up of high strength aluminum, titanium and ferrous alloys has been attempted to replace by carbon fiber composite (CFC skin, ribs and stiffeners. This study presents an approach towards development of a methodology for optimization of first-ply failure index (FI in unidirectional fibrous laminates using Genetic-Algorithms (GA under quasi-static loading. The GAs, by the application of its operators like reproduction, cross-over, mutation and elitist strategy, optimize the ply-orientations in laminates so as to have minimum FI of Tsai-Wu first-ply failure criterion. The GA optimization procedure has been implemented in MATLAB and interfaced with commercial software ABAQUS using python scripting. FI calculations have been carried out in ABAQUS with user material subroutine (UMAT. The GA's application gave reasonably well-optimized ply-orientations combination at a faster convergence rate. However, the final optimized sequence of ply-orientations is obtained by tweaking the sequences given by GA's based on industrial practices and experience, whenever needed. The present study of conversion of an all metallic structure to partial CFC structure has led to 12% of weight reduction. Therefore, the approach proposed here motivates designer to use CFC with a confidence.

  16. Rhythmic Working Memory Activation in the Human Hippocampus

    Directory of Open Access Journals (Sweden)

    Marcin Leszczyński

    2015-11-01

    Full Text Available Working memory (WM maintenance is assumed to rely on a single sustained process throughout the entire maintenance period. This assumption, although fundamental, has never been tested. We used intracranial electroencephalography (EEG recordings from the human hippocampus in two independent experiments to investigate the neural dynamics underlying WM maintenance. We observed periodic fluctuations between two different oscillatory regimes: Periods of “memory activation” were reflected by load-dependent alpha power reductions and lower levels of cross-frequency coupling (CFC. They occurred interleaved with periods characterized by load-independent high levels of alpha power and CFC. During memory activation periods, a relevant CFC parameter (load-dependent changes of the peak modulated frequency correlated with individual WM capacity. Fluctuations between these two periods predicted successful performance and were locked to the phase of endogenous delta oscillations. These results show that hippocampal maintenance is a dynamic rather than constant process and depends critically on a hierarchy of oscillations.

  17. Development and material testing of OF-Cu/DS-Cu/OF-Cu triplex tube (dispersion strengthened copper clad with oxygen free-copper) and trial fabrication of a vertical target mock-up for ITER divertor

    International Nuclear Information System (INIS)

    For the divertor target of the international thermonuclear experimental reactor (ITER), an OF-Cu/DS-Cu/OF-Cu triplex-structured cooling tube has been newly fabricated through powder metallurgy and drawing. The triplex structure comprised an aluminium oxide (0.5 mass%)-dispersion strengthened copper core (DS-Cu) clad with oxygen free copper (OF-Cu), a compliant layer for joining to the carbon fiber composite (CFC) tiles, and with an inner skin which tightly grasps a twisted INCONEL tape to assist heat transfer. Physical and mechanical properties of the DS-Cu core after heat treatment at 850 C for 600 s were investigated. Also, CFC brazability, fabricability and feasibility of the triplex tube for cooling channels for the divertor target were studied: A large scale vertical target mock-up of a 1500 mm length, 35 mm width and 3000 mm radius curved front face, has been fabricated with nearly 50 pieces of ''saddle''-shaped one-dimensional (1D)-CFC tiles were brazed on to 1500 mm long triplex tubes set in grooves of OF-Cu heat sink blocks joined to a stainless-steel back plate. The mock-up was tested under 20 MW/m2 for 15 s for 1000 cycle thermal loadings, which simulated transient heat loadings of a vertical target of an ITER divertor. (orig.)

  18. Clinical-scale cultures of cord blood CD34(+) cells to amplify committed progenitors and maintain stem cell activity.

    Science.gov (United States)

    Ivanovic, Zoran; Duchez, Pascale; Chevaleyre, Jean; Vlaski, Marija; Lafarge, Xavier; Dazey, Bernard; Robert-Richard, Elodie; Mazurier, Frédéric; Boiron, Jean-Michel

    2011-01-01

    We developed a clinical-scale cord blood (CB) cell ex vivo procedure to enable an extensive expansion of committed progenitors--colony-forming cells (CFCs) without impairing very primitive hematopoietic stem cells (HSCs). CD34(++) cells, selected from previously cryopreserved and thawed CB units, were cultured in two steps (diluted 1:4 after 6 days) in the presence of stem cell factor (SCF), fms-related tyrosine kinase 3 ligand (Flt-3L), megakaryocyte growth and development factor (MGDF) (100 ng/ml each), granulocyte-colony stimulating factor (G-CSF) (10 ng/ml) in HP01 serum-free medium. HSC activity was evaluated in a serial transplantation assay, by detection of human cells (CD45, CD33, CD19 and CFC of human origin) in bone marrow (BM) of primary and secondary recipient NOD/SCID mice 6-8 weeks after transplantation. A wide amplification of total cells (∼350-fold), CD34(+) cells (∼100-fold), and CFC (∼130-fold) without impairing the HSC activity was obtained. The activity of a particular HSC subpopulation (SRC(CFC)) was even enhanced.Thus, an extensive ex vivo expansion of CFCs is feasible without impairing the activity of HSCs. This result was enabled by associating antioxidant power of medium with an appropriate cytokine cocktail (i.e., mimicking physiologic effects of a weak oxygenation in hematopoietic environment). PMID:21294956

  19. Results and consequences of high heat flux testing as quality assessment of the Wendelstein 7-X divertor

    International Nuclear Information System (INIS)

    Highlights: • One third of the series production of the actively cooled divertor target elements for W7-X is completed. • A statistical analysis of the CFC bonding quality was developed on the basis of high heat flux tests of 100 cycles at 10 MW/m2. • The application of this method on the 14,000 CFC tiles allows a reliable quality assessment with reasonable test effort. • The results confirm the high thermal performance of the delivered divertor elements. -- Abstract: The series manufacturing of the first 282 Wendelstein 7-X divertor elements was concluded in 2011. The divertor is designed to remove a steady-state heat load of 10 MW/m2. 940 target elements of five different types made of CuCrZr heat sinks and covered with 16,000 CFC NB31 flat-tiles have to be produced. Additional to quality assessment during the manufacturing process, a final assessment of the delivered elements with operational heat load is indispensable to ensure a constant high thermal performance of the installed divertor. Based on the results of the pre-series testing a statistical quality assessment method has been developed for the series production. The application of this method to the series elements ensures their thermal performance with reasonable high heat flux test effort

  20. [Cystic Fibrosis Cloud database: An information system for storage and management of clinical and microbiological data of cystic fibrosis patients].

    Science.gov (United States)

    Prieto, Claudia I; Palau, María J; Martina, Pablo; Achiary, Carlos; Achiary, Andrés; Bettiol, Marisa; Montanaro, Patricia; Cazzola, María L; Leguizamón, Mariana; Massillo, Cintia; Figoli, Cecilia; Valeiras, Brenda; Perez, Silvia; Rentería, Fernando; Diez, Graciela; Yantorno, Osvaldo M; Bosch, Alejandra

    2016-01-01

    The epidemiological and clinical management of cystic fibrosis (CF) patients suffering from acute pulmonary exacerbations or chronic lung infections demands continuous updating of medical and microbiological processes associated with the constant evolution of pathogens during host colonization. In order to monitor the dynamics of these processes, it is essential to have expert systems capable of storing and subsequently extracting the information generated from different studies of the patients and microorganisms isolated from them. In this work we have designed and developed an on-line database based on an information system that allows to store, manage and visualize data from clinical studies and microbiological analysis of bacteria obtained from the respiratory tract of patients suffering from cystic fibrosis. The information system, named Cystic Fibrosis Cloud database is available on the http://servoy.infocomsa.com/cfc_database site and is composed of a main database and a web-based interface, which uses Servoy's product architecture based on Java technology. Although the CFC database system can be implemented as a local program for private use in CF centers, it can also be used, updated and shared by different users who can access the stored information in a systematic, practical and safe manner. The implementation of the CFC database could have a significant impact on the monitoring of respiratory infections, the prevention of exacerbations, the detection of emerging organisms, and the adequacy of control strategies for lung infections in CF patients. PMID:26895996

  1. Adherence to prophylaxis and bleeding outcome in haemophilia: a multicentre study.

    Science.gov (United States)

    Schrijvers, LieSbeth H; Beijlevelt-van der Zande, Marlene; Peters, Marjolein; Lock, Janske; Cnossen, Marjon H; Schuurmans, Marieke J; Fischer, Kathelijn

    2016-08-01

    Prevention of bleeding and joint damage in severe haemophilia is dependent on adherence to prophylactic replacement therapy. The aim of this study was to assess adherence to prophylaxis, including associations with age, bleeding and clotting factor consumption (CFC). In three Dutch haemophilia centres, semi-structured interviews about adherence to prophylaxis in the previous 2 weeks were conducted with patients or parents of a child with haemophilia. Patients were classified, according to pre-specified definitions, as adherent, sub-optimally adherent or non-adherent based on missing, timing, and dose of infusions. Association of annual bleeding rates, mean CFC, person performing the infusion (parents verus patients) with adherence categories were analysed. Overall, 241 patients with haemophilia using prophylaxis were studied. Parents were more adherent (66%; n = 48/73) than patients (43%; n = 72/168). Sub-optimal adherence occurred in 29% of parents and 37% of patients and was characterized by changes in timing of infusion (mostly from morning to evening), while missing parents and 20% of patients. Reduced adherence was associated with lower CFC, but not with joint bleeding. In conclusion, non-adherence in haemophilia was relatively rare, yet 1/3 of patients struggled to administer prophylaxis at the appropriate time of day. PMID:27098446

  2. Anomalous chlorofluorocarbons at the bottom of the eastern subtropical North Pacific Ocean

    Science.gov (United States)

    Min, D.; Bullister, J. L.; Fine, R. A.; Mecking, S.; Smethie, W. M., Jr.; Swift, J. H.

    2014-12-01

    Chlorofluorocarbons (CFCs) are man-made compounds which have been widely used as decadal-scale transient tracers for ocean circulation and ventilation processes. These compounds have well-known atmospheric histories and solubilities. Information derived from CFC concentration and ratio measurements in the global ocean allows us to infer the past history of deep water formation and the rates of spreading and mixing processes. These tracers have also been extensively used to compare and calibrate large-scale ocean circulation models and to estimate the oceanic uptake of anthropogenic CO2. During the P02 CLIVAR/CO2 Repeat Hydrography section along 30°N in 2004, low but detectable levels (>0.005 picomole kg-1) of CFCs (esp. CFC-12) were unexpectedly observed in deep waters (>3000-4000m) along an extensive area between Hawaii and California in the subtropical North Pacific Ocean. Near-bottom CFC concentrations tended to be higher toward the California outer continental shelf region (i.e. Southern California Borderland Basins or SCBB). Potential analytical errors or sampling contamination possibilities were carefully checked during the expedition. These anomalous bottom CFC features were observed again in the same region during the P02 revisit cruise in 2013 by an independent group. The presence of CFCs at the levels measured is inconsistent with presently understood rates and pathways of deep ventilation processes in this region. Potential mechanisms for generating these anomalous features will be discussed, including: a) previously unknown deep ventilation processes in this region; b) release of CFCs from sunken ships or other objects; c) spreading of high-CFC content deep waters from the SCBB along the continental slope; d) vertical transport of CFCs by adsorption/uptake by sinking particulates (including particulate organic matter and/or plastic debris) originating in the surface ocean and re-release in the bottom waters. Studies of sediment trap, sediment cores

  3. Isolation of cytotoxic glucoerebrosides and long-chain bases from sea cucumber Cucumaria frondosa using high speed counter-current chromatography.

    Science.gov (United States)

    Xu, Jie; Guo, Shuang; Du, Lei; Wang, Yu-Ming; Sugawara, Tatsuya; Hirata, Takashi; Xue, Chang-Hu

    2013-01-01

    Total glucocerebrosides of the sea cucumber Cucumaria frondosa (CFC) have been isolated from the less polar lipid fraction of the chloroform-methanol extract using high speed counter-current chromatography (HSCCC) with a two-phase solvent system composed of petroleum ether-methanol-water (5:4:1, v/v). Three glucocerebroside molecular species (CFC-1, CFC-2 and CFC-3) were isolated from crude total cerebrosides with repeated column chromatography. The structures of these three glucocerebroside molecular species were determined on the basis of chemical and spectroscopic evidence: fatty acids were mainly saturated (C22:0 and C18:0), monounsaturated (C24:1 and C20:1) and α-hydroxyl fatty acids (C24:1h, C23:0h, C23:1h and C22:0h), the structures of long-chain bases were dihydroxy (d17:1, d18:2 and d18:1) and trihydroxy (t17:0 and t16:0), and the glycosylation was glucose. High purity long-chain bases of sea cucumber Cucumaria frondosa (CF-LCB) were prepared from total lipids by HSCCC with a two-phase solvent system composed of n-hexane-methyl tert butyl ether-methanol-water (1:1:2:1, v/v). Compare with traditional preparative methods, the method of HSCCC is short cycle, high yield and less solvent consumption. The composition analysis of CF-LCB showed that the ratio of d18:2 and d17:1 was approximately 2:1. The four glucocerebrosides and long-chain bases from sea cucumber Cucumaria frondosa were evaluated for activity in vitro assays for the cytotoxic activities against Caco-2 colon cancer cells. The results indicated that both glucocerebrosides and long-chain bases exhibited an inhibitory effect on cell proliferation. Moreover, CFC-3 was most effective in four glucocerebrosides to Caco-2 cell viability. The inhibition effect of CF-LCB was much stronger than glucocerebrosides. PMID:23470440

  4. Validation of ACE-FTS v2.2 measurements of HCl, HF, CCl3F and CCl2F2 using space-, balloon- and ground-based instrument observations

    Directory of Open Access Journals (Sweden)

    C. Servais

    2008-10-01

    Full Text Available Hydrogen chloride (HCl and hydrogen fluoride (HF are respectively the main chlorine and fluorine reservoirs in the Earth's stratosphere. Their buildup resulted from the intensive use of man-made halogenated source gases, in particular CFC-11 (CCl3F and CFC-12 (CCl2F2, during the second half of the 20th century. It is important to continue monitoring the evolution of these source gases and reservoirs, in support of the Montreal Protocol and also indirectly of the Kyoto Protocol. The Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS is a space-based instrument that has been performing regular solar occultation measurements of over 30 atmospheric gases since early 2004. In this validation paper, the HCl, HF, CFC-11 and CFC-12 version 2.2 profile data products retrieved from ACE-FTS measurements are evaluated. Volume mixing ratio profiles have been compared to observations made from space by MLS and HALOE, and from stratospheric balloons by SPIRALE, FIRS-2 and Mark-IV. Partial columns derived from the ACE-FTS data were also compared to column measurements from ground-based Fourier transform instruments operated at 12 sites. ACE-FTS data recorded from March 2004 to August 2007 have been used for the comparisons. These data are representative of a variety of atmospheric and chemical situations, with sounded air masses extending from the winter vortex to summer sub-tropical conditions. Typically, the ACE-FTS products are available in the 10–50 km altitude range for HCl and HF, and in the 7–20 and 7–25 km ranges for CFC-11 and -12, respectively. For both reservoirs, comparison results indicate an agreement generally better than 5–10% above 20 km altitude, when accounting for the known offset affecting HALOE measurements of HCl and HF. Larger positive differences are however found for comparisons with single profiles from FIRS-2 and SPIRALE. For CFCs, the few coincident measurements available suggest that the differences

  5. Global stratospheric chlorine inventories for 2004–2009 from Atmospheric Chemistry Experiment Fourier Transform Spectrometer (ACE-FTS measurements

    Directory of Open Access Journals (Sweden)

    A. T. Brown

    2013-09-01

    Full Text Available We present chlorine budgets calculated between 2004 and 2009 for four latitude bands (70° N–30° N, 30° N–0° N, 0° N–30° S, and 30° S–70° S. The budgets were calculated using ACE-FTS version 3.0 retrievals of the volume mixing ratios (VMRs of 9 chlorine-containing species: CCl4, CFC-12 (CCl2F2, CFC-11 (CCl3F, COCl2, COClF, HCFC-22 (CHF2Cl, CH3Cl, HCl and ClONO2. These data were supplemented with calculated VMRs from the SLIMCAT 3-D chemical transport model (CFC-113, CFC-114, CFC-115, H-1211, H-1301, HCFC-141b, HCFC-142b, ClO and HOCl. The total chlorine profiles are dominated by chlorofluorocarbons (CFCs and halons up to 24 km in the tropics and 19 km in the extra-tropics. In this altitude range CFCs and halons account for 58% of the total chlorine VMR. Above this altitude HCl increasingly dominates the total chlorine profile, reaching a maximum of 95% of total chlorine at 54 km. All total chlorine profiles exhibit a positive slope with altitude, suggesting that the total chlorine VMR is now decreasing with time. This conclusion is supported by the time series of the mean stratospheric total chlorine budgets which show mean decreases in total stratospheric chlorine of 0.38 ± 0.03% per year in the Northern Hemisphere extra-tropics, 0.35 ± 0.07% per year in the Northern Hemisphere tropical stratosphere, 0.54 ± 0.16% per year in the Southern Hemisphere tropics and 0.53 ± 0.12% per year in the Southern Hemisphere extra-tropical stratosphere for 2004–2009. Globally stratospheric chlorine is decreasing by 0.46 ± 0.02% per year. Both global warming potential-weighted chlorine and ozone depletion potential-weighted chlorine are decreasing at all latitudes. These results show that the Montreal Protocol has had a significant effect in reducing emissions of both ozone-depleting substances and greenhouse gases.

  6. Estimates of anthropogenic halocarbon emissions based on its measured ratios relative to CO in the Pearl River Delta

    Directory of Open Access Journals (Sweden)

    M. Shao

    2011-01-01

    Full Text Available Using a GC/FID/MS system, we analyzed the mixing ratio levels of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD region of southern China. The results revealed elevated regional mixing ratios for most halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE, CH2Cl2 (dichloromethane, DCM, CH3Br (bromomethane, HCFC-22, CHCl3 (trichloromethane, CCl4 (tetrachloromethane, Cl2C = CCl2 (perchloroethylene, PCE, CH3CCl3 (methyl chloroform, MCF, and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in concentrations (relative standard deviation ranged from 9.31% to 96.55% of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO were examined, and then each emission of halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg, CH3CCl3 (6.7 Gg, and Cl2C = CCl2 (2.3 Gg accounted for about 62.9% of total emissions, suggesting a significant contribution to halocarbon emissions from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg, an alternative refrigerant to chlorofluorocarbons (CFCs, were about 2.3 times greater than those of CFC-12 (1.6 Gg. CFC-12 and HCFC-22 accounted for 21.5% of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of other CFCs, such as CFC-11, and levels of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl

  7. Estimate of anthropogenic halocarbon emission based on measured ratio relative to CO in the Pearl River Delta region, China

    Directory of Open Access Journals (Sweden)

    M. Shao

    2011-05-01

    Full Text Available Using a GC/FID/MS system, we analyzed the mixing ratio of 16 halocarbon species in more than 100 air samples collected in 2004 from the Pearl River Delta (PRD region of southern China. The results revealed that there are elevated mixing ratios for most of halocarbons, especially for HClC = CCl2 (trichloroethylene, TCE, CH2Cl2 (dichloromethane, DCM, CH3 Br (bromomethane, HCFC-22, CHCl3 (trichloromethane, CCl4 (tetrachloromethane, Cl2C = CCl2 (perchloroethylene, PCE, CH3CCl3 (methyl chloroform, MCF, and CFC-12. Comparisons were done with the data from TRACE-P and ALE/GAGE/AGAGE experiments, we found that the large variability in mixing ratios (relative standard deviation ranged from 9.31 % to 96.55 % of the halocarbons suggested substantial local emissions from the PRD region in 2004. Correlations between the mixing ratio of each species and carbon monoxide (CO was examined, and then the emission of each halocarbon was quantified based on scaling the optimized CO emission inventory with the slope of the regression line fitted to each species relative to CO. The calculated results revealed that mass of CH2Cl2 (7.0 Gg, CH3CCl3 (6.7 Gg, and Cl2C = CCl2 (2.3 Gg accounted for about 62.9 % of total halocarbon emissions, it suggested a significant contribution from solvent use in the PRD region. Emissions of HCFC-22 (3.5 Gg, an alternative refrigerant to chlorofluorocarbons (CFCs, were about 2.3 times greater than those of CFC-12 (1.6 Gg. CFC-12 and HCFC-22 accounted for 21.5 % of total emissions of halocarbons, so that the refrigerant would be the second largest source of halocarbons. However, the ratio approach found only minor emissions of CFCs, such as CFC-11, and the emission of CFC-114 and CFC-113 were close to zero. Emissions of other anthropogenic halocarbons, such as CCl

  8. Conversion of 5-fluorocytosine to 5-fluorouracil by human intestinal microflora

    International Nuclear Information System (INIS)

    5-Fluorocytosine (FC) is used to treat systemic fungal infections in man. Its clinical effectiveness has been limited by hematologic toxicity which may be secondary to the formation of 5-fluorouracil (FU). It is unclear how FU is formed since human cells lack cytosine deaminase. The present study examined if intestinal microflora (IMF) could convert FC to FU in man. An in vitro semicontinuous culture system was inoculated with human feces and maintained with sterile nutrient suspension. The microbial community was assessed for cell count and anaerobes as well as formation of volatile fatty acids and CH4. The system approximated that believed to occur in vivo. The study was initiated with addition of purified [6-14C]-FC. Unlabelled FC was then added to the system daily for 2 weeks following which [6-14C]-FC was again added. Following each addition of [6-14C]-FC, samples were removed at 2,4,8,24,48,72, and 96 hr. Utilizing HPLC, FC and FU could be separated with quantitation of radioactivity in each peak. Following the initial dose, no detectable FU was observed during the first 8 hr, but after 24 hr increasing levels were detected (9.42 μg FU/ml after 4 days). Following chronic administration of FC, increased levles of FU were noted without an 8 hr lag time in the production of FU (31.86 μg FU/ml after 4 days). In summary, these studies demonstrate that IMF can convert FC to FU possibly accounting for toxicity observed following administration of FC

  9. Swimming exercise ameliorates neurocognitive impairment induced by neonatal exposure to isoflurane and enhances hippocampal histone acetylation in mice.

    Science.gov (United States)

    Zhong, T; Ren, F; Huang, C S; Zou, W Y; Yang, Y; Pan, Y D; Sun, B; Wang, E; Guo, Q L

    2016-03-01

    Isoflurane-induced neurocognitive impairment in the developing rodent brain is well documented, and regular physical exercise has been demonstrated to be a viable intervention for some types of neurocognitive impairment. This study was designed to investigate the potential protective effect of swimming exercise on both neurocognitive impairment caused by repeated neonatal exposure to isoflurane and the underlying molecular mechanism. Mice received 0.75% isoflurane exposures for 4h on postnatal days 7, 8, and 9. From the third month after anesthesia, the mice were subjected to regular swimming exercise for 4weeks, followed by a contextual fear condition (CFC) trial. We found that repeated neonatal exposure to isoflurane reduced freezing behavior during CFC testing and deregulated hippocampal histone H4K12 acetylation. Conversely, mice subjected to regular swimming exercise showed enhanced hippocampal H3K9, H4K5, and H4K12 acetylation levels, increased numbers of c-Fos-positive cells 1h after CFC training, and less isoflurane-induced memory impairment. We also observed increases in histone acetylation and of cAMP-response element-binding protein (CREB)-binding protein (CBP) during the swimming exercise program. The results suggest that neonatal isoflurane exposure-induced memory impairment was associated with dysregulation of H4K12 acetylation, which may lead to less hippocampal activation following learning tasks. Swimming exercise was associated with enhanced hippocampal histone acetylation and CBP expression. Exercise most likely ameliorated isoflurane-induced memory impairment by enhancing hippocampal histone acetylation and activating more neuron cells during memory formation. PMID:26748054

  10. Perspectives of transient tracer applications and limiting cases

    Science.gov (United States)

    Stöven, T.; Tanhua, T.; Hoppema, M.; Bullister, J. L.

    2015-09-01

    Currently available transient tracers have different application ranges that are defined by their temporal input (chronological transient tracers) or their decay rate (radioactive transient tracers). Transient tracers range from tracers for highly ventilated water masses such as sulfur hexafluoride (SF6) through tritium (3H) and chlorofluorocarbons (CFCs) up to tracers for less ventilated deep ocean basins such as argon-39 (39Ar) and radiocarbon (14C). In this context, highly ventilated water masses are defined as water masses that have been in contact with the atmosphere during the last decade. Transient tracers can be used to empirically constrain the transit time distribution (TTD), which can often be approximated with an inverse Gaussian (IG) distribution. The IG-TTD provides information about ventilation and the advective/diffusive characteristics of a water parcel. Here we provide an overview of commonly used transient tracer couples and the corresponding application range of the IG-TTD by using the new concept of validity areas. CFC-12, CFC-11 and SF6 data from three different cruises in the South Atlantic Ocean and Southern Ocean as well as 39Ar data from the 1980s and early 1990s in the eastern Atlantic Ocean and the Weddell Sea are used to demonstrate this method. We found that the IG-TTD can be constrained along the Greenwich Meridian south to 46° S, which corresponds to the Subantarctic Front (SAF) denoting the application limit. The Antarctic Intermediate Water (AAIW) describes the limiting water layer in the vertical. Conspicuous high or lower ratios between the advective and diffusive components describe the transition between the validity area and the application limit of the IG-TTD model rather than describing the physical properties of the water parcel. The combination of 39Ar and CFC data places constraints on the IG-TTD in the deep water north of the SAF, but not beyond this limit.

  11. Syntheses, characterization and electrochemical and spectroscopic properties of ruthenium-iron complexes of 2,3,5,6-tetrakis(2-pyridyl)pyrazine and ferrocene-acetylide ligands.

    Science.gov (United States)

    Wen, Hui-Min; Wang, Jin-Yun; Zhang, Li-Yi; Shi, Lin-Xi; Chen, Zhong-Ning

    2016-06-28

    Heterodimetallic Ru-Fe complexes [(tppz)(PPh3)2RuL](ClO4) (L = C[triple bond, length as m-dash]CFc, [](ClO4); C[triple bond, length as m-dash]C-C6H4-C[triple bond, length as m-dash]CFc), [](ClO4); C[triple bond, length as m-dash]C-C6H4-C6H4-C[triple bond, length as m-dash]CFc, [](ClO4)) were synthesized by the reactions of [(tppz)(PPh3)2RuCl](ClO4) (tppz = 2,3,5,6-tetrakis(2-pyridyl)pyrazine) with ferrocence-acetylide ligands and characterized by ESI-MS, and (1)H and (31)P NMR spectroscopies. The structure of [](PF6) was determined by X-ray crystallography. The electrochemical studies show that compounds [](ClO4)-[](ClO4) possess two widely separated anodic peaks, ascribable to one-electron oxidation of Fc and Ru(II), respectively. This assignment is further corroborated by the results of UV-vis-NIR, XPS, and theoretical calculation studies. Compound [](ClO4) exhibits significant RuFe metal-metal interactions across the Ru-C[triple bond, length as m-dash]C-Fc backbone. As revealed by electrochemical, spectroscopic and theoretical computational studies, one-electron oxidized species [](ClO4)2 is between the electronically delocalized and valence-trapped state and shows a typical Robin-Day class II mixed-valence behavior. PMID:27273611

  12. Flow paths and mixing properties of groundwater using hydrogeochemistry and environmental tracers in the southwestern area of Jeju volcanic island

    Science.gov (United States)

    Koh, Dong-Chan; Ha, Kyoochul; Lee, Kwang-Sik; Yoon, Yoon-Yeol; Ko, Kyung-Seok

    2012-04-01

    SummaryGroundwater from springs, test boreholes and domestic wells was investigated to assess the flow system of basaltic aquifers at base-flow conditions in the southwestern part of Jeju Island, South Korea. This study utilized hydrogeochemical parameters and environmental tracers of 18O, 2H, 3H and chlorofluorocarbons (CFCs), which showed that well-connected flow paths exist between coastal springs regardless of flow rates. In contrast, test boreholes near the coastal springs exhibited various flow paths. Nitrate concentrations were much higher than baseline values in mountainous groundwater while those decreased in coastal areas (<50 m asl) despite stronger anthropogenic land uses. Cl- was seemingly contributed from nitrate contamination sources and seawater sources were minimal due to low-permeability layers near sea level. The water-stable isotopes indicated little evaporation and were comparable to the local meteoric water line during the rainy season, which was confirmed by deuterium excess values, demonstrating that effective infiltration primarily occurs during the rainy season. From the effects of altitude on δ18O, the mean recharge altitudes for both mountainous and coastal springs were estimated as 300-400 m, which implies longer flow paths for the coastal springs. The relationship of CFC-12-CFC-113 and that of CFC-12-3H concordantly indicated that the groundwater consists mainly of binary mixtures composed of 15-25-year-old young water and old water with ages greater than 60 years. Lower nitrate levels in the coastal springs were well represented by the mixing models. Recharge altitudes for coastal springs increased up to 700 m, assuming that old water corresponds to high-altitude recharge, using the binary mixing model. Integration of hydrochemical and environmental tracer characteristics revealed that pahoehoe lava flows and hydrovolcanic tuffs play key roles in controlling the groundwater occurrence and quality.

  13. Precision and linearity targets for validation of an IFNγ ELISPOT, cytokine flow cytometry, and tetramer assay using CMV peptides

    Directory of Open Access Journals (Sweden)

    Lyerly Herbert K

    2008-03-01

    Full Text Available Abstract Background Single-cell assays of immune function are increasingly used to monitor T cell responses in immunotherapy clinical trials. Standardization and validation of such assays are therefore important to interpretation of the clinical trial data. Here we assess the levels of intra-assay, inter-assay, and inter-operator precision, as well as linearity, of CD8+ T cell IFNγ-based ELISPOT and cytokine flow cytometry (CFC, as well as tetramer assays. Results Precision was measured in cryopreserved PBMC with a low, medium, or high response level to a CMV pp65 peptide or peptide mixture. Intra-assay precision was assessed using 6 replicates per assay; inter-assay precision was assessed by performing 8 assays on different days; and inter-operator precision was assessed using 3 different operators working on the same day. Percent CV values ranged from 4% to 133% depending upon the assay and response level. Linearity was measured by diluting PBMC from a high responder into PBMC from a non-responder, and yielded R2 values from 0.85 to 0.99 depending upon the assay and antigen. Conclusion These data provide target values for precision and linearity of single-cell assays for those wishing to validate these assays in their own laboratories. They also allow for comparison of the precision and linearity of ELISPOT, CFC, and tetramer across a range of response levels. There was a trend toward tetramer assays showing the highest precision, followed closely by CFC, and then ELISPOT; while all three assays had similar linearity. These findings are contingent upon the use of optimized protocols for each assay.

  14. Chlorofluorocarbons, sulfur hexafluoride, and dissolved permanent gases in ground water from selected sites in and near the Idaho National Engineering and Environmental Laboratory, Idaho, 1994-97

    Science.gov (United States)

    Busenberg, Eurybiades; Plummer, L. Niel; Bartholomay, Roy C.; Wayland, Julian E.

    1998-01-01

    From July 1994 through May 1997, the U.S. Geological Survey in cooperation with the Department of Energy, sampled 86 wells completed in the Snake River Plain aquifer at and near the Idaho N ationa1 Engineering and Environmental Laboratory (INEEL). The wells were sampled for a variety of constituents including one- and two-carbon halocarbons. Concentrations of dichlorodifluoromethane (CFC-12), trichlorofluoromethane (CFC-11) and trichlorotrifluororoethane (CFC-113) were determined. The samples for halocarbon analysis were collected in 62-milliliter flame sealed borosilicate glass ampoules in the field. The data will be used to evaluate the ages of ground waters at INEEL. The ages of the ground water will be used to determine recharge rates, residence time, and travel time of water in the Snake River Plain aquifer in and near INEEL. The chromatograms of 139 ground waters are presented showing a large number of halomethanes, haloethanes, and haloethenes present in the ground waters underlying the INEEL. The chromatograms can be used to qualitatively evaluate a large number of contaminants at parts per trillion to parts per billion concentrations. The data can be used to study temporal and spatial distribution of contaminants in the Snake River Plain aquifer. Representative compressed chromatograms for all ground waters sampled in this study are available on two 3.5-inch high density computer disks. The data and the program required to decompress the data can be obtained from the U.S. Geological Survey office at Idaho Falls, Idaho. Sulfur hexafluoride (SF6) concentrations were measured in selected wells to determine the feasibility of using this environmental tracer as an age dating tool of ground water. Concentrations of dissolved nitrogen, argon, carbon dioxide, oxygen, and methane were measured in 79 ground waters. Concentrations of dissolved permanent gases are tabulated and will be used to evaluate the temperature of recharge of ground water in and near the INEEL.

  15. Risks in the physical recovery system of waste refrigerator cabinets and the controlling measure.

    Science.gov (United States)

    Ruan, Jujun; Xue, Mianqiang; Xu, Zhenming

    2012-12-18

    Environmental information in physical recovery system of waste refrigerator cabinets was provided in this paper. The system included closed shearing, activated carbon adsorption (ACA), air current separation, magnetic separation, and eddy current separation. Exposures of CFC-11, heavy metals, and noise emitted from the system were assessed. Abundant CFC-11 (>510 mg/m³) was detected in crusher cavity. However, due to the employment of ACA, little CFC-11 (<9.5 mg/m³) could be detected out the recovery system. Heavy metals were detected in the air of workshop (TSP: Cu ≤ 4.91 μg/m³, Pb ≤ 3.17 μg/m³, PM10: Cu ≤ 2.1 μg/m³, Pb ≤ 1.3 μg/m³). Assessment results indicated the concentrations of heavy metals in air were safe for workers. Copper (25.8 mg/kg) and lead (19.5 mg/kg) were found in ground dust of the workshop and the concentrations were safe for soils. Noise level (98.2 dB(A)) of crushing process could cause disease and hearing impairment to workers. For controlling noise, acoustic hood was designed to reduce the noise level to 69.7 dB(A).The above information was of assistance to the industrialization of physical process for recovering waste refrigerator cabinets on environmental protection. Meanwhile, it contributed to the knowledge of environmental information of physical technology for recovering e-waste. PMID:23181933

  16. The combined use of chemical and isotopic information to model the effects of stormwater infiltration on groundwater quality in an urban fractured rock aquifer, Auckland, New Zealand

    International Nuclear Information System (INIS)

    Disposal of storm water in the Mt Eden area of Auckland, New Zealand, is via 'soak holes' drilled directly into the top of fractured basalt. Although this method of disposal has been used for at least 60 years, its sustainability with respect to groundwater quality has not been addressed. The groundwater has relatively low concentrations of dissolved heavy metals, although total metals are higher suggesting that the metals are bound to mobile particulates within the aquifer. PAH concentrations are also low in the aquifer, although sampling after rainfall events show small increases in PAH. Tritium measurements of the groundwater showed that all of the groundwater south of Chamberlin Park is less than 2 years old. This area has many soak holes. The data suggest that infiltration is very rapid and occurs throughout the area almost simultaneously after rainfall events. One well north of Chamberlin Park, where soak holes are absent has an age of 47 years ± 2 years. The groundwater here is low in dissolved oxygen and appears to be slow moving. CFC measurements indicate that all wells sampled south of Chamberlin Park are contaminated by excess CFCs. However, this result indicates rapid recharge from the surface via storm water. The same well north of Chamberlin Park that was dated using tritium, also has a CFC age of approximately 30 years. Thus, CFC dating may be useful in urban areas that are separated from atmospheric contamination by confining beds or slow circulation. A Kohonen self-organising feature maps (KSOFM) neural network was used to analyse the effect on storm water infiltration on groundwater quality, and determine the inter-relationship of the groundwater quality variables. The model shows that where the land use type is industrial or residential with many soak holes, there is a strong correlation of increased concentrations of heavy metals and storm water infiltration. (author)

  17. Material Surface Damage under High Pulse Loads Typical for ELM Bursts and Disruptions in ITER

    International Nuclear Information System (INIS)

    The divertor armour material for the tokamak ITER will probably be carbon manufactured as fibre composites (CFC) and tungsten as either brush-like structures or thin plates. Disruptive pulse loads where the heat deposition Q may reach 102 MJ/m2 on a time scale τ of 3 ms, or operation in the ELMy H-mode at repetitive loads with Q ∼ 3MJ/m2 and τ∼0.3 ms; deteriorate armour performance. This work surveys recent numerical and experimental investigations of erosion mechanisms at these off-normal regimes carried out at FZK, TRINITI, and IPP-Kharkov. The modelling uses the anisotropic thermomechanics code PEGASUS-3D for the simulation of CFC brittle destruction, the surface melt motion code MEMOS-1.5D for tungsten targets, and the radiation-magnetohydrodynamics code FOREV-2D for calculating the plasma impact and simulating the heat loads for the ITER regime. Experiments aimed at validating these codes are being carried out at the plasma gun facilities MK-200UG, QSPA-T, and QSPA-Kh50 which produce powerful streams of hydrogen plasma with Q=10-30MJ/m2 and τ = 0.03-0.5 ms. Essential results are, for CFC targets, the experiments at high heat loads and the development of a local overheating model incorporated in PEGASUS-3D, and for the tungsten targets the analysis of evaporation- and melt motion erosion on the base of MEMOS-1.5D calculations for repetitive ELMs

  18. Chlorofluorocarbons, Sulfur Hexafluoride, and Dissolved Permanent Gases in Ground Water from Selected Sites In and Near the Idaho National Engineering and Environmental Laboratory, Idaho, 1994 - 1997

    Energy Technology Data Exchange (ETDEWEB)

    Busenberg, E.; Plummer, L.N.; Bartholomay, R.C.; Wayland, J.E.

    1998-08-01

    From July 1994 through May 1997, the U.S. Geological Survey, in cooperations with the Department of Energy, sampled 86 wells completed in the Snake River Plain aquifer at and near the Idaho National Engineering and Environmental Laboratory (INEEL). The wells were sampled for a variety of constituents including one- and two-carbon halocarbons. Concentrations of dichlorodifluoromethane (CFC-12), trichlorofluoromethane (CFC-11), and trichlorotrifluororoethane (CFC-113) were determined. The data will be used to evaluate the ages of ground waters at INEEL. The ages of the ground water will be used to determine recharge rates, residence time, and travel time of water in the Snake River Plain aquifer in and near INEEL. The chromatograms of 139 ground waters are presented showing a large number of halomethanes, haloethanes, and haloethenes present in the ground waters underlying the INEEL. The chromatograms can be used to qualitatively evaluate a large number of contaminants at parts per trillion to parts per billion concentrations. The data can be used to study temporal and spatial distribution of contaminants in the Snake River Plain aquifer. Representative compressed chromatograms for all ground waters sampled in this study are available on two 3.5-inch high density computer disks. The data and the program required to decompress the data can be obtained from the U.S. Geological Survey office at Idaho Falls, Idaho. Sulfur hexafluoride (SF6) concentrations were measured in selected wells to determine the feasibility of using this environmental tracer as an age dating tool of ground water. Concentrations of dissolved nitrogen, argon, carbon dioxide, oxygen, and methane were measured in 79 ground waters. Concentrations of dissolved permanent gases are tabulated and will be used to evaluate the temperature of recharge of ground water in and near the INEEL.

  19. Missing Halocarbon Source? Data from a Recent New England Landfill Field Campaign

    Science.gov (United States)

    Hodson, E. L.; Prinn, R.

    2005-12-01

    Anthropogenic emissions of long-lived halocarbons, namely chlorofluorocarbons (CFCs), hydrofluorocarbons (HCFCs), methyl chloroform (CH3CCl3), and carbon tetrachloride (CCl4) represent the largest source of atmospheric chlorine. All of these gases with the exception of the HCFCs are banned under the Montreal Protocol from being produced within the US or imported into the US. Several recent studies indicate that lingering emissions of these compounds are occurring around urban areas in the US. One possible source for these emissions is leakage from landfills. Landfill emissions are not currently considered explicitly in the published industry based global estimations of emissions for these gases. Previous studies have been done in the UK and suggested that this leakage may be significant (on the order of 1 Gg/year in the UK) in comparison with industry emissions estimates, but no measurement based estimates of Montreal Protocol gas emissions from US landfills have been previously reported. To further investigate this idea, flask samples were taken during the winter of 2004 at two Eastern Massachusetts landfills and during the summer of 2004 at four landfills in southwestern Britain. These studies showed more data was needed to create clear regression relationships between the landfill parameters (waste composition, landfill age, and total trash volume) and halocarbon gas emissions of CFC-12, CFC-11, CFC-113, and CH3CCl3. In a movement towards creating the necessary database of measurements, an intensive Fall 2005 landfill measurement campaign was conducted in New England. The results from this campaign will be presented, analyzed and compared to our results from the above two 2004 investigations.

  20. Fuel Inventory in Carbon Fiber Composites from Tokamaks, Detailed Mapping and Quantification

    International Nuclear Information System (INIS)

    Full text: The major issues to be tackled in the field of Plasma-wall interaction (PWI) are lifetime of plasma-facing materials (PFM), fuel inventory and dust formation. The aim of this work was to investigate fuel retention and its distribution in a CFC material, NB41 which is an EU reference material for divertor tiles in ITER. Samples of NB41 were exposed to high flux deuterium plasmas in a plasma-wall interaction simulator PISCES-A at the University of California at San Diego, USA, and in the TEXTOR tokamak in Julich Germany. CFC from Tore Supra at Cadarache France have also been investigated. The reaction 2D(3He,p)4He was used for deuterium and 12C(3He,p)14N for carbon detection using both a broad beam and a nuclear microbeam at the 5 MV Tandem Accelerator in Uppsala. After the exposure in PISCES-A, two regions with distinctly different deuterium content can be distinguished. They correspond to two different types of fibres, ex-PAN and ex-pitch where the larger roughness of the broken fibres of the ex-pitch region can explain the higher retention in this region. Micro-distribution of deuterium and carbon in the erosion zone of the target exposed in TEXTOR is shows that the distributions of D and C are not uniform. In complex pattern there are some spots, up to 100-200 μm wide, with high deuterium content (8x1017 cm-2), whereas the remaining part retains less fuel. There are also places with very small relative carbon content, thus indicating the presence of other species accumulated in those areas. Over a distance of less then 1 mm differences in the deuterium concentration was found to be as large as 4% and as low as 0.2% from CFC samples from Tore Supra first wall. Work supported by EURATOM and carried out under EFDA. (author)

  1. Recovery of hematopoietic colony-forming cells in irradiated mice pretreated with interleukin 1 (IL-1)

    International Nuclear Information System (INIS)

    Data in this report determined the effect of a single injection of recombinant interleukin 1 alpha (rIL-1) prior to irradiation of B6D2F1 mice on the recovery of colony-forming cells (CFC) at early and late times after sublethal and lethal doses of radiation. Injection of rIL-1 promoted an earlier recovery of mature cells in the blood and CFC in the bone marrow and spleen. For example, 8 days after 6.5 Gy irradiation, the number of CFU-E (colony-forming units-erythroid), BFU-E (burst-forming units-erythroid), and GM-CFC (granulocyte-macrophage colony-forming cells) per femur was approximately 1.5-fold higher in rIL-1-injected mice than in saline-injected mice. Also, 5, 9, and 12 days after irradiation, the number of both day 8 and day 12 CFU-S (colony-forming units-spleen) was almost twofold greater in bone marrow from rIL-1-injected mice. The earlier recovery of CFU-S in rIL-1-injected mice was not associated with an increase in the number of CFU-S that survived immediately after irradiation. Also, 7 months after irradiation, the number of CFU-S per femur of both saline- and rIL-1-injected mice was still less than 50% of normal values. Data in this report demonstrate that a single injection of rIL-1 prior to irradiation accelerates early hematopoietic recovery in irradiated mice, but does not prevent expression of radiation-induced frontend damage or long-term damage to hematopoietic tissues

  2. Atmospheric emissions and attenuation of non-methane organic compounds in cover soils at a French landfill.

    Science.gov (United States)

    Scheutz, C; Bogner, J; Chanton, J P; Blake, D; Morcet, M; Aran, C; Kjeldsen, P

    2008-01-01

    In addition to methane (CH(4)) and carbon dioxide (CO(2)), landfill gas may contain more than 200 non-methane organic compounds (NMOCs) including C(2+)-alkanes, aromatics, and halogenated hydrocarbons. Although the trace components make up less than 1% v/v of typical landfill gas, they may exert a disproportionate environmental burden. The objective of this work was to study the dynamics of CH(4) and NMOCs in the landfill cover soils overlying two types of gas collection systems: a conventional gas collection system with vertical wells and an innovative horizontal gas collection layer consisting of permeable gravel with a geomembrane above it. The 47 NMOCs quantified in the landfill gas samples included primarily alkanes (C(2)-C(10)), alkenes (C(2)-C(4)), halogenated hydrocarbons (including (hydro)chlorofluorocarbons ((H)CFCs)), and aromatic hydrocarbons (BTEXs). In general, both CH(4) and NMOC fluxes were all very small with positive and negative fluxes. The highest percentages of positive fluxes in this study (considering all quantified species) were observed at the hotspots, located mainly along cell perimeters of the conventional cell. The capacity of the cover soil for NMOC oxidation was investigated in microcosms incubated with CH(4) and oxygen (O(2)). The cover soil showed a relatively high capacity for CH(4) oxidation and simultaneous co-oxidation of the halogenated aliphatic compounds, especially at the conventional cell. Fully substituted carbons (TeCM, PCE, CFC-11, CFC-12, CFC-113, HFC-134a, and HCFC-141b) were not degraded in the presence of CH(4) and O(2). Benzene and toluene were also degraded with relative high rates. This study demonstrates that landfill soil covers show a significant potential for CH(4) oxidation and co-oxidation of NMOCs. PMID:18032020

  3. Coupling groundwater residence time and 234U/238U isotopic ratios in a granitic catchment (Vosges, Eastern France)

    Science.gov (United States)

    Viville, Daniel; Aquilina, Luc; Ackerer, Julien; Chatton, Eliot; Labasque, Thierry; Pierret, Marie-Claire; Granet, Mathieu; Perrone, Thierry; Chabaux, François

    2016-04-01

    Weathering processes are active in surface waters but groundwater also represents no neglectable chemical fluxes. As residence-time in groundwater are high, silicate weathering might take place and control Si, Ca and C fluxes. Weathering processes can be deduced from U isotopic ratios but the kinetics of these processes remain relatively poorly constrained. In order to better characterize these processes, we have coupled residence-times deduced from anthropogenic gases (CFC and SF6) analysis and 234U/238U isotopic ratios determination. Samples were collected in the Strengbach catchment (Hydro-geochemical Observatory OHGE, Vosges, eastern France). Two campaigns were carried out in May and August 2015 during two highly contrasted hydro-climatic periods. Both springs and boreholes down to 80 m depth have been sampled. A very clear geochemical distinction is observed between groundwater from surface springs and deeper groundwater from boreholes. Springs show much lower residence-time (few years) and specific chemical composition. Deeper groundwater have residence-time of several decades and different geochemical composition. A clear SF6 production is observed with increasing SF6 concentrations with residence-time. The campaign of May is characterized by highly groundwater levels and spring fluxes. All groundwater show very low residence time, except in the boreholes at depth greater than 40 m. Conversely, during low groundwater-level period in August, the residence times are much higher and CFC concentrations indicate a large mixing process between surface groundwater and deeper levels. The 234U/238U isotopic ratios confirm this vertical zonation in the boreholes, with much higher activity ratios in the deep ground-waters from borehole than in the surface and spring waters; Such high U activity ratios are indicative of long water-rock interactions, which is consistent with the long residence times deducted from the CFC and SF6 data.

  4. Pumping-induced ebullition: a unified and simplified method for measuring multiple dissolved gases.

    Science.gov (United States)

    Browne, Bryant A

    2004-11-01

    The incorporation of multiple dissolved gas measurements in biogeochemical studies remains a difficult and expensive challenge. Incompatibilities in collection, handling, and storage procedures generally force the application of multiple sampling procedures for multiple gases. This paper introduces the concept and application of pumping-induced ebullition (PIE), a unified approach for routine measurement of multiple dissolved gases in natural waters and establishes a new platform for development of in situ real-time dissolved gas monitoring tools. Ebullition (spontaneous formation of bubbles) is induced by pumping a water sample through a narrow-diametertube (a "restrictor") to decrease hydrostatic pressure (PH) below total dissolved gas pressure (PT). Buoyancy is used to trap bubbles within a collection tower where gas accumulates rapidly (1 mL/min) to support multiple chemical analyses. Providing for field collection of an essentially unlimited and unified volume of gas sample, PIE afforded accurate and precise measurements of major (N2, 02, Ar), trace (CO2, N20, CH4) and ultratrace (CFC11, CFC12, CFC113, SF6) dissolved gases in Wisconsin groundwater, revealing interrelationships between denitrification, apparent recharge age-dates, and historical land use. Compared to conventional approaches, PIE eliminates multiple gas-specific sampling methods, reduces data computations, simplifies laboratory instrumentation, and avoids aqueous production and consumption of biogenic gases during sample storage. A lake depth profile for CO2 demonstrates PIE's flexibility as an in situ real-time platform for dissolved gas measurements. The apparent departures of some gases (SF6, H2, N2O, CO2) from solubility equilibrium behavior warrant further confirmation and theoretical investigation. PMID:15575293

  5. Expansion of CD34+ cells from human umbilical cord blood by FL and/or TPO gene transfected human marrow stromal cell lines

    Institute of Scientific and Technical Information of China (English)

    张毅; 唐佩弦; 金滢; 李秀森; 张双喜; 吴英; 毛宁

    2001-01-01

    To elucidate the effect of gene transfected marrow stromal cell on expansion of human cord blood CD34+ cells, a culture system was established in which FL and TPO genes were transfected into human stromal cell line HFCL. To establish gene transfected stromal cells co-culture system, cord blood CD34+ cells were purified by using a magnetic beads sorting system. The number of all cells and the number of CD34+ cells and CFC (CFU-GM and BFU-E) were counted in different culture systems. The results showed that in all 8 culture systems, SCF+IL-3+HFT manifested the most potent combination, with the number of total nucleated cells increasing by (893.3±52.1)-fold, total progenitor cells (CFC) by (74.5±5.2)-fold and CD34+ cells by 15.7-fold.Maximal expansions of CFC and CD34+ cells were observed at the end of the second week of culture. Within 14 days of culture, (78.1 ± 5.5)-fold and (57.0 ± 19.7)-fold increases in CFU-GM and BFU-E were obtained. Moreover, generation of LTC-IC from amplified CD34+ cells within 28 days was found only in two combinations, I.e. SCF+IL-3+FL+TPO and SCF+IL-3+HFT, and there was no significant difference between these two groups statistically. These results suggest that human umbilical cord blood CD34+ cells can be extensively expanded ex vivo by using gene transfected stromal cells along with cytokines.

  6. Administration of interleukin-6 stimulates multilineage hematopoiesis and accelerates recovery from radiation-induced hematopoietic depression

    International Nuclear Information System (INIS)

    Hematopoietic depression and subsequent susceptibility to potentially lethal opportunistic infections are well-documented phenomena following radiotherapy. Methods to therapeutically mitigate radiation-induced myelosuppression could offer great clinical value. In vivo studies have demonstrated that interleukin-6 (IL-6) stimulates pluripotent hematopoietic stem cell (CFU-s), granulocyte-macrophage progenitor cell (GM-CFC), and erythroid progenitor cell (CFU-e) proliferation in normal mice. Based on these results, the ability of IL-6 to stimulate hematopoietic regeneration following radiation-induced hematopoietic injury was also evaluated. C3H/HeN female mice were exposed to 6.5 Gy 60Co radiation and subcutaneously administered either saline or IL-6 on days 1 through 3 or 1 through 6 postexposure. On days 7, 10, 14, 17, and 22, femoral and splenic CFU-s, GM-CFC, and CFU-e contents and peripheral blood white cell, red cell, and platelet counts were determined. Compared with saline treatment, both 3-day and 6-day IL-6 treatments accelerated hematopoietic recovery; 6-day treatment produced the greater effects. For example, compared with normal control values (N), femoral and splenic CFU-s numbers in IL-6-treated mice 17 days postirradiation were 27% N and 136% N versus 2% N and 10% N in saline-treated mice. At the same time, bone marrow and splenic GM-CFC values were 58% N and 473% N versus 6% N and 196% N in saline-treated mice; bone marrow and splenic CFU-e numbers were 91% N and 250% N versus 31% N and 130% N in saline-treated mice; and peripheral blood white cell, red cell, and platelet values were 210% N, 60% N, and 24% N versus 18% N, 39% N, and 7% N in saline-treated mice. These studies demonstrate that therapeutically administered IL-6 can effectively accelerate multilineage hematopoietic recovery following radiation-induced hematopoietic injury

  7. Use of chlorofluorocarbons in hydrology: A guidebook

    International Nuclear Information System (INIS)

    Groundwater is used to meet nearly half of the global freshwater demand for domestic and agricultural use. Sustainable use of groundwater resources is, therefore, an important part of the overall efforts required for sustainable human development. Hydrological investigations to assess groundwater resources and to develop sustainable management strategies require a variety of scientific information, including the occurrence and rate of aquifer recharge. In arid and semi-arid areas, natural tracers, such as the environmentally stable isotopes of oxygen and hydrogen and the radioactive isotope tritium, are unique tools for recharge characterization. The atmospheric input of tritium from thermonuclear bomb tests of the 1950s and early 1960s provided an ideal tracer for determining the presence and rate of modern recharge in shallow aquifers. As the atmospheric concentration of tritium declined, its use for quantifying recharge by estimating the age of groundwater became less reliable. Alternative tools, such as concentrations of the daughter product of tritium (3He) and chlorofluorocarbons (CFCs) were devised for quantifying modern groundwater recharge. Measurement of the concentrations of a number of CFCs, which are synthetic compounds used in the industry, provides a complementary tool for corroborating and/or validating recharge estimations based on isotope data. The development of the CFC technique as a tool for dating groundwater has occurred over approximately the last 20 years and a number of research publications have documented its use in specific aquifers. This publication is intended to facilitate a comparative analysis of CFC and isotope techniques and a wider use of the CFC technique under appropriate conditions by providing a description of its scientific basis, sampling and measurement methods, interpretation and limitations of data, and a variety of case studies. This publication is an addition to a number of other IAEA reports and guidebooks that have

  8. Testing mixing models of old and young groundwater in a tropical lowland rain forest with environmental tracers

    Science.gov (United States)

    Solomon, D. Kip; Genereux, David P.; Plummer, L. Niel; Busenberg, Eurybiades

    2010-01-01

    We tested three models of mixing between old interbasin groundwater flow (IGF) and young, locally derived groundwater in a lowland rain forest in Costa Rica using a large suite of environmental tracers. We focus on the young fraction of water using the transient tracers CFC-11, CFC-12, CFC-113, SF6, 3H, and bomb 14C. We measured 3He, but 3H/3He dating is generally problematic due to the presence of mantle 3He. Because of their unique concentration histories in the atmosphere, combinations of transient tracers are sensitive not only to subsurface travel times but also to mixing between waters having different travel times. Samples fall into three distinct categories: (1) young waters that plot along a piston flow line, (2) old samples that have near-zero concentrations of the transient tracers, and (3) mixtures of 1 and 2. We have modeled the concentrations of the transient tracers using (1) a binary mixing model (BMM) of old and young water with the young fraction transported via piston flow, (2) an exponential mixing model (EMM) with a distribution of groundwater travel times characterized by a mean value, and (3) an exponential mixing model for the young fraction followed by binary mixing with an old fraction (EMM/BMM). In spite of the mathematical differences in the mixing models, they all lead to a similar conceptual model of young (0 to 10 year) groundwater that is locally derived mixing with old (>1000 years) groundwater that is recharged beyond the surface water boundary of the system.

  9. Integration of environmentally compatible soldering technologies for waste minimization

    International Nuclear Information System (INIS)

    There has been a concentrated effort throughout the international microelectronics industry to phase out chlorofluorocarbon (CFC) materials and alleviate the serious problem of ozone depletion created by the release of CFCS. The development of more environmentally compatible manufacturing technologies is the cornerstone of this effort. Alternative materials and processes for cleaning and soldering have received special attention. Electronic. soldering typically utilizes rosin-based fluxes to promote solder wettability. Flux residues must be removed from the soldered parts when high product reliability is essential. Halogenated or CFC solvents have been the principle chemicals used to clean the residues. With the accelerated push to eliminate CFCs in the US by 1995, CFC-free solvents, aqueous-based cleaning, water soluble or ''no clean'' fluxes, and fluxless soldering technologies are being developed and quickly integrated into manufacturing practice. Sandia's Center for Solder Science and Technology has been ch g a variety of fluxless and alternative soldering technologies for DOE's waste minimization program. The work has focused on controlled atmosphere, laser, and ultrasonic fluxless soldering, protective metallic and organic coatings, and fluxes which have water soluble or low solids-based chemistries. With the increasing concern that Pb will also be banned from electronic soldering, Sandia has been characterizing the wetting, aging, and mechanical properties of Pb-fire solder alloys. The progress of these integrated studies will be discussed. Their impact on environmentally compatible manufacturing will be emphasized. Since there is no universal solution to the various environmental, safety, and health issues which currently face industry, the proposed technologies offer several complementary materials and processing options from which one can choose

  10. Carbide formation in tungsten coatings on carbon-fibre reinforced carbon substrates

    International Nuclear Information System (INIS)

    Tungsten coatings with molybdenum interlayer deposited on carbon-fibre reinforced carbon (CFC) substrates were selected as the first wall material for the divertor in the Wall Project at Joint European Torus (similar to the International Thermonuclear Experimental Reactor). For such a layered structure, diffusion of carbon from the CFC substrate towards the Mo and W deposits is expected during the operation of the reactor. As both molybdenum and tungsten form stable carbides, brittle compounds may form at the interface, thus strongly affecting the thermomechanical performance of the coated tiles. For the purpose of prediction of the operation time of such coated tiles, carbon diffusion and carbide formation kinetics need to be determined. In the present study, W/Mo/CFC samples were subjected to heat treatment at 1470 K for various annealing times. The Focused Ion Beam technique was used for sample preparation for electron microscopy examinations. Transmission electron microscopy observations supported with diffraction pattern analyses revealed the both W2C and WC carbides in the W coating, as well as that of Mo2C carbide in the Mo layer. The results were used to estimate the kinetics of coatings degradation. - Highlights: ► Thin Mo/W layers system on carbon-fibre reinforced carbon divertor tile ► Heat treatment at 1470 K results in two tungsten carbide creation — W2C and WC ► The total tungsten carbide creation is limited by carbon diffusion ► WC carbide creation is limited by W2C–WC reaction rate

  11. Analysis and inventory of sales in Quebec of substances depleting the ozone layer for 1993 to 1996; Analyse et bilan des ventes au Quebec de substances appauvrissant la couche d`ozone

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Quebec`s regulation on ozone-layer depleting substances requires that all distributors of chlorofluorocarbons (CFCs), hydrochlorofluorocarbons(HCFCs) and bromofluorocarbons (Halons) in Quebec provide an annual report of the quantities of these substances sold or distributed in the province. The inventory of these substances for the years 1993 to 1996 is presented. Included in the inventory are 16 different CFC, HCFC or Halon compounds. The contribution of these substances to the destruction of the ozone layer is estimated as well as their influence on global warming. Analysis of the data indicates that Quebec`s consumption of ozone-layer depleting substances is constantly decreasing. 3 tabs., 16 figs.

  12. Chapter 7. Practical applications of CFCs in hydrological investigations

    International Nuclear Information System (INIS)

    In an aquifer of constant thickness and receiving constant recharge, the groundwater age will increase exponentially with depth below the water table. If the groundwater age is measured at any discrete depth, then it is possible to calculate the groundwater recharge rate. In practice, collection of a number of samples at discrete depths close to the water table is preferred, and vertical groundwater velocities can then be directly determined from the vertical CFC age gradient. The aquifer recharge rate can be determined from this data, provided that the aquifer porosity is known or can be estimated

  13. Effects of Humic Acid and Solution pH on Dispersion of Na—and Ca—Soil Clays

    Institute of Scientific and Technical Information of China (English)

    LANYEQING; HUQIONGYING; 等

    1996-01-01

    Dispersed soil clays have a negative impact on soil structure and contribute to soil erosion and contaminant movement.In this study,two typical soils from the south of China were chosen for investigating roles of pH and humic acid(HA) on dispersion of soil clays.Critical flocculation concentration (CFC) of the soil clay suspension was determined by using light transmission at a wavelength of 600 nm.The results indicated that effects of pH and HA on dispersion of the soil clays were closely related to the type of the major minerals makin up the soil and to the valence of the exchangeable cations as well.At four rates of pH(4,6,8and 10),the CFC for the Na-yellow-brown soil treated with H2O2 was increased from 0.32 to 0.56,6.0 to 14.0,10.0 to 24.6 and 26.0 to 52.0mmol L-1 NaCl,respectively when Na-HA was added at the rate of from 0 to 40mgL-1,With the same Na-HA addition and three pH(6,8and 10)treatments,the CFC for the Na-red soil was incresed from 0.5 to 20.0,1.0 to 40.0 and 6.0 to 141.0mmol L-1 NaCl,respectively.Obviously,pH and HA has greater effects on clay dispersion of the red soil(dominated by 1:1 minerals and oxides) than on that of the yellow-brown soil(dominated by 2:1minerals).However,at three rates of pH(6,8and 10) and with the addition of Ca-HA from 0 to 40mg L-1,the CFC of the Ca-yellow-brown soil and Ca-red soil treated with H2O2 was increased from 0.55 to 0.81,0.75 to 1.28,0.55 to 1.45and 0.038 to 0.266.0.25 to 0.62,0.7to 1.6mmol CaCl2 L-1,respectively.So,Na-soil claye are more sensitive to pH and HA than Ca-soil clays.

  14. No 'all-clear' for the ozone layer before 2000

    International Nuclear Information System (INIS)

    The article discusses the possibility of the recurrence in the Federal Republic of Germany of a situation in the USA, where the Environmental Protection Agency asked the refrigerant manufacturer DuPont to recant its self-imposed obligation and continue manufacturing refrigerants containing CFC. The legal situation here would not permit such an action by the Federal Government. Besides this, the industry has already adapted most of its products to the new conditions. The article points out the good dialogue between research and production. There are even plans to put a ban on all part-halogenated substances in new installations over the medium term. (BWI)

  15. Attenuation of fluorocarbons released from foam insulation in landfills

    DEFF Research Database (Denmark)

    Scheutz, Charlotte; Dote, Yukata; Fredenslund, Anders Michael; Mosbæk, Hans; Kjeldsen, Peter

    2007-01-01

    Chlorofluorocarbons (CFCs), hydrochlorofluorocarbons (HCFCs), and hydrofluorocarbons (HFCs) have been used as blowing agents (BAs) for foam insulation in home appliances and building materials, which after the end of their useful life are disposed of in landfills. The objective of this project was...... products did not correlate with a stoichiometric removal of CFC-11 indicating that other degradation products were produced. HCFC-21 and HCFC-31 were further degraded whereas no further degradation of HFC-41 was observed. The degradation rate coefficient was directly correlated with the number of chlorine...

  16. Recent age indicators applied to groundwaters in fractured aquifers in the UK

    International Nuclear Information System (INIS)

    After early studies using tritium in the 1960s and 70s, the investigation of recent groundwater dynamics in UK aquifers has been largely neglected from the age-indicator standpoint. Now, however, with the ever-increasing stress on water quality issues, attention is once again being focused on this area. In the interim, new and relatively inexpensive dating methods using chlorofluorocarbons (CFCs) and sulphur hexafluoride (SF6) have arrived to rejuvenate the study of young groundwater components. This study considers preliminary results obtained from fractured aquifers in the UK. Many British aquifers are fractured, resulting in important non-intergranular permeability. Two different lithologies are considered here: a Permian sandstone from southern Scotland, and the Chalk of southern England. The sandstone is sufficiently fractured that the bulk of flow occurs via this 'secondary' route. In the Chalk, although it has a porosity double that of the sandstone (up to 40%), most flow also occurs via the fracture network because pore throat sizes are so small. The Permian basin of Dumfries, 25 km long and 10 km wide, supplies 11% of Scotland's groundwater. Farming is widespread in the basin, while industry is locally important. Both activities have potential impacts on groundwater quality. To better understand groundwater quality developments in the basin, a hydrogeochemical sampling campaign was carried out. This resulted in 17 boreholes across the basin being sampled for CFCs and in most cases SF6. The results were interpreted in terms of mixing between modern (late 1990s) recharge and >50year-old CFC-free groundwater. Modern water percentage calculated from CFC-12 and SF6 concentrations respectively are shown. In over half the cases the correlation is good. In a few cases CFC-12 percentages exceed 100%, indicating a pollution problem. SF6 percentages remain below 100% in these cases and so can still be used as age indicators, albeit with caution. In a few other cases

  17. CONTRIBUTION A L’AMELIORATION DU SYSTEME DE CLIMATISATION DES VOITURES DE VOYAGEURS DE LA SNTF

    OpenAIRE

    YOUCEF, Ahmed

    2011-01-01

    L’accroissement de l’effet de serre et la diminution de la couche d’ozone ont marqué ces dix dernières années, les gaz frigorigènes classiques tels que les CFC (chlorofluorocarbones),HCFC (hydrochlorofluorocarbones) participent respectivement à la destruction de la couche d’ozone et à l’effet de serre. Les secteurs du froid et de la climatisation sont des domaines en pleine expansion non seulement dans les pays industrialisés mais aussi dans les pays en voie de développement. La communa...

  18. Spatial distribution of seepage at a flow-through lake: Lake Hampen, Western Denmark

    DEFF Research Database (Denmark)

    Kidmose, Jacob Baarstrøm; Engesgaard, Peter Knudegaard; Nilsson, Bertel; Laier, Troels; Looms, Majken Caroline

    2011-01-01

    The spatial distribution of seepage at a flow-through lake in western Denmark was investigated at multiple scales with integrated use of a seepage meter, lake–groundwater gradients, stable isotope fractionation (d18O), chlorofl uorocarbon (CFC) apparent ages, land-based and off -shore geophysical...... recharge patiern of the lake and relating these to the geologic history of the lake. Recharge of the surrounding aquifer by lake water occurs off shore in a narrow zone, as measured from lake–groundwater gradients. A 33-m-deep d18O profi le at the recharge side shows a lake d18O plume at depths that...

  19. Role of mesoscale eddies in the global ocean uptake of anthropogenic CO2

    International Nuclear Information System (INIS)

    Mesoscale eddies play a fundamental role in ocean dynamics particularly in the Southern Ocean. Global-scale tracer simulations are typically made at coarse resolution without explicitly modeling eddies. Here we ask what role do eddies play in ocean uptake, storage, and meridional transport of anthropogenic CO2, CFC-11 and bomb Δ14C. We made global anthropogenic transient tracer simulations in coarse-resolution, ORCA2, and eddy-permitting, ORCA05 and ORCA025, versions of the ocean modelling system NEMO. We focus on the Southern Ocean where tracer air-sea fluxes are largest. Eddies have little effect on bomb Δ14C uptake and storage. Yet for CFC-11 and anthropogenic CO2, increased eddy activity reduces southern extra-tropical uptake by 28% and 25% respectively, thereby providing better agreement with observations. It is shown that the discrepancies in the equilibration times between the three tracers determine their respective sensitivities to the model horizontal resolution. Applying Gent and McWilliams (1990) (GM) parameterization of eddies in the non-eddying version of the model does improve results, but not enough. An in-depth investigation of the mechanisms by which eddies affect the uptake of the transient tracers shows that including mesoscale eddies leads to an overall reduction in the Antarctic Intermediate Water (AAIW) ventilation, and modifies substantially the spatial distribution of their source regions. This investigation reveals also that the GM parameterization still overestimates the ventilation and the subduction of AAIW in the Indian Ocean where the simulated mixed layer is particularly deep during the winter. This work suggests that most current coarse-resolution models may overestimate the ventilation of AAIW in the Indian sector of the Southern Ocean. This study shows also that the use of the GM parameterization may be of limited utility where mixed layer is relatively deep and confirms the general need for a more adequate parameterization that

  20. Cogeneration and beyond: The need and opportunity for high efficiency, renewable community energy systems

    Energy Technology Data Exchange (ETDEWEB)

    Gleason, T.C.J.

    1992-06-01

    The justification, strategies, and technology options for implementing advanced district heating and cooling systems in the United States are presented. The need for such systems is discussed in terms of global warming, ozone depletion, and the need for a sustainable energy policy. Strategies for implementation are presented in the context of the Public Utilities Regulatory Policies Act and proposed new institutional arrangements. Technology opportunities are highlighted in the areas of advanced block-scale cogeneration, CFC-free chiller technologies, and renewable sources of heating and cooling that are particularly applicable to district systems.