WorldWideScience

Sample records for cesium 141

  1. Process for recovering cesium from cesium alum

    International Nuclear Information System (INIS)

    Mein, P.G.

    1984-01-01

    Cesium is recovered from cesium alum, CsAl(SO 4 ) 2 , by a two-reaction sequence in which the cesium alum is first dissolved in an aqueous hydroxide solution to form cesium alum hydroxide, CsAl(OH) 3 , and potassium sulfate, K 2 SO 4 . Part of the K 2 SO 4 precipitates and is separated from the supernatant solution. In the second reaction, a water-soluble permanganate, such as potassium permanganate, KMnO 4 , is added to the supernatant. This reaction forms a precipitate of cesium permanganate, CsMnO 4 . This precipitate may be separated from the residual solution to obtain cesium permanganate of high purity, which can be sold as a product or converted into other cesium compounds

  2. Process for recovering cesium from cesium alum

    International Nuclear Information System (INIS)

    Mein, P.G.

    1984-01-01

    Cesium is recovered from cesium alum, CsAl(SO 4 ) 2 , by an aqueous conversion and precipitation reaction using a critical stoichiometric excess of a water-soluble permanganate to form solid cesium permanganate (CsMnO 4 ) free from cesium alum. The other metal salts remain in solution, providing the final pH does not cause hydroxides of aluminium or iron to form. The precipitate is separated from the residual solution to obtain CsMnO 4 of high purity

  3. Process for recovering cesium from pollucite

    International Nuclear Information System (INIS)

    Mein, P.G.

    1985-01-01

    Cesium is recovered from a cesium-bearing mineral such as pollucite by extraction with hydrochloric acid to obtain an extract of cesium chloride and other alkali metal and polyvalent metal chlorides. The iron and aluminum chlorides can be precipitated as the hydroxides and separated from the solution of the alkali metal chlorides to which is added potassium permanganate or other water-soluble permanganate to selectively precipitate cesium permanganate. The cesium precipitate is then separated from the residual solution containing the metal chlorides. The cesium permanganate, which is in a very pure form, can be converted to other cesium compounds by reaction with a reducing agent to obtain cesium carbonate and cesium delta manganese dioxide

  4. Methods of producing cesium-131

    Science.gov (United States)

    Meikrantz, David H; Snyder, John R

    2012-09-18

    Methods of producing cesium-131. The method comprises dissolving at least one non-irradiated barium source in water or a nitric acid solution to produce a barium target solution. The barium target solution is irradiated with neutron radiation to produce cesium-131, which is removed from the barium target solution. The cesium-131 is complexed with a calixarene compound to separate the cesium-131 from the barium target solution. A liquid:liquid extraction device or extraction column is used to separate the cesium-131 from the barium target solution.

  5. Cesium reservoir and interconnective components

    International Nuclear Information System (INIS)

    1994-03-01

    The program objective is to demonstrate the technology readiness of a TFE (thermionic fuel element) suitable for use as the basic element in a thermionic reactor with electric power output in the 0.5 to 5.0 MW range. A thermionic converter must be supplied with cesium vapor for two reasons. Cesium atoms adsorbed on the surface of the emitter cause a reduction of the emitter work function to permit high current densities without excessive heating of the emitter. The second purpose of the cesium vapor is to provide space-charge neutralization in the emitter-collector gap so that the high current densities may flow across the gap unattenuated. The function of the cesium reservoir is to provide a source of cesium atoms, and to provide a reserve in the event that cesium is lost from the plasma by any mechanism. This can be done with a liquid cesium metal reservoir in which case it is heated to the desired temperature with auxiliary heaters. In a TFE, however, it is desirable to have the reservoir passively heated by the nuclear fuel. In this case, the reservoir must operate at a temperature intermediate between the emitter and the collector, ruling out the use of liquid reservoirs. Integral reservoirs contained within the TFE will produce cesium vapor pressures in the desired range at typical electrode temperatures. The reservoir material that appears to be the best able to meet requirements is graphite. Cesium intercalates easily into graphite, and the cesium pressure is insensitive to loading for a given intercalation stage. The goals of the cesium reservoir test program were to verify the performance of Cs-graphite reservoirs in the temperature-pressure range of interest to TFE operation, and to test the operation of these reservoirs after exposure to a fast neutron fluence corresponding to seven year mission lifetime. In addition, other materials were evaluated for possible use in the integral reservoir

  6. Mineral resource of the month: cesium

    Science.gov (United States)

    Angulo, Marc A.

    2010-01-01

    The article offers information on cesium, a golden alkali metal derived from the Latin word caesium which means bluish gray. It mentions that cesium is the first element discovered with the use of spectroscopy. It adds that the leading producer and supplier of cesium is Canada and there are 50,000 kilograms of cesium consumed of the world in a year. Moreover, it states that only 85% of the cesium formate can be retrieved and recycled.

  7. Cesium in the nutrient cycle. Cesium metsaen ravinnekierrossa marjojen ja sienten cesium ei vaehene

    Energy Technology Data Exchange (ETDEWEB)

    Rantavaara, A

    1992-01-01

    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland.

  8. Cesium transport data for HTGR systems

    International Nuclear Information System (INIS)

    Myers, B.F.; Bell, W.E.

    1979-09-01

    Cesium transport data on the release of cesium from HTGR fuel elements are reviewed and discussed. The data available through 1976 are treated. Equations, parameters, and associated variances describing the data are presented. The equations and parameters are in forms suitable for use in computer codes used to calculate the release of metallic fission products from HTGR fuel elements into the primary circuit. The data cover the following processes: (1) diffusion of cesium in fuel kernels and pyrocarbon, (2) sorption of cesium on fuel rod matrix material and on graphite, and (3) migration of cesium in graphite. The data are being confirmed and extended through work in progress

  9. Extraction of radioactive cesium from tea leaves

    International Nuclear Information System (INIS)

    Yano, Yukiko; Kubo, M. Kenya; Higaki, Shogo; Hirota, Masahiro; Nomura, Kiyoshi

    2011-01-01

    Radioactive contamination of foodstuffs attributed to the Fukushima Daiichi nuclear disaster has become a social problem. This study investigated the extraction of radioactive cesium from the contaminated leaves to the tea. The green tea was brewed twice reusing the same leaves to study the difference in extraction of cesium between the first and second brew. Moreover, the extraction of cesium was studied in correlation to brewing time. The concentration of radioactive cesium was determined with gamma spectrometry, and the concentration of caffeine was determined with absorption spectrometry. About 40% of cesium was extracted from leaves in the first brew, and about 80% was extracted in the second brew. The extraction of cesium increased over time, and it reached about 80% after 10 minutes brew. The ratio of radioactive cesium to caffeine decreased linearly over time. This study revealed that the extraction of cesium was higher for the second brew, and a rapid increase in extraction was seen as the tea was brewed for 6 minutes and more. Therefore, the first brew of green tea, which was brewed within 5 minutes, contained the least extraction of radioactive cesium from the contaminated leaves. (author)

  10. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms

    International Nuclear Information System (INIS)

    Haas, M.

    2007-01-01

    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m f =2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m f =1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m f =4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The last chapter

  11. Process for cesium decontamination and immobilization

    Science.gov (United States)

    Komarneni, Sridhar; Roy, Rustum

    1989-01-01

    Cesium can be selectively recovered from a nuclear waste solution containing cesium together with other metal ions by contact with a modified phlogopite which is a hydrated, sodium phlogopite mica. Once the cesium has entered the modified phlogopite it is fixed and can be safely stored for long periods of time.

  12. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph; Destombe, C; Grasseau, A; Mathieu, J; Chancerelle, Y; Mestries, J C [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1998-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  13. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1997-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  14. Process for cesium decontamination and immobilization

    Science.gov (United States)

    Komarneni, S.; Roy, R.

    1988-04-25

    Cesium can be selectively recovered from a nuclear waste solution containing cesium together with other metal ions by contact with a modified phlogopite which is a hydrated, sodium phlogopite mica. Once the cesium has entered the modified phlogopite it is fixed and can be safely stored for long periods of time. 6 figs., 2 tabs.

  15. Method for primary containment of cesium wastes

    International Nuclear Information System (INIS)

    Angelini, P.; Arnold, W.D.; Blanco, R.E.; Bond, W.D.; Lackey, W.J.; Stinton, D.P.

    1983-01-01

    A method for producing a cesium-retentive waste form, characterized by a high degree of compositional stability and mechanical integrity, is provided by subjecting a cesium-loaded zeolite to heat under conditions suitable for stabilizing the zeolite and immobilizing the cesium, and coating said zeolite for sufficient duration within a suitable environment with at least one dense layer of pyrolytic carbon to seal therein said cesium to produce a final, cesium-bearing waste form. Typically, the zeolite is stabilized and the cesium immobilized in less than four hours by confinement within an air environment maintained at about 600 0 C. Coatings are thereafter applied by confining the calcined zeolite within a coating environment comprising inert fluidizing and carbon donor gases maintained at 1,000* C. For a suitable duration

  16. Management of cesium loaded AMP- Part I preparation of 137Cesium concentrate and cementation of secondary wastes

    International Nuclear Information System (INIS)

    Singh, I.J.; Sathi Sasidharan, N.; Yalmali, Vrunda S.; Deshingkar, D.S.; Wattal, P.K.

    2005-11-01

    Separation of 137 cesium from High Level Waste can be achieved by use of composite-AMP, an engineered form of Ammonium Molybdo-Phosphate(AMP). Direct vitrification of cesium loaded composite AMP in borosilicate glass matrix leads to separation of water soluble molybdate phase. A proposed process describes two different routes of selective separation of molybdates and phosphate to obtain solutions of cesium concentrates. Elution of 137 Cesium from composite-AMP by decomposing it under flow conditions using saturated barium hydroxide was investigated. This method leaves molybdate and phosphate embedded in the column but only 70% of total cesium loaded on column could be eluted. Alternatively composite-AMP was dissolved in sodium hydroxide and precipitation of barium molybdate-phosphate from the resultant solution, using barium nitrate was investigated by batch methods. The precipitation technique gave over 99.9% of 137 Cesium activity in solutions, free of molybdates and phosphates, which is ideally suited for immobilization in borosilicate glass matrix. Detailed studies were carried out to immobilize secondary waste of 137 Cesium contaminated barium molybdate-phosphate precipitates in the slag cement matrix using vermiculite and bentonite as admixtures. The cumulative fraction of 137 Cs leached from the cement matrix blocks was 0.05 in 140 days while the 137 Cs leach rate was 0.001 gm/cm 2 /d. (author)

  17. Cesium Concentration in MCU Solvent

    International Nuclear Information System (INIS)

    Walker, D

    2006-01-01

    During Modular Caustic-Side Solvent Extraction (CSSX) Unit (MCU) operations, Cs-137 concentrations in product streams will vary depending on the location in the process and on the recent process conditions. Calculations of cesium concentrations under a variety of operating conditions reveal the following: (1) Under nominal operations with salt solution feed containing 1.1 Ci Cs-137 per gallon, the maximum Cs-137 concentration in the process will occur in the strip effluent (SE) and equal 15-16.5 Ci/gal. (2) Under these conditions, the majority of the solvent will contain 0.005 to 0.01 Ci/gal, with a limited portion of the solvent in the contactor stages containing ∼4 Ci/gal. (3) When operating conditions yield product near 0.1 Ci Cs-137/gal in the decontaminated salt solution (DSS), the SE cesium concentration will be the same or lower than in nominal operations, but majority of the stripped solvent will increase to ∼2-3 Ci/gal. (4) Deviations in strip and waste stream flow rates cause the largest variations in cesium content: (a) If strip flow rates deviate by -30% of nominal, the SE will contain ∼23 Ci/gal, although the cesium content of the solvent will increase to only 0.03 Ci/gal; (b) If strip flow rate deviates by -77% (i.e., 23% of nominal), the SE will contain 54 Ci/gal and solvent will contain 1.65 Ci/gal. At this point, the product DSS will just reach the limit of 0.1 Ci/gal, causing the DSS gamma monitors to alarm; and (c) Moderate (+10 to +30%) deviations in waste flow rate cause approximately proportional increases in the SE and solvent cesium concentrations. Recovery from a process failure due to poor cesium stripping can achieve any low cesium concentration required. Passing the solvent back through the contactors while recycling DSS product will produce a ∼70% reduction during one pass through the contactors (assuming the stripping D value is no worse than 0.36). If the solvent is returned to the solvent hold tank (containing additional

  18. Cesium removal and kinetics equilibrium: Precipitation kinetics

    International Nuclear Information System (INIS)

    Barnes, M.J.

    1999-01-01

    This task consisted of both non-radioactive and radioactive (tracer) tests examining the influence of potentially significant variables on cesium tetraphenylborate precipitation kinetics. The work investigated the time required to reach cesium decontamination and the conditions that affect the cesium precipitation kinetics

  19. Radiochemical determination of cesium-137 in seawater

    International Nuclear Information System (INIS)

    Cunha, I.I.L.; Munita, C.S.; Paiva, R.P.

    1990-01-01

    Seawater samples were collected from the Atlantic Ocean, in the vicinity of Ubatuba (Sao Paulo State - Brazil), acidified to pH 1 and stored in polyethylene containers. Cesium was precipitated with ammonium phospho molybdate (AMP), synthesized in our laboratory. The elements potassium and rubidium present in the seawater are also coprecipitated by AMP and adequate decontamination of the cesium is made by preparing a column by mixing Cs-137 AMP precipitate and asbestos. The interfering elements were eluted with 1.0 M ammonium nitrate solution whereas cesium was eluted with 1.0 M sodium hydroxide solution. Cesium was reprecipitated by acidifying the solution with concentrated hydrochloric acid. The overall chemical yield of cesium was of 75%. (author)

  20. Cesium migration in LMFBR fuel pins

    International Nuclear Information System (INIS)

    Karnesky, R.A.; Jost, J.W.; Stone, I.Z.

    1978-10-01

    The factors affecting the axial migration of cesium in mixed oxide fuel pins and the effects of cesium migration on fuel pin performance are examined. The development and application of a correlated model which will predict the occurrence of cesium migration in a mixed oxide (75 w/o UO 2 + 25 w/o PuO 2 ) fuel pins over a wide range of fabrication and irradiation conditions are described

  1. Cesium ion bombardment of metal surfaces

    International Nuclear Information System (INIS)

    Tompa, G.S.

    1986-01-01

    The steady state cesium coverage due to cesium ion bombardment of molybdenum and tungsten was studied for the incident energy range below 500 eV. When a sample is exposed to a positive ion beam, the work function decreases until steady state is reached with a total dose of less than ≅10 16 ions/cm 2 , for both tungsten and molybdenum. A steady state minimum work function surface is produced at an incident energy of ≅100 eV for molybdenum and at an incident energy of ≅45 eV for tungsten. Increasing the incident energy results in an increase in the work function corresponding to a decrease in the surface coverage of cesium. At incident energies less than that giving the minimum work function, the work function approaches that of cesium metal. At a given bombarding energy the cesium coverage of tungsten is uniformly less than that of molybdenum. Effects of hydrogen gas coadsorption were also examined. Hydrogen coadsorption does not have a large effect on the steady state work functions. The largest shifts in the work function due to the coadsorption of hydrogen occur on the samples when there is no cesium present. A theory describing the steady-state coverage was developed is used to make predictions for other materials. A simple sticking and sputtering relationship, not including implantation, cannot account for the steady state coverage. At low concentrations, cesium coverage of a target is proportional to the ratio of (1 - β)/γ where β is the reflection coefficient and γ is the sputter yield. High coverages are produced on molybdenum due to implantation and low backscattering, because molybdenum is lighter than cesium. For tungsten the high backscattering and low implantation result in low coverages

  2. Cesium levels in foodstuffs fall slowly

    International Nuclear Information System (INIS)

    Rantavaara, A.

    1994-01-01

    Since spring 1986, radioactive decay has reduced the total amount of radioactive cesium 137 in the Finnish environment, originating in Chernobyl, by 17 per cent. The cesium content in fish keeps falling at a diminishing rate, depending on the species of fish and environmental factors. The use of fish from lakes need not be restricted anymore. The cesium contents of game, mushrooms and wild berries have remained steady for some years now. The same is true for agricultural produce. The contents in milk and meat still keep falling slowly. Most of the cesium ingested by finns comes from fish, then from game, reindeer and gathered foods; the lowest amounts are received from agricultural products. (orig.)

  3. Studies on release and deposition behaviour of cesium from contaminated sodium pools and cesium trap development for FBTR

    International Nuclear Information System (INIS)

    Sahoo, P.; Kannan, S.E.; Muralidharan, P.; Chandran, K.

    1996-01-01

    Investigations were carried out on the release and deposition behaviour of cesium from sodium pools in air-filled chamber in the temperature range of 673 to 873 K, using Cs-134 to simulate Cs-137. About 0.12 kg of sodium was loaded in a burn-pot together with 92.5 kBq of cesium. Experiments were carried out with 21% oxygen. Natural burning period of sodium and specific activity ratio between cesium and sodium showed a tendency to decrease and release fractions of both the species tended to increase with temperature. From the surface deposited aerosols it was observed that cesium has propensity to settle down closer to the point of release. A cesium trap has been developed for FBTR with RVC as getter material. Absorption kinetics and particle release behaviour studies pointed to its intended satisfactory performance in the plant. (author)

  4. Behavior of ion-implanted cesium in silicon dioxide films

    International Nuclear Information System (INIS)

    Fishbein, B.J.

    1988-01-01

    Charged impurities in silicon dioxide can be used to controllably shift the flatband voltage of metal-oxide-semiconductor devices independently of the substrate doping, the gate oxide thickness and the gate-electrode work function. Cesium is particularly well suited for this purpose because it is immobile in SiO 2 at normal device operating temperatures, and because it can be controllably introduced into oxide films by ion implantation. Cesium is positively charged in silicon dioxide, resulting in a negative flatband voltage shift. Possible applications for cesium technology include solar cells, devices operated at liquid nitrogen temperature, and power devices. The goal of this work has been to characterize as many aspects of cesium behavior in silicon dioxide as are required for practical applications. Accordingly, cesium-ion implantation, cesium diffusion, and cesium electrical activation in SiO 2 were studied over a broad range of processing conditions. The electrical properties of cesium-containing oxides, including current-voltage characteristics, interface trap density, and inversion-layer carrier mobility were examined, and several potential applications for cesium technology have been experimentally demonstrated

  5. Cesium diffusion in Bure mud-rock: effect of cesium sorption and of the surface structure of the clay

    International Nuclear Information System (INIS)

    Melkior, T.; Motellier, S.; Yahiaoui, S.

    2005-01-01

    Full text of publication follows: This work is devoted to cesium diffusion through mud-rock samples from Bure (Meuse/Haute- Marne, France). This rock is mainly composed of interstratified illite/smectite, quartz and calcite. According to published data, positively charged solutes exhibit high diffusion coefficients in argillaceous media compared to neutral species. This effect was actually observed for cesium in Bure mud-rock samples: the effective diffusion coefficients (De) of tritiated water and cesium were found to be ca. 2 x 10 -11 m 2 s -1 and 2.5 x 10 -10 m 2 s -1 , respectively. Some authors assign this 'enhanced diffusion' of cations to the particular migration of ions within the electrical double layer, next to mineral surfaces (surface diffusion mechanism). To assess the role of sorbed ions in the diffusive transfer, cesium diffusion coefficients in Bure mud-rock were measured at different cesium concentrations. The distribution coefficient of cesium onto Bure mud-rock was measured in batch: it significantly varies over the concentration range investigated in the diffusion tests (between 2 x 10 -6 M and 2 x 10 -2 M). If sorbed ions contribute to the transfer, the effective diffusion coefficients deduced from these different tests should depend on cesium concentration. Nevertheless, the measured effective diffusion coefficients are found to be relatively unaffected by cesium concentration. It is thus concluded that ions at the sorbed state play a minor role in the diffusion. Following the assumption of an 'accelerated' transfer due to ions located in the diffuse double layer, the charge of the clay particles should affect the 'enhanced diffusion' of cesium. Therefore, a mud-rock sample was first crushed and contacted with a cationic surfactant at different solid/liquid ratios. The conditions were adjusted to obtain suspensions having positive, neutral and negative zeta potentials respectively. Three compact samples were then made with these different

  6. ''Crown molecules'' for separating cesium

    International Nuclear Information System (INIS)

    Dozol, J.F.; Lamare, V.

    2002-01-01

    After the minor actinides, the second category of radionuclides that must be isolated to optimize nuclear waste management concerns fission products, especially two cesium isotopes. If the cesium-135 isotope could be extracted, it could subsequently be transmuted or conditioned using a tailor-made process. Eliminating the 137 isotope from reprocessing and nuclear facility-dismantling waste would allow to dispose of most of this waste in near-surface facilities, and simply process the small remaining quantity containing long-lived elements. CEA research teams and their international partners have thought up crown molecules that could be used to pick out the cesium and meet these objectives. (authors)

  7. A combined cesium-strontium extraction/recovery process

    International Nuclear Information System (INIS)

    Horwitz, E.P.; Dietz, M.L.; Jensen, M.P.

    1996-01-01

    A new solvent extraction process for the simultaneous extraction of cesium and strontium from acidic nitrate media is described. This process uses a solvent formulation comprised of 0.05 M di-t-butylcyclohexano-18-crown-6 (DtBuCH18C6), 0.1 M Crown 100' (a proprietary, cesium-selective derivative of dibenzo-18-crown-6), 1.2 M tributyl phosphate (TBP), and 5% (v/v) lauryl nitrile in an isoparaffinic hydrocarbon diluent. Distribution ratios for cesium and strontium from 4 M nitric acid are 4.13 and 3.46, respectively. A benchtop batch countercurrent extraction experiment indicates that >98% of the cesium and strontium initially present in the feed solution can be removed in only four extraction stages. Through proper choice of extraction and strip conditions, extracted cesium and strontium can be recovered either together or individually

  8. Uptake behavior of titanium molybdophosphate for cesium and strontium

    International Nuclear Information System (INIS)

    Yavari, R.; Ahmadi, S.J.; Huang, Y.D.

    2010-01-01

    This study investigates uptake of cesium and strontium from aqueous solution similar to nuclear waste on three samples of titanium molybdophosphate (TMP) synthesized under various conditions. Effects of concentration of sodium nitrate, pH and contact time on the uptake of cesium and strontium have been studied by bath method. The results showed that TMP has high affinity toward cesium and strontium at pH > 2 and relatively low concentration of sodium nitrate. Kinetic data indicated that cesium uptake process to achieve equilibrium was faster than strontium. Cesium and strontium breakthrough curves were examined at 25 deg C using column packed with H 3 O + form of TMP and breakthrough curves showed symmetrical S-shaped profiles. At the same time, the calculated breakthrough capacity for cesium was higher than strontium. The results of desorption studies showed that over 99% of cesium and strontium was washed out of column by using 4 M NH 4 Cl solution. This study suggests that TMP can have great potential applications for the removal of strontium and specially cesium from nuclear waste solution. (author)

  9. On mobility of cesium-137, sodium, potassium in various types of soils and prediction of cesium-137 cumulation in agricultural plants

    International Nuclear Information System (INIS)

    Ashkinazi, Eh.I.

    1990-01-01

    Mobility of cesium-137, sodium and potassium in the natural environment in podzolic gray and chernozem medium-loamy, sward podzolic sandy soils and chernozem has been studied. Durability of fixation of cesium-137 increases in a number of soils and increase of the level of metabolic potassium. Coefficient of transition of level of metabolic cesium-137 by potassium and sodium, and of sodium by potassium. The mentioned above coefficients can be used for the prediction of cesium-137 cumulation in plants

  10. Separation of cesium and strontium with zeolites

    Energy Technology Data Exchange (ETDEWEB)

    Kanno, T; Hashimoto, H [Tohoku Univ., Sendai (Japan). Research Inst. of Mineral Dressing and Metallurgy

    1976-06-01

    The basic studies of separation of cesium and strontium were made with specimens of zeolite, which are synthetic zeolites A, X and Y; synthetic mordenite; natural mordenite; and clinoptilolite. Ammonium chloride was used as eluent, because it was considered to be a most appropriate eluent in alkaline chlorides. Cesium was easily eluted from the zeolites A and X by ammonium chloride solution, but it was difficult to elute from the synthetic mordenite, natural mordenite and clinoptilolite by ammonium chloride solution, but it was difficult to elute from the zeolites A and X. The zeolite Y is the only one zeolite among these zeolites from which both of cesium and strontium were easily eluted by ammonium chloride solution. Strontium could be separated from cesium with zeolites by formation of Sr-EDTA chelate at pH above 11. In this process, cesium was only exchanged in zeolite column, but strontium flow out from it.

  11. Separation of cesium and strontium with zeolites

    International Nuclear Information System (INIS)

    Kanno, Takuji; Hashimoto, Hiroyuki

    1976-01-01

    The basic studies of separation of cesium and strontium were made with specimens of zeolite, which are synthetic zeolites A, X and Y; synthetic mordenite; natural mordenite; and clinoptilolite. Ammonium chloride was used as eluent, because it was considered to be a most appropriate eluent in alkaline chlorides. Cesium was easily eluted from the zeolites A and X by ammonium chloride solution, but it was difficult to elute from the synthetic mordenite, natural mordenite and clinoptilolite by ammonium chloride solution, but it was difficult to elute from the zeolites A and X. The zeolite Y is the only one zeolite among these zeolites from which both of cesium and strontium were easily eluted by ammonium chloride solution. Strontium could be separated from cesium with zeolites by formation of Sr-EDTA chelate at pH above 11. In this process, cesium was only exchanged in zeolite column, but strontium flow out from it. (auth.)

  12. Magnetic circular Dichroism and Faraday rotation of cesium-argon excimers and cesium dimers

    International Nuclear Information System (INIS)

    Islam, M.A.

    1981-01-01

    Magnetic Circular Dichroism (MCD) and Faraday Rotation (FR) of excimer absorption bands in gases are measured to obtain the first direct information about the angular momentum quantum numbers and the angular momentum coupling schemes of excimer molecules. So far, there has been no experimental method to obtain information about the axial angular momentum and the angular momentum coupling schemes of excimer molecules. In this experiment, the MCD and the FR of cesium-argon excimer and cesium dimer absorption bands between 5000 A and 10,000 A are measured for the range of temperature from 116 0 to 355 0 C. Of particular interest is the blue wing of D 2 line in cesium which has been the subject of vigorous investigation. The measured MCD data at the blue wing of D 2 line clearly shows that the assignment of 2 μ/sub 1/2/ to this excited state assuming Hund's case (b) is a poor approximation. By a simple inspection of the MCD data, it is found that the coupling scheme is more nearly Hund's case (c) than Hynd's case (b). Several other new and interesting results are obtained. The blue wing associated with 5D transition in atomic cesium is devoid of MCD and exhibits strong MCD in the red wings. Thus, the assignment of 2 μ/sub 1/2/ and 2 π to the blue and red wings, respectively, assuming Hund's case (a) and (b), is a very good approximation. Again the yellow-green band associated with 7s-6s transition in atomic cesium shows no MCD. It is therefore also a good approximation to assign 2 μ/sub 1/2/ to the upper state assuming Hund's case (b). Much more information can be obtained by a detailed analysis of the MCD data

  13. Cesium heat-pipe thermostat

    Energy Technology Data Exchange (ETDEWEB)

    Wu, F.; Song, D.; Sheng, K.; Wu, J. [Changcheng Institute of Metrology and Measurement, 100095, Beijing (China); Yi, X. [China National South Aviation industry CO., LTD., 412002, Hunan (China); Yu, Z. [Dalian Jinzhou Institute of Measurement and Testing, 116100, Liaoning (China)

    2013-09-11

    In this paper the authors report a newly developed Cesium Heat-Pipe Thermostat (Cs HPT) with the operation range of 400 °C to 800 °C. The working medium is cesium (Cs) of 99.98% purity and contains no radioisotope. A Cs filing device is developed which can prevent Cs being in contact with air. The structural material is stainless steel. A 5000 h test has been made to confirm the compatibility between cesium and stainless steel. The Cs HPT has several thermometer wells of 220mm depth with different diameters for different sizes of thermometers. The temperature uniformity of the Cs HPT is 0.06 °C to 0.20 °C. A precise temperature controller is used to ensure the temperature fluctuation within ±0.03 °C. The size of Cs HPT is 380mm×320mm×280mm with foot wheels for easy moving. The thermostat has been successfully used for the calibration of industrial platinum resistance thermometers and thermocouples.

  14. Cesium Salts of Phosphotungstic Acid: Comparison of Surface ...

    African Journals Online (AJOL)

    NICO

    acidity and lowest solubility in reaction media in comparison with the other cesium content salts. KEYWORDS. Polyoxometalates, cesium ... insoluble salt of HPA is cesium salt of tungstophosphoric acid,. CsxH3-xPW12O40 (CsxPW), a ... of Cs2CO3, very fine particles (precipitates) were formed to make the solution milky.

  15. Method of processing radioactive cesium liquid wastes

    International Nuclear Information System (INIS)

    Nishijima, Hiroaki; Asaoka, Sachio; Kondo, Tadami; Suzuki, Isao.

    1985-01-01

    Purpose: To convert and settle cesium, mainly, Cs-137 in liquid wastes in the form of pollucites, that is, cesium-containing ores. Constitution: Water, silica, alumina and alkali metal source are mixed with radioactive liquid wastes containing cesium as the main metal element ingredient, to which an onium compound is further added and they are brought into reaction till pollucite ores (Cs 16 (Al 16 Si 32 O 96 )) are formed. Since most portion of cesium is thus settled in the form of pollucites, storage safety can be attained. Further, the addition of the onium compound can moderate the condition and shorten the time till the pollucite ores are formed. The onium compound usable herein includes tetramethyl ammonium. (Kamimura, M.)

  16. Evaluation of electrochemical ion exchange for cesium elution

    International Nuclear Information System (INIS)

    Bontha, J.D.; Kurath, D.E.; Surma, J.E.; Buehler, M.F.

    1996-04-01

    Electrochemical elution was investigated as an alternative method to acid elution for the desorption of cesium from loaded ion exchange resins. The approach was found to have several potential advantages over existing technologies, in particular, electrochemical elution eliminates the need for addition of chemicals to elute cesium from the ion exchange resin. Also, since, in the electrochemical elution process the eluting solution is not in direct contact with the ion exchange material, very small volumes of the eluting solution can be used in a complete recycle mode in order to minimize the total volume of the cesium elute. In addition, the cesium is eluted as an alkaline solution that does not require neutralization with caustic to meet the tank farm specifications. Other advantages include easy incorporation of the electrochemical elution process into the present cesium recovery schemes

  17. Seasonal variation of cesium 134 and cesium 137 in semidomestic reindeer in Norway after the Chernobyl accident

    International Nuclear Information System (INIS)

    Eikelmann, I.M.H.; Bye, K.; Sletten, H.D.

    1990-01-01

    The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively

  18. Adsorption of cesium on cement mortar from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Volchek, Konstantin, E-mail: konstantin.volchek@ec.gc.ca [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Kuang, Wenxing; DeMaleki, Zack [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, Canada K1N 6N5 (Canada)

    2011-10-30

    Highlights: {yields} The adsorption of cesium on cement mortar was investigated in a range of temperatures and cesium concentrations. {yields} The pseudo-second order kinetic model produced a good fit with the experimental kinetic data. {yields} Equilibrium test results correlated well with the Freundlich isotherm adsorption model. {yields} The interaction between cesium ions and cement mortar was dominated by chemical adsorption. - Abstract: The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L{sup -1} and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L{sup -1} while the respective surface concentration on coupons varied from 0.0395 to 22.34 {mu}g cm{sup -2}. Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol{sup -1} suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  19. Application of Cesium isotopes in daily life

    International Nuclear Information System (INIS)

    Jordao, B.O.; Quaresma, D.S.; Carvalho, R.J.; Peixoto, J.G.P.

    2014-01-01

    In the world of science, the desire of the scientific community to discover new chemical elements is crucial for the development of new technologies in various fields of knowledge. And the main chemical element addressed by this article is Cesium, but specifically 133 Cesium isotope and radioisotope 137 Cesium, exemplifying their physical and chemical characteristics, and their applications. This article will also show how these isotopes have provided researchers a breakthrough in the field of radiological medicine and in time and frequency metrology. (author)

  20. The burden of cesium 137 in forest clerks

    International Nuclear Information System (INIS)

    Piechotowski, I.; Jaroni, J.; Link, B.; Groezinger, O.

    2000-01-01

    In 47 forest clerks from the regions Ortenau and Oberschwaben in south-west Germany the incorporation of cesium 137 and potassium 40 was measured in autumn 1994. Soil burden as well as burden of nutrition with cesium 137 are different in these regions for geological reasons and as a result of the nuclear accident of Chernobyl. Caused by low content of clay in Oberschwaben, the transfer of cesium to plants is assisted. Heavy rainfall after the nuclear accident led to an additional increase of burden. The median of the concentration of cesium 137 was 1.4 Bq/kg body weight. The median for potassium 40 was 58 Bq/kg body weight. For cesium 137 regional differences were observed. For persons from Oberschwaben the median for cesium 137 was with 2.8 Bq/kg body weight clearly higher than for persons from Ortenau with 0,6 Bq/kg body weight. Concerning nutrition habits, the clearest difference was found comparing persons who had ate a minimum of four portions of deer from the surroundings within the last four weeks with persons who had ate less than four portions of deer from the surroundings within the last four weeks. The difference was greater in Oberschwaben than in Ortenau. The effective dose of cesium 137 calculated on the basis of the incorporation is very low compared to natural radiation. This is also valid for persons from Oberschwaben. (orig.) [de

  1. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    International Nuclear Information System (INIS)

    Fujishiro, F.; Ishii, K.; Matsuyama, S.; Arai, H.; Ishizaki, A.; Osada, N.; Sugai, H.; Kusano, K.; Nozawa, Y.; Yamauchi, S.; Karahashi, M.; Oshikawa, S.; Kikuchi, K.; Koshio, S.; Watanabe, K.; Suzuki, Y.

    2014-01-01

    Highlights: • There are radioactively contaminated soils having a radioactive cesium transfer of 0.01. • Micro-PIXE analysis has revealed an existence of phosphorus in a contaminated soil. • Radioactive cesium captured by phosphorus compound would be due to radioactive transfer. -- Abstract: Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ∼0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds

  2. Method for synthesizing pollucite from chabazite and cesium chloride

    International Nuclear Information System (INIS)

    Pereira, C.

    1999-01-01

    A method is described for immobilizing waste chlorides salts containing radionuclides and hazardous nuclear material for permanent disposal, and in particular, a method is described for immobilizing waste chloride salts containing cesium, in a synthetic form of pollucite. The method for synthesizing pollucite from chabazite and cesium chloride includes mixing dry, non-aqueous cesium chloride with chabazite and heating the mixture to a temperature greater than the melting temperature of the cesium chloride, or above about 700 C. The method further comprises significantly improving the rate of retention of cesium in ceramic products comprised of a salt-loaded zeolite by adding about 10% chabazite by weight to the salt-loaded zeolite prior to conversion at elevated temperatures and pressures to the ceramic composite. 3 figs

  3. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    Science.gov (United States)

    Fujishiro, F.; Ishii, K.; Matsuyama, S.; Arai, H.; Ishizaki, A.; Osada, N.; Sugai, H.; Kusano, K.; Nozawa, Y.; Yamauchi, S.; Karahashi, M.; Oshikawa, S.; Kikuchi, K.; Koshio, S.; Watanabe, K.; Suzuki, Y.

    2014-01-01

    Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ˜0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds.

  4. Sorption of cesium on titanium and zirconium phosphates

    International Nuclear Information System (INIS)

    Lebedev, V.N.; Mel'nik, N.A.; Rudenko, A.V.

    2003-01-01

    Titanium and zirconium phosphates were prepared from mineral raw materials of the Kola Peninsula. Their capability to recover cesium cations from the model solutions and liquid radioactive waste (LRW) was studied. Titanium phosphate prepared from solutions formed by titanite breakdown demonstrates greater distribution coefficients of cesium as compared to zirconium phosphate. Titanium phosphate as a cheaper agent featuring greater sorption capacity was recommended for treatment of LRW to remove cesium [ru

  5. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Andrello, Avacir C.; Appoloni, Carlos R., E-mail: acandrello@uel.b [Universidade Estadual de Londrina, PR (Brazil). Dept. de Fisica; Araujo, Ednaldo S. [EMBRAPA Agrobiologia, Seropedica, RJ (Brazil); Thomaz, Edivaldo L. [Universidade Estadual do Centro-Oeste - UNICENTRO, Guarapuava, PR (Brazil). Dept. de Geografia; Medeiros, Pedro Henrique Augusto [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia Agricola; Macedo, Iris L. [Universidade de Brasilia (UnB), DF (Brazil). Faculdade de Tecnologia. Dept. de Engenharia Civil e Ambiental

    2009-07-01

    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 +- 15 Bq.m{sup -2} for South region to 15 +- 2 Bq.m{sup -2} for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  6. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    International Nuclear Information System (INIS)

    Andrello, Avacir C.; Appoloni, Carlos R.; Thomaz, Edivaldo L.; Medeiros, Pedro Henrique Augusto; Macedo, Iris L.

    2009-01-01

    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 ± 15 Bq.m -2 for South region to 15 ± 2 Bq.m -2 for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  7. Surface interactions of cesium and boric acid with stainless steel

    International Nuclear Information System (INIS)

    Grossman-Canfield, N.

    1995-08-01

    In this report, the effects of cesium hydroxide and boric acid on oxidized stainless steel surfaces at high temperatures and near one atmosphere of pressure are investigated. This is the first experimental investigation of this chemical system. The experimental investigations were performed using a mass spectrometer and a mass electrobalance. Surfaces from the different experiments were examined using a scanning electron microscope to identify the presence of deposited species, and electron spectroscopy for chemical analysis to identify the species deposited on the surface. A better understanding of the equilibrium thermodynamics, the kinetics of the steam-accelerated volatilizations, and the release kinetics are gained by these experiments. The release rate is characterized by bulk vaporization/gas-phase mass transfer data. The analysis couples vaporization, deposition, and desorption of the compounds formed by cesium hydroxide and boric acid under conditions similar to what is expected during certain nuclear reactor accidents. This study shows that cesium deposits on an oxidized stainless steel surface at temperatures between 1000 and 1200 Kelvin. Cesium also deposits on stainless steel surfaces coated with boric oxide in the same temperature ranges. The mechanism for cesium deposition onto the oxide layer was found to involve the chemical reaction between cesium and chromate. Some revaporization in the cesium hydroxide-boric acid system was observed. It has been found that under the conditions given, boric acid will react with cesium hydroxide to form cesium metaborate. A model is proposed for this chemical reaction

  8. Hanford waste encapsulation: strontium and cesium

    International Nuclear Information System (INIS)

    Jackson, R.R.

    1976-06-01

    The strontium and cesium fractions separated from high radiation level wastes at Hanford are converted to the solid strontium fluoride and cesium chloride salts, doubly encapsulated, and stored underwater in the Waste Encapsulation and Storage Facility (WESF). A capsule contains approximately 70,000 Ci of 137 Cs or 70,000 to 140,000 Ci of 90 Sr. Materials for fabrication of process equipment and capsules must withstand a combination of corrosive chemicals, high radiation dosages and frequently, elevated temperatures. The two metals selected for capsules, Hastelloy C-276 for strontium fluoride and 316-L stainless steel for cesium chloride, are adequate for prolonged containment. Additional materials studies are being done both for licensing strontium fluoride as source material and for second generation process equipment

  9. Axial migratin of cesium in LMFBR fuel pins

    International Nuclear Information System (INIS)

    Karnesky, R.A.; Bridges, A.E.; Jost, J.W.

    1981-11-01

    A correlated model for quantitatively predicting the behavior of cesium in LMFBR fuel pins has been developed. This correlation was shown to be in good agreement with experimental data. It has been used to predict the behavior of cesium in the FFTF driver fuel and as the result of this analysis it has been shown that the accumulation of cesium in the insulator pellets at the ends of the fuel column will not be life limiting

  10. Cesium glass irradiation sources

    International Nuclear Information System (INIS)

    Plodinec, M.J.

    1982-01-01

    The precipitation process for the decontamination of soluble SRP wastes produces a material whose radioactivity is dominated by 137 Cs. Potentially, this material could be vitrified to produce irradiation sources similar to the Hanford CsCl sources. In this report, process steps necessary for the production of cesium glass irradiation sources (CGS), and the nature of the sources produced, are examined. Three options are considered in detail: direct vitrification of precipitation process waste; direct vitrification of this waste after organic destruction; and vitrification of cesium separated from the precipitation process waste. Direct vitrification is compatible with DWPF equipment, but process rates may be limited by high levels of combustible materials in the off-gas. Organic destruction would allow more rapid processing. In both cases, the source produced has a dose rate of 2 x 10 4 rads/hr at the surface. Cesium separation produces a source with a dose rate of 4 x 10 5 at the surface, which is nearer that of the Hanford sources (2 x 10 6 rads/hr). Additional processing steps would be required, as well as R and D to demonstrate that DWPF equipment is compatible with this intensely radioactive material

  11. Spatial variability and Cesium-137 inventories in native forest

    International Nuclear Information System (INIS)

    Andrello, A.C.; Appoloni, C.R.

    2004-01-01

    With the nuclear fission discovery and development of nuclear weapons in 1940s, artificial radioisotopes were introduced in the environment. This contamination is due to worldwide fallout by superficial nuclear tests realized from early 1950s to late 1970s by USA, former URSS, UK, France and China. One of theses radioisotopes that have been very studied is cesium-137. Cesium-137 has a half-life of 30.2 years and its biological behavior is similar to the potassium. The behavior in soil matrix, depth distribution, spatial variability and inventories values of cesium-137 has been determinate for several regions of the world. In Brazil, some research groups have worked on this subject, but there are few works published about theses properties of cesium-137. The aim of this paper was study the depth distribution, spatial variability, and inventory of cesium-137 in native forest. Two native forests (Mata 1 and Mata UEL) were sampling in region of Londrina, PR. The results shows that there is a spatial variability of 40% for Mata 1 and 42% for Mata UEL. The depth distribution of cesium-137 for two forests presented a exponential form, characteristic to undisturbed soil. Cesium-137 inventory determinate for Mata 1 was 358 Bq m -2 and for Mata UEL was 320 Bq m -2 . (author)

  12. Decorporation of cesium-137

    International Nuclear Information System (INIS)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C.

    1997-01-01

    Cesium radio-isotopes, especially cesium-137 ( 137 Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137 Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137 Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137 Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  13. Conceptual design of cesium removal device for ITER NBI maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Oka, Kiyoshi; Shibanuma, Kiyoshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2003-03-01

    Cesium is required in order to generate a stable negative ion of hydrogen in an ion source of the neutral beam injector (NBI), which is one of the plasma-heating devices for International Thermonuclear Experimental Reactor (ITER). After long time operation of the NBI, the cesium deposits to the insulators supporting the electrode. Due to the deterioration of the insulation resistance, the continuous operation of the NBI will be difficult. In addition, the NBI device is activated by neutrons from D-T plasma, so that periodic removal and cleaning of the cesium on the insulators by remove handling is required. A study of the cesium removal scenario and the device is therefore required considering remote handling. In this report, a cesium removal procedure and conceptual design of the cesium removal device using laser ablation technique are studied, and the feasibility of the laser ablation method is shown. (author)

  14. Ionization mechanism of cesium plasma produced by irradiation of dye laser

    International Nuclear Information System (INIS)

    Yamada, Jun; Shibata, Kohji; Uchida, Yoshiyuki; Hioki, Yoshiaki; Sahashi, Toshio.

    1992-01-01

    When a cesium vapor was irradiated by a dye laser which was tuned to the cesium atomic transition line, the number of charged particles produced by the laser radiation was observed. Several sharp peaks in the number of charged particles were observed, which corresponded to the atomic transition where the lower level was the 6P excited atom. The ionization mechanism of the laser-produced cesium plasma has been discussed. An initial electron is produced by laser absorptions of the cesium dimer. When the cesium density is high, many 6P excited atoms are excited by electron collisions. The 6P excited atom further absorbs the laser photon and is ionized through the higher-energy state. As the cesium vapor pressure increases, the resonance effect becomes observable. The 6P excited atom plays dominant role in the ionization mechanism of the laser-produced cesium plasma. (author)

  15. Extraction of cesium from acid solutions

    International Nuclear Information System (INIS)

    Katykhin, G.S.; Simonov, A.S.

    1983-01-01

    The extraction of cesium from acidic solutions is studied. Halogen-substituted carboxylic acids were chosen for the aqueous phase and nitrobenzene the diluent. The distribution coefficients are determined by the use of radioactive tracers 134 Cs and 137 Cs. It is believed that large singly charged anions of strong acids are necessary for the extraction of cesium. Metal halide acids are selected for supplying the anions

  16. Cesium in the nutrient cycle

    International Nuclear Information System (INIS)

    Rantavaara, A.

    1992-01-01

    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland

  17. Removal of cesium radioisotopes from solutions using granulated zeolites

    International Nuclear Information System (INIS)

    Bronic, J.; Subotic, B.

    1991-01-01

    The influence of type of zeolite and the flow rate of solution through the column on the removal efficiency of radioactive cesium ions from solution has been investigated. The analysis of the change in the concentration of cesium ions in the solutions and distribution of cesium ions in the column fillings (granulated zeolites), after passing the solutions through the columns filled with various granulated zeolites (zeolite 4A, zeolite 13X, synthetic mordenite) was performed. On the basis of the results of this study, the conditions for the most efficient removal of cesium ions from solutions have been discussed. (author) 35 refs.; 9 figs.; 1 tab

  18. Study of strontium and cesium migration in fractured crystalline rock

    International Nuclear Information System (INIS)

    Gustafsson, E.; Klockars, C.E.

    1984-01-01

    The purpose of this investigation has been to study the retardation and dilution of non-active strontium and cesium relative to a non-absorbing substance (iodide) in a well-defined fracture zone in the Finnsjoen field research area. The investigation was carried out in a previously tracer-tested fracture zone. The study has encompassed two separate test runs with prolonged injection of strontium and iodide and of cesium and iodide. The test have shown that: - Strontium is not retarded, but rather absorbed to about 40% at equilibrium. - At injection stop, 36.3% of the injected mass of strontium has been absorbed and there is no deabsorption. -Cesium is retarded a factor of 2-3 and absorbed to about 30% at equilibrium. - At injection stop, 39.4% of the injected mass of cesium has been absorbed. Cesium is deabsorbed after injection stop (400h) and after 1300 hours, only 22% of the injected mass of cesium is absorbed. (author)

  19. Cesium vapor cycle for an advanced LMFBR

    International Nuclear Information System (INIS)

    Fraas, A.P.

    1975-01-01

    A review indicates that a cesium vapor topping cycle appears attractive for use in the intermediate fluid circuit of an advanced LMFBR designed for a reactor outlet temperature of 1250 0 F or more and would have the following advantages: (1) it would increase the thermal efficiency by about 5 to 10 points (from approximately 40 percent to approximately 45 to 50 percent) thus reducing the amount of waste heat rejected to the environment by 15 to 30 percent. (2) the higher thermal efficiency should reduce the overall capital cost of the reactor plant in dollars per kilowatt. (3) the cesium can be distilled out of the intermediate fluid circuit to leave it bone-dry, thus greatly reducing the time and cost of maintenance work (particularly for the steam generator). (4) the large volume and low pressure of the cesium vapor region in the cesium condenser-steam generator greatly reduces the magnitude of pressure fluctuations that might occur in the event of a leak in a steam generator tube, and the characteristics inherent in a condenser make it easy to design for rapid concentration of any noncondensibles that may form as a consequence of a steam leak into the cesium region so that a steam leak can be detected easily in the very early stages of its development

  20. Cesium and Strontium Separation Technologies Literature Review

    Energy Technology Data Exchange (ETDEWEB)

    T. A. Todd; T. A. Todd; J. D. Law; R. S. Herbst

    2004-03-01

    Integral to the Advanced Fuel Cycle Initiative (AFCI) Program’s proposed closed nuclear fuel cycle, the fission products cesium and strontium in the dissolved spent nuclear fuel stream are to be separated and managed separately. A comprehensive literature survey is presented to identify cesium and strontium separation technologies that have the highest potential and to focus research and development efforts on these technologies. Removal of these high-heat-emitting fission products reduces the radiation fields in subsequent fuel cycle reprocessing streams and provides a significant short-term (100 yr) heat source reduction in the repository. This, along with separation of actinides, may provide a substantial future improvement in the amount of fuel that could be stored in a geologic repository. The survey and review of the candidate cesium and strontium separation technologies are presented herein. Because the AFCI program intends to manage cesium and strontium together, technologies that simultaneously separate both elements are of the greatest interest, relative to technologies that separate only one of the two elements.

  1. METHOD FOR THE RECOVERY OF CESIUM VALUES

    Science.gov (United States)

    Rimshaw, S.J.

    1960-02-16

    A method is given for recovering Cs/sup 137/ from radioactive waste solutions together with extraneous impurities. Ammonium alum is precipitated in the waste solution. The alum, which carries the cesium, is separated from the supernatant liquid and then dissolved in water. The resulting aqueous solution is then provided with a source of hydroxyl ions, which precipitates aluminum as the hydroxide, and the aluminum hydroxide is separated from the resulting liquid. This liquid, which contains anionic impurities together with ammonium and cesium, is passed through an anion exchange resin bed which removes the anionic impurities. The ammonium in the effluent is removed by destructive distiilation, leaving a substantiaily pure cesium salt in the effluent.

  2. Biochemical changes in rats under the influence of cesium chloride

    Directory of Open Access Journals (Sweden)

    N. M. Melnikova

    2013-04-01

    Full Text Available Cesium is lately accumulated actively in the environment, but its influence on human and ani­mal organism is the least studied among heavy metals. It is shown that the action of cesium chloride in rats caused significant changes in blood chemistry, which are characterized by a decrease of total protein content, pH, an increase in the level of urea, creatinine, glucose and total hemoglobin. The results showed that potassium content in all the studied organs and tissues of poisoned rats decreases under the action of cesium chloride. Histological examination of the heart tissue in rats poisoned with cesium chloride indicates the onset of pathology of cardiovascular system. It was found out that use of the drug “Asparkam” reduces the negative effect of cesium chloride on the body of rats.

  3. Cesium-134 and cesium-137 in honey bees and cheese samples collected in the U. S. after the Chernobyl accident

    Energy Technology Data Exchange (ETDEWEB)

    Ford, B C; Jester, W A; Griffith, S M; Morse, R A; Zall, R R; Lisk, D J; Burgett, D M; Bodyfelt, F W

    1988-01-01

    As a result of the Chernobyl accident on April 25, 1986, possible radioactive contamination of honey bees and cheese sampled in several areas of the United States were measured. Of bees collected in May and June of 1986 in both Oregon and New York, only those from Oregon showed detectable levels of cesium-134 (T1/2 = 2.05 years), a radionuclide which would have originated from the Chernobyl incident. Cheese produced in Oregon and New York before the accident showed only cesium-137 (T1/2 = 30.23 years) but cheese produced afterwards (May and September, 1986) in Oregon contained cesium-134. Cheese produced in Ohio and California at the time of the accident and thereafter contained only cesium-137. In general, the levels of radioactivity were higher in the West coast samples as compared to those taken in the East. The levels of radioactivity detected were considered to be toxicologically of no consequence.

  4. Electron-stimulated desorption of cesium atoms from cesium layers adsorbed on gold-covered tungsten

    Energy Technology Data Exchange (ETDEWEB)

    Ageev, V N; Kuznetsov, Yu A; Potekhina, N D, E-mail: kuznets@ms.ioffe.r [A F Ioffe Physico-Technical Institute, Russian Academy of Sciences, 194021, St Petersburg (Russian Federation)

    2010-03-03

    The electron-stimulated desorption (ESD) yields and energy distributions (ED) for neutral cesium atoms have been measured from cesium layers adsorbed on a gold-covered tungsten surface as a function of electron energy, gold film thickness, cesium coverage and substrate temperature. The measurements have been carried out using a time-of-flight method and surface ionization detector in the temperature range 160-300 K. A measurable ESD yield for Cs atoms is observed only after deposition of more than one monolayer of gold and cesium on a tungsten surface at a temperature T = 300 K, which is accompanied by the formation of a CsAu semiconductor film covered with a cesium atom monolayer. The Cs atom ESD yield as a function of incident electron energy has a resonant character and consists of two peaks, the appearance of which depends on both electron energy and substrate temperature. The first peak has an appearance threshold at an electron energy of 57 eV and a substrate temperature of 300 K that is due to Au 5p{sub 3/2} core level excitation in the substrate. The second peak appears at an electron energy of 24 eV and a substrate temperature of 160 K. It is associated with a Cs 5s core level excitation in the Cs adsorbed layer. The Au 5p{sub 3/2} level excitation corresponds to a single broad peak in the ED with a maximum at a kinetic energy of 0.45 eV at a substrate temperature T = 300 K, which is split into two peaks with maxima at kinetic energies of 0.36 and 0.45 eV at a substrate temperature of 160 K, associated with different Cs atom ESD channels. The Cs 5s level excitation leads to an ED for Cs atoms with a maximum at a kinetic energy of approx 0.57 eV which exists only at T < 240 K and low Cs concentrations. The mechanisms for all the Cs atom ESD channels are proposed and compared with the Na atom ESD channels in the Na-Au-W system.

  5. Recovery of cesium

    Science.gov (United States)

    Izatt, Reed M.; Christensen, James J.; Hawkins, Richard T.

    1984-01-01

    A process of recovering cesium ions from mixtures of ions containing them and other ions, e.g., a solution of nuclear waste materials, which comprises establishing a separate source phase containing such a mixture of ions, establishing a separate recipient phase, establishing a liquid membrane phase in interfacial contact with said source and recipient phases, said membrane phase containing a ligand, preferably a selected calixarene as depicted in the drawing, maintaining said interfacial contact for a period of time long enough to transport by said ligand a substantial portion of the cesium ion from the source phase to the recipient phase, and recovering the cesium ion from the recipient phase. The separation of the source and recipient phases may be by the membrane phase only, e.g., where these aqueous phases are emulsified as dispersed phases in a continuous membrane phase, or may include a physical barrier as well, e.g., an open-top outer container with an inner open-ended container of smaller cross-section mounted in the outer container with its open bottom end spaced from and above the closed bottom of the outer container so that the membrane phase may fill the outer container to a level above the bottom of the inner container and have floating on its upper surface a source phase and a recipient phase separated by the wall of the inner container as a physical barrier. A preferred solvent for the ligand is a mixture of methylene chloride and carbon tetrachloride.

  6. Cesium-137 retention in irops obtained from various soils

    International Nuclear Information System (INIS)

    Gulyakin, I.V.; Yudintseva, E.V.; Gorina, L.I.

    1974-01-01

    A non-station experiment has shown that the accumulation of cesium-137 in a plant yield depends on the type of soil. The highest contents of cesium-137 were found in the yield of plants from soddy-podzolic sandy loam soils, and the lowest- in those from leached chernozem. The accumulation of radiocesium in the yield of the basic produce strongly depended on the plant species. The amount of cesium-137 differed 5- to 7-fold in different crops

  7. Measurements of the cesium flow from a surface-plasma H- ion source

    International Nuclear Information System (INIS)

    Smith, H.V.; Allison, P.W.

    1979-01-01

    A surface ionization gauge (SIG) was constructed and used to measure the Cs 0 flow rate through the emission slit of a surface-plasma source (SPS) of H - ions with Penning geometry. The equivalent cesium density in the SPS discharge is deduced from these flow measurements. For dc operation the optimum H - current occurs at an equivalent cesium density of approx. 7 x 10 12 cm -3 (corresponding to an average cesium consumption rate of 0.5 mg/h). For pulsed operation the optimum H - current occurs at an equivalent cesium density of approx. 2 x 10 13 cm -3 (1-mg/h average cesium consumption rate). Cesium trapping by the SPS discharge was observed for both dc and pulsed operation. A cesium energy of approx. 0.1 eV is deduced from the observed time of flight to the SIG. In addition to providing information on the physics of the source, the SIG is a useful diagnostic tool for source startup and operation

  8. Selective extraction of cesium: from compound to process

    International Nuclear Information System (INIS)

    Simon, N.; Eymard, S.; Tournois, B.; Dozol, J.F.

    2000-01-01

    Under the French law of 30 December 1991 on nuclear waste management, research is conducted to recover long-lived fission products from high-level radioactive effluents generated by spent fuel reprocessing, in order to destroy them by transmutation or encapsulate them in specific matrices. Cesium extraction with mono and bis-crown calix(4)arenes (Frame 1) is a candidate for process development. These extractants remove cesium from highly acidic or basic pH media even with high salinity. A real raffinate was treated in 1994 in a hot cell to extract cesium with a calix-crown extractant. The success of this one batch experiment confirmed the feasibility of cesium decontamination from high-level liquid waste. It was then decided to develop a process flowchart to extract cesium selectively from high-level raffinate, to be included in the general scheme of long-lived radionuclide partitioning. It was accordingly decided to develop a process based on liquid-liquid extraction and hence optimize a calixarene/diluent solvent according to: - hydraulic properties: density, viscosity, interfacial tension, - chemical criteria: sufficient cesium extraction (depending on the diluent), kinetics, third phase elimination... New mono-crown-calixarenes branched with long aliphatic groups (Frame 2) were designed to be soluble in aliphatic diluents. To prevent third phase formation associated with nitric acid extraction, the addition of modifiers (alcohol, phosphate and amide) in the organic phase was tested (Frame 3). Table 1 shows examples of calixarene/diluent systems suitable for a process flowchart, and Figure 2 provides data on cesium extraction with these new systems. Alongside these improvements, a system based on a modified 1,3-di(n-octyl-oxy)2,4-calix[4]arene crown and a modified diluent was also developed, considering a mixed TPH/NPHE system as the diluent, where TPH (hydrogenated tetra propylene) is a common aliphatic industrial solvent and NPHE is nitrophenyl

  9. THERMIONIC EMISSION ENHANCEMENT FROM CESIUM COATED RHENIUM IN ELECTRIC FIELDS

    Energy Technology Data Exchange (ETDEWEB)

    de Steese, J. G.; Zollweg, R. J.

    1963-04-15

    The plasma-anode technique was used to observe anomalously high thermionic emission from a rhenium surface with small cesium coverage, where the work function of the composite surface is greater than the ionization potential of cesium. Data suggest that emission enhancement is caused by increased cesium coverage because of cesiumion trapping near the emitter surface under the influence of an ion-rich sheath. (auth)

  10. Method and article for primary containment of cesium wastes. [DOE patent application

    Science.gov (United States)

    Angelini, P.; Lackey, W.J.; Stinton, D.P.; Blanco, R.E.; Bond, W.D.; Arnold, W.D. Jr.

    1981-09-03

    A method for producing a cesium-retentive waste form, characterized by a high degree of compositional stability and mechanical integrity, is provided by subjecting a cesium-loaded zeolite to heat under conditions suitable for stabilizing the zeolite and immobilizing the cesium, and coating said zeolite for sufficient duration within a suitable environment with at least one dense layer of pyrolytic carbon to seal therein said cesium to produce a final, cesium-bearing waste form. Typically, the zolite is stabilized and the cesium immobilized in less than four hours by confinement within an air environment maintained at about 600/sup 0/C. Coatings are thereafter applied by confining the calcined zeolite within a coating environment comprising inert fluidizing and carbon donor gases maintained at 1000/sup 0/C for a suitable duration.

  11. Cesium Toxicity Alters MicroRNA Processing and AGO1 Expressions in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Il Lae Jung

    Full Text Available MicroRNAs (miRNAs are short RNA fragments that play important roles in controlled gene silencing, thus regulating many biological processes in plants. Recent studies have indicated that plants modulate miRNAs to sustain their survival in response to a variety of environmental stimuli, such as biotic stresses, cold, drought, nutritional starvation, and toxic heavy metals. Cesium and radio-cesium contaminations have arisen as serious problems that both impede plant growth and enter the food chain through contaminated plants. Many studies have been performed to define plant responses against cesium intoxication. However, the complete profile of miRNAs in plants during cesium intoxication has not been established. Here we show the differential expression of the miRNAs that are mostly down-regulated during cesium intoxication. Furthermore, we found that cesium toxicity disrupts both the processing of pri-miRNAs and AGONOUTE 1 (AGO1-mediated gene silencing. AGO 1 seems to be especially destabilized by cesium toxicity, possibly through a proteolytic regulatory pathway. Our study presents a comprehensive profile of cesium-responsive miRNAs, which is distinct from that of potassium, and suggests two possible mechanisms underlying the cesium toxicity on miRNA metabolism.

  12. Effect of cesium seeding on hydrogen negative ion volume production

    International Nuclear Information System (INIS)

    Bacal, M.; Balghiti-Sube, F. El; Elizarov, L. I.; Tontegode, A. J.

    1998-01-01

    The effect of cesium vapor partial pressure on the plasma parameters has been studied in the dc hybrid negative ion source ''CAMEMBERT III.'' The cesium vapor pressure was varied up to 10 -5 Torr and was determined by a surface ionization gauge in the absence of the discharge. The negative ion relative density measured by laser photodetachment in the center of the plasma extraction region increases by a factor of four when the plasma is seeded with cesium. However the plasma density and the electron temperature (determined using a cylindrical electrostatic probe) are reduced by the cesium seeding. As a result, the negative ion density goes up by a factor of two at the lowest hydrogen pressure studied. The velocity of the directed negative ion flow to the plasma electrode, determined from two-laser beam photodetachment experiments, appears to be affected by the cesium seeding. The variation of the extracted negative ion and electron currents versus the plasma electrode bias will also be reported for pure hydrogen and cesium seeded plasmas. The cesium seeding leads to a dramatic reduction of the electron component, which is consistent with the reduced electron density and temperature. The negative ion current is enhanced and a goes through a maximum at plasma electrode bias lower than 1 V. These observations lead to the conclusion that the enhancement of pure volume production occurs in this type of plasma. Possible mechanisms for this type of volume process will be discussed

  13. Redistribution of strontium and cesium during alteration of smectite to illite

    International Nuclear Information System (INIS)

    Ohnuki, Toshihiko; Murakami, Takashi; Sato, Tsutomu; Isobe, Hiroshi

    1994-01-01

    The redistribution of strontium and cesium during the alteration of smectite to illite has been studied under hydrothermal conditions at 200 C using solutions of 1x10 -4 M Sr and Cs. Two different sorption conditions were applied for the hydrothermal experiments. One was the condition in which strontium and cesium were sorbed by smectite before the hydrothermal experiments (dynamic condition). The other was the condition in which strontium and cesium were sorbed by the alteration products, illite/smectite (I/S) interstratified minerals after the hydrothermal experiments (static condition). The sorption characteristics of strontium and cesium by smectite, I/S interstratified minerals were examined by a sequential extraction method. Most of the strontium was desorbed from smectite and the I/S interstratified minerals with a 1 M KCl solution under both the dynamic and static conditions. Less than 1% of cesium was desorbed from the I/S interstratified minerals with any solution of a 1 M KCl, a 1 M HCl and a 6 M HCl under the dynamic condition, while most of cesium was desorbed with either solution of a 1 M KCl and 1 M HCl from smectite and from the I/S interstratified minerals under the static condition. These suggest that cesium sorbed by smectite changes its sorption characteristic during the alteration process, but strontium does not. Possible sites for more strongly bounded cesium to the I/S interstratified minerals may be at the 'ditrigonal cavity' of adjacent tetrahedral layers. (orig.)

  14. Radiation safety for incineration of radioactive waste contaminated by cesium

    International Nuclear Information System (INIS)

    Veryuzhs'kij, Yu.V.; Gryin'ko, O.M.; Tokarevs'kij, V.V.

    2016-01-01

    Problems in the treatment of radioactive waste contaminated by cesium nuclides are considered in the paper. Chornobyl experience in the management of contaminated soil and contaminated forests is analyzed in relation to the accident at Fukushima-1. The minimization of release of cesium aerosols into atmosphere is very important. Radiation influence of inhaling atmosphere aerosols polluted by cesium has damage effect for humans. The research focuses on the treatment of forests contaminated by big volumes of cesium. One of the most important technologies is a pyro-gasification incineration with chemical reactions of cesium paying attention to gas purification problems. Requirements for process, physical and chemical properties of treatment of radioactive waste based on the dry pyro-gasification incineration facilities are considered in the paper together with the discussion of details related to incineration facilities. General similarities and discrepancies in the environmental pollution caused by the accidents at Chornobyl NPP and Fukushima-1 NPP in Japan are analyzed

  15. Strontium-90 and cesium-137 in powdered milk

    International Nuclear Information System (INIS)

    1977-01-01

    Japan Chemical Analysis Center has analysed the strontium-90 and cesium-137 content in powdered milk. The samples were purchased on the open market in Tokyo from the powdered milk producers. The analysis of Strontium-90 and Cesium-137 content was carried out using the method recommended by Science and Technology Agency. (author)

  16. Using copper hexacyanoferrate (II) impregnated zeolite for cesium removal from radioactive liquid waste

    International Nuclear Information System (INIS)

    Fumio, K.; Kenji, M.

    1982-01-01

    Experiments were performed to obtain fundamental data on cesium ion removal characteristics of metal hexacyanoferrate (II) impregnated zeolite in radioactive liquid waste containing a large amount of sodium sulfate. Copper hexacyanoferrate (II) impregnated zeolite (CuFZ) was prepared and showed a high selectivity for cesium ion. The material was suitable for use in an ion exchange column. This exchanger could selectively and efficiently remove the cesium even if there is 15 wt% Na 2 SO 4 in the solution. Cesium removal ability and stability of CuFZ were excellent over a wide pH range between 1.5 and 10. The cesium ion exchange ability was not influenced by the presence of the alkali metal ions, calcium and magnesium, and carbonate ions even at concentrations 25 times greater than the cesium ion. However, since ammonium ion behaves similarly to cesium ion and interrupts latter ion adsorption, the presence of ammonium ion is not desirable. The CuFZ offers the possibility of separating and removing cesium from liquid wastes produced in facilities handling radioactive materials

  17. Sericitization of illite decreases sorption capabilities for cesium

    Science.gov (United States)

    Choung, S.; Hwang, J.; Han, W.; Shin, W.

    2017-12-01

    Release of radioactive cesium (137Cs) to environment occurs through nuclear accidents such as Chernobyl and Fukushima. The concern is that 137Cs has long half-life (t1/2 = 30.2 years) with chemical toxicity and γ-radiation. Sorption techniques are mainly applied to remove 137Cs from aquatic environment. In particular, it has been known well that clay minerals (e.g, illite) are effective and economical sorbents for 137Cs. Illite that was formed by hydrothermal alteration exist with sericite through "sericitization" processes. Although sericite has analogous composition and lattice structure with illite, the sorptive characteristics of illite and sericite for radiocesium could be different. This study evaluated the effects of hydrothermal alteration and weathering process on illite cesium sorption properties. Natural illite samples were collected at Yeongdong area in Korea as the world-largest hydrothermal deposits for illite. The samples were analyzed by XRF, XRD and SEM-EDX to determine mineralogy, chemical compositions and morphological characteristics, and used for batch sorption experiments. The Yeongdong illites predominantly consist of illite, sericite, quartz, and albite. The measured cesium sorption distribution coefficients (Kd,Cs) of reference illite and sericite were approximately 6000 and 400 L kg-1 at low aqueous concentration (Cw 10-7 M), respectively. In contrast, Kd,Cs values for the Yeongdong illite samples ranged from 500 to 4000 L kg-1 at identical concentration. The observed narrow and sharp XRD peak of sericite indicated that the sericite has better crystallinity compared to illite. These experimental results suggested that sericitization processes of illite can decline the sorption capabilities of illite for cesium under various hydrothermal conditions. In particular, weathering experiments raised the cesium sorption to illite, which seems to be related to the increase of preferential sorption sites for cesium through crystallinity destruction

  18. 40 CFR 141.700 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... described in §§ 141.721 through 141.722. (7) Systems must address significant deficiencies identified in... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements. 141.700 Section 141.700 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

  19. Desorption of radioactive cesium by seawater from the suspended particles in river water.

    Science.gov (United States)

    Onodera, Masaki; Kirishima, Akira; Nagao, Seiya; Takamiya, Kouichi; Ohtsuki, Tsutomu; Akiyama, Daisuke; Sato, Nobuaki

    2017-10-01

    In 2011, the accident at the Fukushima-Daiichi nuclear power plant dispersed radioactive cesium throughout the environment, contaminating the land, rivers, and sea. Suspended particles containing clay minerals are the transportation medium for radioactive cesium from rivers to the ocean because cesium is strongly adsorbed between the layers of clay minerals, forming inner sphere complexes. In this study, the adsorption and desorption behaviors of radioactive cesium from suspended clay particles in river water have been investigated. The radioactive cesium adsorption and desorption experiments were performed with two kinds of suspended particulate using a batch method with 137 Cs tracers. In the cesium adsorption treatment performed before the desorption experiments, simulated river water having a total cesium concentration ([ 133+137 Cs + ] total ) of 1.3 nM (10 -9  mol/L) was used. The desorption experiments were mainly conducted at a solid-to-liquid ratio of 0.17 g/L. The desorption agents were natural seawater collected at 10 km north of the Fukushima-Daiichi nuclear power plant, artificial seawater, solutions of NaCl, KCl, NH 4 Cl, and 133 CsCl, and ultrapure water. The desorption behavior, which depends on the preloaded cesium concentration in the suspended particles, was also investigated. Based on the cesium desorption experiments using suspended particles, which contained about 1000 ng/g loaded cesium, the order of cesium desorption ratios for each desorption agent was determined as 1 M NaCl (80%) > 470 mM NaCl (65%) > 1 M KCl (30%) ≈ seawater (natural seawater and Daigo artificial seawater) > 1 M NH 4 Cl (20%) > 1 M 133 CsCl (15%) ≫ ultrapure water (2%). Moreover, an interesting result was obtained: The desorption ratio in the 470 mM NaCl solution was much higher than that in seawater, even though the Na + concentrations were identical. These results indicate that the cesium desorption mechanism is not a simple ion exchange reaction

  20. Room temperature deposition of crystalline indium tin oxide films by cesium-assisted magnetron sputtering

    International Nuclear Information System (INIS)

    Lee, Deuk Yeon; Baik, Hong-Koo

    2008-01-01

    Indium tin oxide (ITO) films were deposited on a Si (1 0 0) substrate at room temperature by cesium-assisted magnetron sputtering. Including plasma characteristics, the structural, electrical, and optical properties of deposited films were investigated as a function of cesium partial vapor pressure controlled by cesium reservoir temperature. We calculated the cesium coverage on the target surface showing maximum formation efficiency of negative ions by means of the theoretical model. Cesium addition promotes the formation efficiency of negative ions, which plays important role in enhancing the crystallinity of ITO films. In particular, the plasma density was linearly increased with cesium concentrations. The resultant decrease in specific resistivity and increase in transmittance (82% in the visible region) at optimum cesium concentration (4.24 x 10 -4 Ω cm at 80 deg. C of reservoir temperature) may be due to enhanced crystallinity of ITO films. Excess cesium incorporation into ITO films resulted in amorphization of its microstructure leading to degradation of ITO crystallinity. We discuss the cesium effects based on the growth mechanism of ITO films and the plasma density

  1. Cesium transport in Four Mile Creek of the Savannah River Plant

    International Nuclear Information System (INIS)

    Kiser, D.L.

    1979-04-01

    The behavior of a large radioactive cesium release to a Savannah River Plant (SRP) stream was examined using a stable cesium release to Four Mile Creek. Measurements following the release show that most of the cesium released was transported downstream; however, sorption and desorption decreased the maximum concentration and increased the travel time and duration, relative to a dye tracer, at sampling stations downstream. The study was made possible by the development of an analytical technique using ammonium molybdophosphate and neutron activation that permitted the measurement of stable cesium concentrations as low as 0.2 μg/L

  2. Myocardial imaging with cesium-130

    International Nuclear Information System (INIS)

    Harper, P.V.; Resnekov, L.; Stark, V.; Odeh, N.

    1984-01-01

    Recently comparative studies using nitrogen-13 ammonia and cesium-130 have shown strikingly different myocardial localization patterns in the same subjects with ischemic heart disease. Initial localization of ammonia, an avidly extracted agent, reflects the perfusion pattern in viable myocardial tissue. The myocardial localization of cesium ion, taking place more slowly over 15 to 20 minutes, is apparently much less flow dependent, causing uptake defects shown with ammonia to be largely filled in. Cesium thus appears to provide information on the extent of the viable myocardial mass, apart from perfusion. Cesium-130 (t1/2 30 m) decays by positron emission and electron capture. The whole body radiation absorbed dose, assuming uniform distribution, is 24 mrad/mCi. While abundant production of Cs-130 results from proton bombardment of natural xenon [Xe-130(rho,n)Cs-130] at 15 MeV, small amounts of Cs-129, -131, and -132 are also produced, and enriched Xe-130 is not available. Alternatively almost completely uncontaminated Cs-130 is available by alpha bombardment of natural I-127. Anhydrous sodium iodide is dissolved in acetone and a thin layer (≅20 mg per centimeter squared) is evaporated onto the gold plated tip of the internal target backing which is oscillated vertically to spread out the area upon which the beam is incident. The target surface is inclined 2.5 degrees to the beam giving a power density of about 400 watts per centimeter squared at 100μA which is adequately handled by water cooling. A 30-minute bombardment yields 4 to 5 mCi of Cs-130 which is dissolved directly from the target. This approach appears to offer a new and helpful method for evaluating ischemic heart disease by permitting evaluation of viable myocardial mass

  3. Hydrological Methods can Separate Cesium from Nuclear Waste Saltcake

    International Nuclear Information System (INIS)

    Brooke, J.N.; Peters, J.F.; Staheli, K.

    1999-01-01

    Interstitial Fluid Displacement (IFD) is a new and novel method for separating cesium from saltcake waste. Hydrologic modeling of liquid flow through porous saltcake suggests that the cesium, potassium and sodium hydroxide can be separated at high recovery and low volume using IFD.'

  4. A model for radial cesium transport in a fuel pellet

    International Nuclear Information System (INIS)

    Imoto, Shosuke

    1989-01-01

    In order to explain the radial redistribution of cesium in an irradiated pellet, a two-step release model is proposed. The first step involves the migration of cesium by atomic diffusion to some channels, such as grain boundaries and cracks, and the second step assumes a thermomigration down along the temperature gradient. Distribution profiles of cesium are obtained by numerical calculation with the present model assuming a constant and spatially uniform birth rate of cesium in the pellet. The result agrees well with the profile observed by micro-gamma scanning for the LWR fuel in the outer region of the pellet but diverges from it at the inner region. Discussion is made on the steady-state model hitherto generally utilized. (orig.)

  5. Accumulation and mobility of cesium in roots of tulip popular seedlings

    International Nuclear Information System (INIS)

    Cox, T.L.

    1975-01-01

    Tulip poplar, Liriodendron tulipifera L., seedlings were stem-well tagged with cesium, periodically harvested, and separated into root and shoot compartments to determine seasonal cesium distributions in different root-diameter classes and to delineate element pathways to forest soils. The cesium concentration (μCi/g) in roots less than 0.1 cm in diameter averaged 1.5 and 3.0 times greater than in roots in the 0.5- to 0.1-cm- and 1.0- to 0.5-cm-diameter classes, respectively. Roots contained 24 percent of the seedling pool of cesium in 1 week and about 40 percent in 7 weeks after inoculation. Sixty-five percent of the seedling content was in the root system 8 months after tagging. On an annual basis, roots of the less than 0.5-cm-diameter classes contained an average of 36 percent of the seedling pool (root and shoot) and 72 percent of the root pool of cesium. This is important because small roots constituted a considerable portion of the annual turnover in these root systems. Soil content of cesium (3.37 μCi) at the termination of the study and analysis of treatment effects (aboveground inputs to soil allowed or not allowed) indicated that root processes contributed twice as much cesium to the soil during the study period as the combined aboveground processes contributed

  6. Protection of cesium-antimony photocathodes

    International Nuclear Information System (INIS)

    Buzulutskov, A.; Breskin, A.; Chechik, R.; Prager, M.; Shefer, E.

    1996-06-01

    In order to operate gaseous photomultipliers in the visible range it was suggested to protect sensitive photocathodes against contact to air and counting gases by their coating with a thin solid dielectric film. We present data on coating of cesium- antimony photocathodes with alkali-halide (NaI, CsI, CsF, NaF), oxide (SiO) and organic (hexatriacontane, calcium stearate) films. The photoelectron transmission through these films and their protection capability have been studied in detail. Cesium-antimony photocathodes are shown to withstand exposure to considerable doses of oxygen and dry air when coated with Nal films. This opens ways to their operation in gas media. (authors), 11 refs., 6 figs

  7. 18 CFR 284.141 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Applicability. 284.141 Section 284.141 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Sales by Intrastate Pipelines § 284.141 Applicability. This subpart implements section 311(b) of...

  8. 40 CFR 141.89 - Analytical methods.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.89 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper § 141.89 Analytical methods. (a... shall be conducted with the methods in § 141.23(k)(1). (1) Analyses for alkalinity, calcium...

  9. Cesium-137 as a radiation source

    International Nuclear Information System (INIS)

    McMullen, W.H.; Sloan, D.P.

    1985-01-01

    The U.S. Department of Energy (DOE) Byproducts Utilization Program (BUP) seeks to develop and encourage widespread commercial use of defense byproducts that are produced by DOE. Cesium-l37 is one such byproduct that is radioactive and decays with emission of gamma rays. The beneficial use of this radiation to disinfect sewage sludge or disinfest food commodities is actively being pursued by the program. The radiation produced by cesium-l37(Cs-l37) is identical in form to that produced by cobalt-60(Co-60), an isotope that is widely used in commercial applications such as medical product sterilization. The choice of isotope to use depends on several factors ranging from inherent properties of the isotopes to availability and cost. The BUP, although centrally concerned with the beneficial use of Cs-l37, by investigating and assessing the feasibility of various uses hopes to define appropriate circumstances where cesium or cobalt might best be used to accomplish specific objectives. This paper discusses some of the factors that should be considered when evaluating potential uses for isotopic sources

  10. Electrically switched cesium ion exchange

    International Nuclear Information System (INIS)

    Lilga, M.A.; Orth, R.J.; Sukamto, J.P.H.; Schwartz, D.T.; Haight, S.M.; Genders, J.D.

    1997-04-01

    Electrically Switched Ion Exchange (ESIX) is a separation technology being developed as an alternative to conventional ion exchange for removing radionuclides from high-level waste. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution are controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. A case study for the KE Basin on the Hanford Site was conducted based on the results of the development testing. Engineering design baseline parameters for film deposition, film regeneration, cesium loading, and cesium elution were used for developing a conceptual system. Order of magnitude cost estimates were developed to compare with conventional ion exchange. This case study demonstrated that KE Basin wastewater could be processed continuously with minimal secondary waste and reduced associated disposal costs, as well as lower capital and labor expenditures

  11. 10 CFR 63.141 - Scope.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Scope. 63.141 Section 63.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Quality Assurance § 63.141 Scope. As used in this part, quality assurance comprises all those...

  12. Cesium removal flow studies using ion exchange

    International Nuclear Information System (INIS)

    Lee, D.D.; Walker, J.F. Jr.; Taylor, P.A.

    1997-01-01

    Cesium and strontium radionuclides are a small fraction of the mainly sodium and potassium salts in underground storage tank supernatant at US Department of Energy (DOE) sites at Hanford, Oak Ridge, Savannah River, and Idaho that DOE must remediate. Cesium-137 ( 137 Cs) is the primary gamma radiation source in the dissolved tank waste at these sites, and its removal from the supernatant can reduce the hazard and waste classification of the treated waste reducing the further treatment and disposal costs. Several cesium removal sorbents have been developed by private industry and the US DOE's Office of Science and Technology. Several of these removal technologies have been previously tested in small batch and column tests using simulated and a few actual supernatant under DOE's Environmental Management (EM) programs including the Tanks Focus Area (TFA) and the Efficient Separations and Processing (ESP) Cross-Cutting Program

  13. Catalytic oxidation of silicon by cesium ion bombardment

    International Nuclear Information System (INIS)

    Souzis, A.E.; Huang, H.; Carr, W.E.; Seidl, M.

    1991-01-01

    Results for room-temperature oxidation of silicon using cesium ion bombardment and low oxygen exposure are presented. Bombardment with cesium ions is shown to allow oxidation at O 2 pressures orders of magnitude smaller than with noble gas ion bombardment. Oxide layers of up to 30 A in thickness are grown with beam energies ranging from 20--2000 eV, O 2 pressures from 10 -9 to 10 -6 Torr, and total O 2 exposures of 10 0 to 10 4 L. Results are shown to be consistent with models indicating that initial oxidation of silicon is via dissociative chemisorption of O 2 , and that the low work function of the cesium- and oxygen-coated silicon plays the primary role in promoting the oxidation process

  14. Cesium separation using integrated electro-membrane technique

    International Nuclear Information System (INIS)

    Fors, Patrik; Lillfors-Pintér, Christina; Widestrand, Henrik; Velin, Anna; Bengtsson, Bernt

    2014-01-01

    Conventional separation technologies such as ion exchange, electro-deionisation and cross flow filtration are not always effective to eliminate nuclides, which are weekly ionised, complexed or hydrated in effluents. Specific nuclide selective absorbers perform well for the treatment of active and contaminated wastewaters but most absorbers generate additional waste while treating high volumes of contaminated water and often show limitations in operating at high flow rates. Electrochemical Ion Exchange (EIX) and EIX in combination with absorbers may offer an alternative solution that overcomes those limitations. This paper reports on the optimization and performance of the integrated technique EIX, for the treatment of low activity effluents that contain cesium and other nuclides. The three-compartment EIX system, which operates with authentic reactor coolant with enhanced nuclide content, indicates high, over 90%, elimination of cesium in a single pass operation mode. With the in-situ and instant ion exchange regeneration, the system successfully reduces the activity from an initial range of 400-2600 Bq/kg to close to detection limit at a velocity of 10-15 cm/min. The applied current density varies between 50-200 mA/cm 2 and the mass balance is close to 100%. During the process, the eliminated cesium and other nuclides are concentrated up to the limits where reverse migration from the concentrated chamber occurs. The concentrate could then be treated with specific absorbents at low flow rates. EIX in combination with cesium-selective ion exchanger CsTreat ® separates the cesium-137 efficiently, but up to now the process does not perform according to EIX principles for the treatment of low grade radioactive wastewaters it rather performs as an irreversible adsorber. The aim with the outcome of the presently ongoing long-term tests is to further support the Best Available Technique Minimizing All Nuclide (BATMAN) projects of Vattenfall NPPs. (author)

  15. Cesium-137 in ash from combustion of biofuels. Application of regulations from the Swedish Radiation Safety Authority; Cesium-137 i aska fraan foerbraenning av biobraenslen. Tillaempning av Straalsaekerhetsmyndighetens regler

    Energy Technology Data Exchange (ETDEWEB)

    Sjoeblom, Rolf (Tekedo AB, Nykoeping (SE))

    2009-03-19

    The Swedish Radiation Safety Authority, SSM, has issued an ordinance on ash contaminated with Cesium-137. It implies amongst other things that ash containing 0,5 - 10 kBq/kg Cesium-137 (so-called contaminated ash) can be used for geotechnical purposes provided that the content in a near-by well does not exceed 1 Bq/litre and that the increase in a near-by fish producing recipient does not exceed 0,1 Bq/litre. The initial plan with the presently reported work was to provide a compilation of how the ordinance for Cesium-137 can be applied in practical work. It became evident, however, in the course of the work that issues related to the co-variation between potassium and Cesium needed further investigation. As a result, the present report comprises also a compilation of this extended information search. Cesium-137 is present in ash as a result of the accident in a nuclear power reactor in Chernobyl in 1986 during which material having a very small grain size was spread to a high altitude. A few days later, Cesium-137 was deposited during rains over large parts of Sweden. This activity penetrated to a depth of one or a few decimetres during the course of the subsequent few days and weeks, after which it was partially taken up by plants and spread in the ecosystem. Section 2 has the character of a handbook. It provides basic information on radiation, and also about the ordinance and other material from the SSI. Section 3 comprises compilations of relevant international status of knowledge. This regards how potassium and Cesium behave in soil and ash, and also how spreading of Cesium can be modelled. Cesium behaves similarly to Potassium but with the difference that Cesium is bonded much more strongly to mineral soil and ash. Potassium and Cesium appears in soil in four different forms: dissolved in the pore water, exchangeable, non-exchangeable and as bonded to minerals. The amount dissolved in the pore water is the smallest and that bonded to minerals is the largest

  16. Hot demonstration of proposed commercial cesium removal technology

    International Nuclear Information System (INIS)

    Lee, D.D.; Travis, J.R.; Gibson, M.R.

    1997-12-01

    This report describes the work done in support of the development of technology for the continuous removal and concentration of radioactive cesium in supernatant from Melton Valley Storage Tanks (MVSTs) at the ORNL site. The primary objective was to test candidate absorbers and ion exchangers under continuous-flow conditions using actual supernatant from the MVSTs. An experimental system contained in a hot-cell facility was constructed to test the materials in columns or modules using the same batch of supernatant to allow comparison on an equal basis. Resorcinol/formaldehyde (RF) resin was evaluated at three flow rates with 50% breakthrough ranges of 35 to 50 column volumes (CV) and also through a series of five loading/elution/regeneration cycles. The results reported here include the cesium loading breakthrough curves, elution curves (when applicable), and operational problems and observations for each material. The comparative evaluations should provide critical data for the selection of the sorbent for the ORNL Cesium Removal Demonstration project. These results will be used to help determine the design parameters for demonstration-scale systems. Such parameters include rates of cesium removal, quantity of resin or sorbent to be used, and elution and regeneration requirements, if applicable

  17. Fast concentration of dissolved forms of cesium radioisotopes from large seawater samples

    International Nuclear Information System (INIS)

    Jan Kamenik; Henrieta Dulaiova; Ferdinand Sebesta; Kamila St'astna; Czech Technical University, Prague

    2013-01-01

    The method developed for cesium concentration from large freshwater samples was tested and adapted for analysis of cesium radionuclides in seawater. Concentration of dissolved forms of cesium in large seawater samples (about 100 L) was performed using composite absorbers AMP-PAN and KNiFC-PAN with ammonium molybdophosphate and potassium–nickel hexacyanoferrate(II) as active components, respectively, and polyacrylonitrile as a binding polymer. A specially designed chromatography column with bed volume (BV) 25 mL allowed fast flow rates of seawater (up to 1,200 BV h -1 ). The recovery yields were determined by ICP-MS analysis of stable cesium added to seawater sample. Both absorbers proved usability for cesium concentration from large seawater samples. KNiFC-PAN material was slightly more effective in cesium concentration from acidified seawater (recovery yield around 93 % for 700 BV h -1 ). This material showed similar efficiency in cesium concentration also from natural seawater. The activity concentrations of 137 Cs determined in seawater from the central Pacific Ocean were 1.5 ± 0.1 and 1.4 ± 0.1 Bq m -3 for an offshore (January 2012) and a coastal (February 2012) locality, respectively, 134 Cs activities were below detection limit ( -3 ). (author)

  18. Cesium-137, a drama recounted

    International Nuclear Information System (INIS)

    Vieira, Suzane de Alencar

    2013-01-01

    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  19. Separation of cesium from aqueous solutions using alkylated tetraaryl borates

    International Nuclear Information System (INIS)

    Feldmaier, F.

    1991-01-01

    The water solubility of cesium tetraaryl borates was lowered by introducing hydrophobic aliphatic side chains into corresponding acid-resistant fluorosubstituted tetraaryl borates. This improved cesium spearability both in precipitation and in extraction from aqueous solutions. (orig.) [de

  20. Improvement of cesium retention in uranium dioxide by additional phases

    International Nuclear Information System (INIS)

    Gamaury Dubois, S.

    1995-01-01

    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs 2 O-Al 2 O 3 -SiO 2 et Cs 2 O-ZrO 2 -SO 2 . The compounds CsAISi 2 O 6 and Cs 2 ZrSi 6 O 15 were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al 2 O 3 + SiO 2 ) or (ZrO 2 + SiO 2 ) and the intergranular phase was characterized. In the presence of (Al 2 O 3 + SiO 2 ), the sintering is realized at 1610 deg C in H 2 . It is a liquid phase sintering. On the other end, with (ZrO 2 + SiO 2 ), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO 2+x . We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs

  1. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    International Nuclear Information System (INIS)

    Peterson, R.A.

    1999-01-01

    This report contains the results from a study requested by High Level Waste Division on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na+] increased the rate at which cesium tetraphenylborate (KTPB) in the presence of high [Na+] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice

  2. Concentrating cesium-137 from seawater using resorcinol-formaldehyde resin for radioecological monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Egorin, Andrei; Tokar, Eduard; Tutov, Mikhail; Avramenko, Valentin [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation); Far Eastern Federal Univ., Vladivostok (Russian Federation); Palamarchuk, Marina; Marinin, Dmitry [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation)

    2017-04-01

    A method of preconcentrating cesium-137 from seawater using a resorcinol-formaldehyde resin, which enables one to optimize the ecological monitoring procedure, has been suggested. Studies of sorption of cesium-137 from seawater by resorcinol-formaldehyde resin have been performed, and it has been demonstrated that the cation exchanger is characterized by high selectivity with respect to cesium-137. It was found that the selectivity depended on the temperature of resin solidification and the seawater pH value. The maximal value of the cesium-137 distribution coefficient is equal to 4.1-4.5 x 10{sup 3} cm{sup 3} g{sup -1}. Under dynamic conditions, the ion-exchange resin capacity is 310-910 bed volumes depending on the seawater pH, whereas the efficiency of cesium removal exceeds 95%. The removal of more than 95% of cesium-137 has been attained using 1-3 M solutions of nitric acid: here, the eluate volume was 8-8.4 bed volumes. Application of 3 M solution of nitric acid results in resin degradation with the release of gaseous products.

  3. Measurements of cesium and strontium diffusion in biotite gneiss

    International Nuclear Information System (INIS)

    Skagius, K.; Neretnieks, I.

    1988-01-01

    A significant retardation of radionuclides transported by flowing water from an underground repository can be expected if the nuclides are able to diffuse into the water filled micropores in the rock. This diffusion into the pores will also increase the surface available to interactions between the nuclides in the ground water and the rock material, such as sorption. To calculate the retardation, it is necessary to know the sorption properties and the diffusivities in the rock matrix for the radionuclides. Diffusion experiments with cesium and strontium in biotite gneiss samples have been performed. Both the transport of strontium and cesium through rock samples and the concentration profiles of cesium and strontium inside rock samples have been determined. The result shows that diffusion of cesium and strontium occurs in the rock material. A diffusion model has been used to evaluate the diffusivity. Both pore diffusion and surface diffusion had to be included in the model to give good agreement with the experimental data. If surface diffusion is not included in the model, the effective pore diffusivity that gives the best fit to the experimental data is found to be higher than expected from earlier measurement of iodide diffusion in the same type of rock material. This indicates that the diffusion of cesium and strontium (sorbing components) in rock material is caused by both pore diffusion and surface diffusion acting in parallel

  4. Diffusion measurements of cesium and strontium in biotite gneiss

    International Nuclear Information System (INIS)

    Skagius, K.; Neretnieks, I.

    1985-01-01

    A significant retardation of radionuclides transported by flowing water from an underground repository can be expected if the nuclides are able to diffuse into the water filled micropores in the rock. This diffusion into the pores will also increase the surface available to interaction between the nuclides in the groundwater and the rock material, such as sorption. To calculate the retardation it is necessary to know the sorption properties and the diffusivities in the rock matrix for the radionuclides. Diffusion experiments with cesium and strontium in biotite gneiss samples have been performed. Both the transport of strontium and cesium through rock samples and the concentration profiles of cesium and strontium inside rock samples have been determined. The result show that diffusion of cesium and strontium occurs in the rock material. A diffusion model has been used to evaluate the diffusivity. Both pore diffusion and surface diffusion had to be included in the model to give good agreement with the experimental data. If surface diffusion is not included in the model, the effective pore diffusivity that gives the best fit to the experimental data is found to be higher than expected from earlier measurements of iodide diffusion in the same type of rock material. This indicates that the diffusion of cesium and strontium (sorbing components) in rock material is caused by both pore diffusion and surface diffusion acting in parallel. (author)

  5. Cesium removal using crystalline silicotitanate. Innovative technology summary report

    International Nuclear Information System (INIS)

    1999-05-01

    Approximately 100 million gallons of radioactive waste is stored in underground storage tanks at the Hanford Site, Idaho National Engineering and Environmental Laboratory (INEEL), Oak Ridge Reservation, and Savannah River Site (SRS). Most of the radioactivity comes from 137 Cs, which emits high-activity gamma radiation. The Cesium Removal System is a modular, transportable, ion-exchange system configured as a compact processing unit. Liquid tank waste flows through columns packed with solid material, called a sorbent, that selectively adsorbs cesium and allows the other materials to pass through. The sorbent is crystalline silicotitanate (CST), an engineered material with a high capacity for sorbing cesium from alkaline wastes. The Cesium Removal System was demonstrated at Oak Ridge using Melton Valley Storage Tank (MVST) waste for feed. Demonstration operations began in September 1996 and were completed during June 1997. Prior to the demonstration, a number of ion-exchange materials were evaluated at Oak Ridge with MVST waste. Also, three ion-exchange materials and three waste types were tested at Hanford. These bench-scale tests were conducted in a hot cell. Hanford's results showed that 300 times less sorbent was used by selecting Ionsiv IE-911 over organic ion-exchange resins for cesium removal. This paper gives a description of the technology and discusses its performance, applications, cost, regulatory and policy issues and lessons learned

  6. Sorption kinetics of cesium on hydrous titanium dioxide

    International Nuclear Information System (INIS)

    Altas, Y.; Tel, H.; Yaprak, G.

    2003-01-01

    Two types of hydrous titanium dioxide possessing different surface properties were prepared and characterized to study the sorption kinetics of cesium. The effect of pH on the adsorption capacity were determined in both type sorbents and the maximum adsorption percentage of cesium were observed at pH 12. To elucidate the kinetics of ion-exchange reaction on hydrous titanium dioxide, the isotopic exchange rates of cesium ions between hydrous titanium dioxides and aqueous solutions were measured radiochemically and compared with each other. The diffusion coefficients of Cs + ion for Type1 and Type2 titanium dioxides at pH 12 were calculated as 2.79 x 10 -11 m 2 s -1 and 1.52 x 10 -11 m 2 s -1 , respectively, under particle diffusion controlled conditions. (orig.)

  7. Sorption of cesium in intact rock

    International Nuclear Information System (INIS)

    Puukko, E.

    2014-04-01

    The mass distribution coefficient K d is used in performance assessment (PA) to describe sorption of a radionuclide on rock. The R d is determined using crushed rock which causes uncertainty in converting the R d values to K d values for intact rock. This work describes a method to determine the equilibrium of sorption on intact rock. The rock types of the planned Olkiluoto waste disposal site were T-series mica gneiss (T-MGN), T-series tonalite granodiorite granite gneiss (T-TGG), P-series tonalite granodiorite granite gneiss (P-TGG) and pegmatitic granite (PGR). These rocks contain different amount of biotite which is the main sorbing mineral. The sorption of cesium on intact rock slices was studied by applying an electrical field to speed up migration of cesium into the rock. Cesium is in the solution as a noncomplex cation Cs + and it is sorbed by ion exchange. The tracer used in the experiments was 134 Cs. The experimental sorption on the intact rock is compared with values calculated using the in house cation exchange sorption model (HYRL model) in PHREEQC program. The observed sorption on T-MGN and T-TGG rocks was close to the calculated values. Two PGR samples were from a depth of 70 m and three samples were from a depth of 150 m. Cesium sorbed more than predicted on the two 70 m PGR samples. The sorption of Cs on the three 150 m PGR samples was small which was consistent with the calculations. The pegmatitic granite PGR has the smallest content of biotite of the four rock types. In the case of P-TGG rock the observed values of sorption were only half of the calculated values. Two kind of slices were cut from P-TGG drill core. The slices were against and to the direction of the foliation of the biotite rims. The sorption of cesium on P-TGG rock was same in both cases. The results indicated that there was no effect of the directions of the electric field and the foliation of biotite in the P-TGG rock. (orig.)

  8. Test procedures and instructions for Hanford tank waste supernatant cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W., Westinghouse Hanford

    1996-05-31

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test using Hanford Double-Shell Slurry Feed supernatant liquor from tank 251-AW-101 in a bench-scale column.Cesium sorbents to be tested include resorcinol-formaldehyde resin and crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-022, Hanford Tank Waste Supernatant Cesium Removal Test Plan.

  9. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    International Nuclear Information System (INIS)

    Peterson, R.A.

    2000-01-01

    This report contains the results from a study requested by High Level Waste on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na + ] increased the rate at which cesium tetraphenylborate (CsTPB) precipitates also increases. Serkiz also demonstrated that the precipitation of potassium tetraphenylborate (KTPB) in the presence of high [Na + ] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice. In the crystallographic structure of these three tetraphenylborate salts (Cs,K,NaTPB), the tetraphenylborate ion dominates the size of the crystals. Also, note that the three crystals have nearly identical structures with the exception of two additional peaks in the cesium pattern. Given these similarities, TPB precipitation in the presence of Na + , Cs + and K + likely produces an impure isomorphic crystalline mixture of CsTPB, KTPB and NaTPB. The authors speculate that the primary crystalline structure resembles that of KTPB with NaTPB and CsTPB mixed throughout the crystal structure. The precipitation of NaTPB makes some of the anticipated excess tetraphenylborate relatively unavailable for precipitation of cesium. Thus, the amount of excess tetraphenylborate required to completely precipitate all of the potassium and cesium may increase significantly

  10. Potassium effect on cesium 137 behaviour in natural waters of contaminated regions (Belarus)

    International Nuclear Information System (INIS)

    Kudel'skij, A.V.; Pashkevich, V.I.; Ovsyannikova, S.V.; Petrovich, A.A.; Smit, D.T.

    1998-01-01

    Very close relationships between cesium 137 activity of water objects (soil solutions, bog and lake water) and their stable potassium contents have been revealed in the contaminated area in south-eastern Belarus. It was revealed the increase of cesium 137 activity in soil solutions and bog ecosystems proportionally with the increase of potassium content. The exponential dependence of cesium 137 activity of fish production was similar to reverse. The coefficient of cesium 137 accumulation in plants was estimated to be reverse connected with the potassium content in soils. So an universal character of these relations and their specificity are of interest when elaborating countermeasures for reducing population dose loads due to cesium 137 water migration

  11. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms; Sympathetisches Kuehlen in einer Rubidium-Caesium-Mischung: Erzeugung ultrakalter Caesiumatome

    Energy Technology Data Exchange (ETDEWEB)

    Haas, M.

    2007-07-01

    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m{sub f}=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m{sub f}=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m{sub f}=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The

  12. Measurement of low levels of cesium-137 in water

    International Nuclear Information System (INIS)

    Milham, R.C.; Kantelo, M.V.

    1984-10-01

    Large volume water sampling systems were developed to measure very low levels of cesium-137 in river water and in finished water from water treatment plants. Three hundred to six hundred liters of filtered water are passed through the inorganic ion exchanger potassium cobalti-ferrocyanide to remove greater than 90% of the cesium. Measurement of cesium-137 by gamma ray spectrometry results in a sensitivity of 0.001 pCi/L. Portable as well as stationary samplers were developed to encompass a variety of applications. Results of a one year study of water from the Savannah River and from water treatment plants processing Savannah River water are presented. 3 references, 7 figures

  13. Measurement of cesium emissions during the vitrification of simulated high level radioactive waste

    International Nuclear Information System (INIS)

    Zamecnik, J.R.; Miller, D.H.; Carter, J.T.

    1992-01-01

    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to eliminate a startup test that would involve adding small amounts of radioactive cesium-137 to simulated high-level waste. In order to eliminate this test, a reliable method for measuring non-radioactive cesium in the offgas system from the glass melter is required. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICPMS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. Typical particulate loadings ranged from 800 μg of cesium. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. The decontamination factors measured experimentally compared favorably with the process design basis values

  14. Cesium-137 inventory of the undisturbed soil areas in the Londrina Region, Parana, Brazil

    International Nuclear Information System (INIS)

    Andrello, Avacir C.; Appoloni, Carlos Roberto

    2005-01-01

    Cesium-137 is an artificial radionuclide introduced in the environment through the radioactive fallout of the superficial tests of nuclear weapons. The cesium-137 deposition occurred to middles of the 1980-decade and, due to the Chernobyl accident, great part of Europe had a additional fallout of cesium-137. The contaminations of this accident do not have reached Southern Hemisphere. Cesium-137 is an alkaline metal, high electropositive, that in contact with the soil is strongly adsorbed to the clay in the FES (Frayed Edge Sites) and RES (Regular Edge Sites) positions, and it movement by chemical processes in the soil is insignificant. Because of this, cesium-137 became a good soil marker, and its movement is related to the soil movement particles, so that the cesium-137 have been used in the study of the soil redistribution processes, as a tool of quantifying the rates of soil losses and gain. To use this methodology, it is necessary the knowledge of the reference inventory of cesium-137, that is given as function of the total concentration of cesium-137 deposited in an area by the radioactive fallout. If a sampling point presents less cesium-137 than the reference inventory, this point is considered a point with soil loss; otherwise, the point is considered a point with soil deposition. To evaluate the cesium-137 inventory in the Londrina region, four areas of the undisturbed soil were sampling in grid of 3x3, with a distance of 9 meters among the points. Of these four sampling areas, three areas were of native forest (labeled Mata1, Mata2 and Mata UEL), and one was a pasture area. Cesium-137 inventory was 223 ± 41 Bq m -2 , 240 ± 65 Bq m -2 and 305 ± 36 Bq m -2 for Mata UEL, Mata1 and Mata2, respectively, and of 211 ± 28 Bq m -2 for the native pasture. Considering the deviation in each value, it is not possible to conclude that there are differences among the values of cesium-137 inventory, so that the average reference inventory of cesium-137 for the

  15. Microbial accumulation of uranium, radium, and cesium

    International Nuclear Information System (INIS)

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; North, S.E.

    1981-05-01

    Diverse microbial species varied considerably in their ability to accumulate uranium, cesium, and radium. Mechanistic differences in uranium uptake by Saccharomyces cerevisiae and Pseudomonas aeruginosa were indicated. S. serevisiae exhibited a slow (hours) surface accumulation of uranium which was subject to environmental factors, while P. aeruginosa accumulated uranium rapidly (minutes) as dense intracellular deposits and did not appear to be affected by environmental parameters. Metabolism was not required for uranium uptake by either organism. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several species tested

  16. Dicty_cDB: VHI141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  17. Adsorption of Radioactive Cesium to Illite-Sericite Mixed Clays

    Science.gov (United States)

    Hwang, J. H.; Choung, S.; Park, C. S.; Jeon, S.; Han, J. H.; Han, W. S.

    2016-12-01

    Once radioactive cesium is released into aquatic environments through nuclear accidents such as Chernobyl and Fukushima, it is harmful to human and ecological system for a long time (t1/2 = 30.2 years) because of its chemical toxicity and γ-radiation. Sorption mechanism is mainly applied to remove the cesium from aquatic environments. Illite is one of effective sorbent, considering economical cost for remediation. Although natural illite is typically produced as a mixture with sericite formed by phyllic alteration in hydrothermal ore deposits, the effects of illite-sericite mixed clays on cesium sorption was rarely studied. This study evaluated the sorption properties of cesium to natural illite collected at Yeongdong in Korea as the world-largest illite producing areas (termed "Yeongdong illite"). The illite samples were analyzed by XRF, XRD, FT-IR and SEM-EDX to determine mineralogy, chemical composition, and morphological characteristics, and used for batch sorption experiments. Most of "Yeongdong illite" samples predominantly consist of sericite, quartz, albite, plagioclase feldspar and with minor illite. Cesium sorption distribution coefficients (Kd,Cs) of various "Yeongdong illite" samples ranged from 500 to 4000 L/kg at low aqueous concentration (Cw 10-7 M). Considering Kd,Cs values were 400 and 6000 using reference sericite and illite materials, respectively, in this study, these results suggested that high contents of sericite significantly affect the decrease of sorption capabilities for radiocesium by natural illite (i.e., illite-sericite mixed clay).

  18. High voltage holding in the negative ion sources with cesium deposition

    Energy Technology Data Exchange (ETDEWEB)

    Belchenko, Yu.; Abdrashitov, G.; Ivanov, A.; Sanin, A.; Sotnikov, O., E-mail: O.Z.Sotnikov@inp.nsk.su [Budker Institute of Nuclear Physics, Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation)

    2016-02-15

    High voltage holding of the large surface-plasma negative ion source with cesium deposition was studied. It was found that heating of ion-optical system electrodes to temperature >100 °C facilitates the source conditioning by high voltage pulses in vacuum and by beam shots. The procedure of electrode conditioning and the data on high-voltage holding in the negative ion source with small cesium seed are described. The mechanism of high voltage holding improvement by depletion of cesium coverage is discussed.

  19. Dosage of cesium 137 in radioactive wastes by the application of sodium tetraphenylborate; Dosage du cesium 137 dans les effluents radioactifs par le tetraphenylborate de sodium

    Energy Technology Data Exchange (ETDEWEB)

    Testemale, G; Girault, J [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-07-01

    A simple technique of the dosage of {sup 137}Cs has been developed. The technique consists in the formation of cesium tetraphenyl borate, followed by a double extraction with isoamyl acetate, and washing of the organic phase. The counting of known parts of the cesium solution assaying of its purity by {gamma} spectrometry enable the determination of the {sup 137}Cs. The yield is about 98 per cent. (authors) [French] Une technique simple du dosage du {sup 137}Cs a ete mise au point. Elle consiste en une double extraction du tetraphenylborate de cesium forme par l'acetate d'isoamyle suivie d'un lavage de la phase organique. Des comptages sur des parties aliquotes de la solution de cesium et un controle de purete par spectrometrie {gamma} permettent la determination de cet element. Rendement: environ 98 pour cent. (auteurs)

  20. 40 CFR 141.76 - Recycle provisions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recycle provisions. 141.76 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.76 Recycle provisions. (a... recycle spent filter backwash water, thickener supernatant, or liquids from dewatering processes must meet...

  1. Removal of radioactive cesium from soil by ammonium citrate solution and ionic liquid

    International Nuclear Information System (INIS)

    Ishiwata, Shunji; Kitakouji, Manabu; Taga, Atsushi; Ogata, Fumihiko; Ouchi, Hidekazu; Yamanishi, Hirokuni; Inagaki, Masayo

    2015-01-01

    Radioactive cesium has strongly bound soil as time proceeded, which could not be cleaved in mild condition. We have found that serial treatment of ammonium citrate solution and ionic liquid removed radioactive cesium from soil effectively. The sequence of the treatment is crucial, since inverse serial treatment or mixture of two kinds of solution did not show such an effect, which suggested that ammonium citrate unlocked trapped cesium in soil and ionic liquid solved it. We also found that repeating serial treatment and prolonged treatment time additively removed cesium from soil. (author)

  2. Cesium-plasma-conductivity enhancement in the advanced thermionic energy converter. Final report

    International Nuclear Information System (INIS)

    Manikopoulos, C.N.

    Two methods of plasma conductivity enhancement in a cesium vapor thermionic energy converter have been studied. The first involved resonance photoabsorption of several cesium lines and the second utilized cesium plasma sustenance by application of microwave power. An extensive study of ionization processes in a cesium discharge in the presence of resonance ionization was made. Calculations were made of expected percentage excitation levels for several cesium resonance transitions for different values of neutral density and temperature as well as incident radiation power levels. The results of some of these computations were tabulated. Several ionization schemes were considered. A number of cesium transitions were investigated in the range of 799 to 870 nanometers for four different cesium reservoir temperatures, 467, 511, 550 and 591 K. The related absorption coefficients of the radiation lines in the plasma were deduced and tabulated. The resulting plasma conductivity increase was recorded and the associated ionization enhancement was deduced. A microwave cavity was built where the emitter and collector of a simple thermionic converter made up two of the cavity walls and resonant microwave power was externally applied. The I-V characteristics of the thermionic converter were studied under several microwave power levels in the range of 0 to 2 watts. Significant shifts to higher currents were observed as the microwave power levels were raised. In conclusion, both methods show promise as auxiliary ionization mechanisms for the thermionic energy converter, especially at low emitter temperatures

  3. Cesium immobilization into potassium magnesium phosphate matrix

    International Nuclear Information System (INIS)

    Sayenko, S.Y.; Shkuropatenko, V.A.; Bereznyak, O.P.; Hodyreva, Y.S.; Tarasov, R.V.; Virych, V.D.; Ulybkina, E.A.; Pylypenko, O.V.; Kholomeev, G.O.; Zykova, A.V.; Wagh, Arun S.

    2017-01-01

    The possibility of isomorphous substitution of potassium ions by cesium ions in the structure of potassium magnesium phosphate KMgPO 4 centred dot 6H 2 O (PMP) was shown. It was established, that the Cs included into the PMP matrix does not transfer to the environment during high temperatures heating process (1176 deg C, 3 hours). Analysis of the IR absorption spectrum of the PMP sample has demonstrated that an increase in the amount of additive of the cesium chloride resulted in the shift of the main bands in the spectrum to the low-frequency region with average shift value 10 cm -1 , which indicates the strengthening of bonds in the crystal lattice of matter. The calculated degree of substitution of potassium by cesium during energy release process in the PMP matrix at the level of vitrified high level wastes is about 4%, i. e. the PMP matrix should correspond to the formula K 0.96 Cs 0.04 MgPO 4 centred dot 6H 2 O.

  4. 40 CFR 141.70 - General requirements.

    Science.gov (United States)

    2010-07-01

    ...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.70 General requirements. (a... regulations establish criteria under which filtration is required as a treatment technique for public water... filtration requirements in § 141.73 and the disinfection requirements in § 141.72(b). (c) Each public water...

  5. 14 CFR 141.23 - Advertising limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...

  6. Pilot unit for cesium-137 separation

    International Nuclear Information System (INIS)

    Raggenbass, A.; Quesney, M.; Fradin, J.; Dufrene, J.

    1958-01-01

    Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of 137 Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain 137 Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author) [fr

  7. High-current negative hydrogen ion beam production in a cesium-injected multicusp source

    International Nuclear Information System (INIS)

    Takeiri, Y.; Tsumori, K.; Kaneko, O.

    1997-01-01

    A high-current negative hydrogen ion source has been developed, where 16.2 A of the H - current was obtained with a current density of 31 mA/cm 2 . The ion source is a multicusp source with a magnetic filter for negative ion production, and cesium vapor is injected into the arc chamber, leading to enhancement of the negative ion yields. The cesium-injection effects are discussed, based on the experimental observations. Although the surface production of the negative ions on the cesium-covered plasma grid is thought to be a dominant mechanism of the H - current enhancement, the cesium effects in the plasma volume, such as the cesium ionization and the electron cooling, are observed, and could contribute to the improved operation of the negative ion source. (author)

  8. Cesium 137 in oils and plants from Guatemala

    International Nuclear Information System (INIS)

    Ayala, R.E.; Perez, J.F.

    1993-01-01

    Since 1990 the project of radioactive and environmental contamination started in Guatemala. Studies about the radioactive contamination levels are made within the framework of this project. Cesium-137 has been an interest radionuclide, because it is a fission product released to the environment by the use of nuclear weapons and nuclear power plants accidents. The sampling consisted in collection of soil and grass in 20 provinces of Guatemala, one point by province, and it was made in 1990. The cesium-137 concentration in the samples, was determined by gamma spectrometry, using an hyper pure germanium detector. The results show the presence of radioactive contamination in soil and grass due to cesium-137, at levels that might be considered as normal. The levels found are not harmful for human health, and its importance is the fact that can be used as reference levels for the environmental radioactivity monitoring in Guatemala

  9. Cesium uptake capacity of simulated ferrocyanide tank waste. Interim report FY 1994, Ferrocyanide Safety Project

    International Nuclear Information System (INIS)

    Burgeson, I.E.; Bryan, S.A.; Burger, L.E.

    1994-09-01

    The objective of this project is to determine the capacity for 137 CS uptake by mixed metal ferrocyanides present in Hanford waste tanks, and to assess the potential for aggregation of these 137 CS exchanged materials to form tank ''hot-spots.'' This research, performed at the Pacific Northwest Laboratory (PNL) for the Westinghouse Hanford Company (WHC), stems from concerns of possible localized radiolytic heating within the tanks. If radioactive cesium is exchanged and concentrated by the remaining nickel ferrocyanide present in the tanks, this heating could cause temperatures to rise above the safety limits specified for the ferrocyanide tanks. For the purposes of this study, two simulants, In-Farm-2 and U-Plant-2, were chosen to represent the wastes generated by the scavenging processes. These simulants were formulated using protocols from the original cesium scavenging campaign. Later additions of cesium-rich wastes from various processes also were considered. The simulants were prepared and centrifuged to obtain a moist ferrocyanide sludge. The centrifuged sludges were treated with the original supernate spiked with a known amount of cesium nitrate. After analysis by flame atomic absorption spectrometry, distribution coefficients (K d ) were calculated. The capacity of solid waste simulants to exchange radioactive cesium from solution was examined. Initial results showed that the greater the molar ratio of cesium to cesium nickel ferrocyanide, the less effective the exchange of cesium from solution. The theoretical capacity of 2 mol cesium per mol of nickel ferrocyanide was not observed. The maximum capacity under experimental conditions was 0.35 mol cesium per mol nickel ferrocyanide. Future work on this project will examine the layering tendency of the cesium nickel ferrocyanide species

  10. Experimental study on cesium immobilization in struvite structures

    International Nuclear Information System (INIS)

    Wagh, Arun S.; Sayenko, S.Y.; Shkuropatenko, V.A.; Tarasov, R.V.; Dykiy, M.P.; Svitlychniy, Y.O.; Virych, V.D.; Ulybkina, E.A.

    2016-01-01

    Graphical abstract: X-ray diffraction patterns of Ceramicrete forms, green representing struvite-K, and red, struvite-(K,Cs) with 10 wt.% CsCl in it. Cs substitutes partially for K, which immobilizes Cs at room temperature by the acid–base reaction. - Highlights: • Struvite structure of Ceramicrete is an excellent host of radioactive cesium. • The volatility problem of cesium can be avoided by this method. • This method can be used to produce cesium waste forms in ambient conditions. • It can also be used to pretreat cesium in glass vitrification technology. • It also provides a method to produce safe sealed radioactive sources of cesium. - Abstract: Ceramicrete, a chemically bonded phosphate ceramic, was developed for nuclear waste immobilization and nuclear radiation shielding. Ceramicrete products are fabricated by an acid–base reaction between magnesium oxide and mono potassium phosphate that has a struvite-K mineral structure. In this study, we demonstrate that this crystalline structure is ideal for incorporating radioactive Cs into a Ceramicrete matrix. This is accomplished by partially replacing K by Cs in the struvite-K structure, thus forming struvite-(K, Cs) mineral. X-ray diffraction and thermo-gravimetric analyses are used to confirm such a replacement. The resulting product is non-leachable and stable at high temperatures, and hence it is an ideal matrix for immobilizing Cs found in high-activity nuclear waste streams. The product can also be used for immobilizing secondary waste streams generated during glass vitrification of spent fuel, or the method described in this article can be used as a pretreatment method during glass vitrification of high level radioactive waste streams. Furthermore, it suggests a method of producing safe commercial radioactive Cs sources.

  11. Experimental study on cesium immobilization in struvite structures

    Energy Technology Data Exchange (ETDEWEB)

    Wagh, Arun S., E-mail: asw@anl.gov [Environmental Science Division, Argonne National Laboratory, 9700 S. Cass Avenue, IL 60439 (United States); Sayenko, S.Y.; Shkuropatenko, V.A.; Tarasov, R.V.; Dykiy, M.P.; Svitlychniy, Y.O.; Virych, V.D.; Ulybkina, E.A. [National Science Center, Kharkov Institute of Physics and Technology, Kharkov (Ukraine)

    2016-01-25

    Graphical abstract: X-ray diffraction patterns of Ceramicrete forms, green representing struvite-K, and red, struvite-(K,Cs) with 10 wt.% CsCl in it. Cs substitutes partially for K, which immobilizes Cs at room temperature by the acid–base reaction. - Highlights: • Struvite structure of Ceramicrete is an excellent host of radioactive cesium. • The volatility problem of cesium can be avoided by this method. • This method can be used to produce cesium waste forms in ambient conditions. • It can also be used to pretreat cesium in glass vitrification technology. • It also provides a method to produce safe sealed radioactive sources of cesium. - Abstract: Ceramicrete, a chemically bonded phosphate ceramic, was developed for nuclear waste immobilization and nuclear radiation shielding. Ceramicrete products are fabricated by an acid–base reaction between magnesium oxide and mono potassium phosphate that has a struvite-K mineral structure. In this study, we demonstrate that this crystalline structure is ideal for incorporating radioactive Cs into a Ceramicrete matrix. This is accomplished by partially replacing K by Cs in the struvite-K structure, thus forming struvite-(K, Cs) mineral. X-ray diffraction and thermo-gravimetric analyses are used to confirm such a replacement. The resulting product is non-leachable and stable at high temperatures, and hence it is an ideal matrix for immobilizing Cs found in high-activity nuclear waste streams. The product can also be used for immobilizing secondary waste streams generated during glass vitrification of spent fuel, or the method described in this article can be used as a pretreatment method during glass vitrification of high level radioactive waste streams. Furthermore, it suggests a method of producing safe commercial radioactive Cs sources.

  12. 47 CFR 101.141 - Microwave modulation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Microwave modulation. 101.141 Section 101.141... SERVICES Technical Standards § 101.141 Microwave modulation. (a) Microwave transmitters employing digital modulation techniques and operating below 25.25 GHz (except for MVDDS stations in the 12,200-12,700 MHz band...

  13. 14 CFR 141.91 - Satellite bases.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...

  14. Theoretical study of the chemical properties of cesium hydride; Teoreticke studium chemickych vlastnosti hydridu cezia

    Energy Technology Data Exchange (ETDEWEB)

    Skoviera, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra fyzikalnej a teoretickej chemie, 84215 Bratislava (Slovakia)

    2012-04-25

    A theoretical study of radiofrequency source of hydrogen ions in the International Thermonuclear Experimental Reactor (ITER) used a cesium grid as a source of electrons for ionization of hydrogen. In the process of ionization of hydrogen, however, there is a weathering of cesium grid, resulting into a group of undesired products - cesium hydrides and materials derived from cesium hydride. We calculated the potential curves of cesium hydride and of its anion and cation, their spectroscopic properties and partly their electrical properties. To make electrical properties comparable with the experiment, we calculated for all also the vibration corrections. Lack of convergence in RASSCF step caused, that the electrical properties of excited states are still an open question of chemical properties of cesium hydride. (authors)

  15. 22 CFR 141.5 - Compliance information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be necessary...

  16. 19 CFR 141.88 - Computed value.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 141.88 Section 141.88 Customs... (CONTINUED) ENTRY OF MERCHANDISE Invoices § 141.88 Computed value. When the port director determines that information as to computed value is necessary in the appraisement of any class or kind of merchandise, he...

  17. Structure of cesium loaded iron phosphate glasses: An infrared and Raman spectroscopy study

    International Nuclear Information System (INIS)

    Joseph, Kitheri; Premila, M.; Amarendra, G.; Govindan Kutty, K.V.; Sundar, C.S.; Vasudeva Rao, P.R.

    2012-01-01

    The structure of cesium loaded iron phosphate glasses (IPG) was investigated using infrared and Raman spectroscopy. The spectra of the cesium doped samples revealed a structural modification of the parent glass owing to the incorporation of cesium. The structural changes could be correlated with the variation observed in the glass transition temperature of these glasses. Increased Cs-mediated cationic cross linking appears to be the reason for the initial rise in glass transition temperature up to 21 mol% Cs 2 O in IPG; while, breakdown of the phosphate network with increasing cesium content, brings down the glass transition temperature.

  18. Accumulation of strontium 90 and cesium 137 in some hydrobionts

    International Nuclear Information System (INIS)

    Boyadzhiev, A.; Keslev, D.; Kerteva, A.; Novakova, E.

    1974-01-01

    Factors responsible for the accumulation of strontium 90 and cesium 137 in some plant organisms, characteristic for fishes in Bulgarian fresh-water reservoirs and in Black Seawater, were examined. The investigated samples were taken during spring, summer and autumn-winter seasons 1967/1968. Each sample burnt to ashes at 450 0 C was examined for strontium 90 and cesium 137 content as well as stable isotopes of calcuim and potassium. Accumulation factors for strontium 90 and cesium 137 were significantly higher in freshwater hydrobionts than in seawater hydrobionts. This could be explained by variations in the concentration of stable isotopes of calcium and potassium from freshwater reservoirs and from seawater. Potassium and calcium concentrations were relatively constant in seawater while in freshwater they were significantly variable. Accumulation factors for these radionuclides increased according to the amount of rain and the altitude above sea level. Strontium 90 was deposited mostly in fins, less in scales and least in the meat of fishes; cesium 137 was mainly deposited in the meat and less in the other parts of fishes. The highest accumulation factors for strontium 90 were determined in fishes and for cesium 137 in plant organisms. The most convenient plant and fish species for tracing radioactive contamination of freshwater reservoirs and in the Black Sea were indicated. (A.B.)

  19. The molar enthalpies of solution and vapour pressures of saturated aqueous solutions of some cesium salts

    International Nuclear Information System (INIS)

    Apelblat, Alexander; Korin, Eli

    2006-01-01

    Vapour pressures of water over saturated solutions of cesium chloride, cesium bromide, cesium nitrate, cesium sulfate, cesium formate, and cesium oxalate were determined as a function of temperature. These vapour pressures were used to evaluate the water activities, osmotic coefficients and molar enthalpies of vapourization. Molar enthalpies of solution of cesium chloride, Δ sol H m (T = 295.73 K; m = 0.0622 mol . kg -1 ) = (17.83 ± 0.50) kJ . mol -1 ; cesium bromide, Δ sol H m (T = 293.99 K; m = 0.0238 mol . kg -1 ) = (26.91 ± 0.59) kJ . mol -1 ; cesium nitrate, Δ sol H m (T = 294.68 K; m = 0.0258 mol . kg -1 ) = (37.1 ± 2.3) kJ . mol -1 ; cesium sulfate, Δ sol H m (T = 296.43 K; m = 0.0284 mol . kg -1 ) (16.94 ± 0.43) kJ . mol -1 ; cesium formate, Δ sol H m (T = 295.64 K; m = 0.0283 mol . kg -1 ) = (11.10 ± 0.26) kJ . mol -1 and Δ sol H m (T = 292.64 K; m = 0.0577 mol . kg -1 ) = (11.56 ± 0.56) kJ . mol -1 ; and cesium oxalate, Δ sol H m (T = 291.34 K; m = 0.0143 mol . kg -1 ) = (22.07 ± 0.16) kJ . mol -1 were determined calorimetrically. The purity of the chemicals was generally greater than 0.99 mass fraction, except for HCOOCs and (COOCs) 2 where purities were approximately 0.95 and 0.97 mass fraction, respectively. The uncertainties are one standard deviations

  20. 14 CFR 1264.141 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

  1. 25 CFR 141.16 - Price marking.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Price marking. 141.16 Section 141.16 Indians BUREAU OF... AND ZUNI RESERVATIONS General Business Practices § 141.16 Price marking. The price of each article... visible to the customer and that affords the customer a reasonable opportunity to learn the price of the...

  2. Phase separation of cesium from lead borosilicate glass by heat treatment under a reducing atmosphere

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zhanglian; Okada, Takashi, E-mail: t-okada@u-fukui.ac.jp; Nishimura, Fumihiro; Yonezawa, Susumu

    2016-11-05

    Highlights: • Cesium was phase separated from lead borosilicate glass under a reductive atmosphere. • The phase separation occurred on the glass surface that was in contact with the gas. • The leachability of cesium was enhanced by the phase separation. • The degree of such enhancement varied depending on the heat treatment conditions. - Abstract: A phase-separation technique for removing sodium from glass using a heat-treatment method under a reducing atmosphere was previously developed for sodium recovery from waste glass. In this study, this technique was applied to cesium-containing lead borosilicate glass to concentrate the cesium in phase-separated sodium-rich materials for efficient cesium extraction. The theoretical phase-separation temperature of the sodium-rich phase was simulated by thermodynamic equilibrium calculations and was predicted to occur below 700 °C for lead borosilicate glass. Experimentally, a simulated lead borosilicate glass was melted at 1000 °C and subsequently annealed below 700 °C under a CO-containing reducing atmosphere. The phase separation of cesium was found to occur with sodium enrichment on the glass surface that was in contact with the gas phase, promoting cesium extraction from the treated glass using water. The cesium extraction efficiency was affected by the surface area of the treated glass that was in contact with water, and under the examined conditions, the cesium extraction efficiency was up to 66%. Phase separation using reductive heat treatment, combined with a water leaching technique, is suggested to be effective for extracting cesium incorporated in borosilicate glass waste.

  3. Functions and requirements for a cesium demonstration unit

    International Nuclear Information System (INIS)

    Howden, G.F.

    1994-04-01

    Westinghouse Hanford Company is investigating alternative means to pretreat the wastes in the Hanford radioactive waste storage tanks. Alternatives include (but are not limited to) in-tank pretreatment, use of above ground transportable compact processing units (CPU) located adjacent to a tank farm, and fixed processing facilities. This document provides the functions and requirements for a CPU to remove cesium from tank waste as a demonstration of the CPU concept. It is therefore identified as the Cesium Demonstration Unit CDU

  4. Cesium-137 accumulation in higher plants before and after Chernobyl

    International Nuclear Information System (INIS)

    Sawidis, T.; Drossos, E.; Papastefanou, C.; Heinrick, G.

    1990-01-01

    Cesium-137 concentrations in plant species of three biotypes of northern Greece, differing in location as well as in vegetation, are reported following the Chernobyl reactor accident. The cesium uptake by plants was due to the foliar deposition rather than the root uptake. The highest level of cesium in plants was found in Ranunculus sardous, a pubescent plant. The 137 Cs concentration was about 22kBq kg -1 d.w. A high level of cesium was also found in Salix alba ( 137 Cs: 19.6 kBq kg -1 d.w.), a deciduous tree showing that hairy leaves or leaves having rough and large surfaces can absorb greater amounts of radioactivity (surface effect). A comparison is also made between the results of measurements of the present study and the results of measurements of some herbarium plants collected one year before the accident as well as the results of measurements of some new plants grown and collected one year after the accident resulting in a natural removal rate of 137 Cs in plants varying from 14 to 130 days

  5. Cesium powder and pellets inner container decontamination method determination

    International Nuclear Information System (INIS)

    Ferrell, P.C.

    1998-01-01

    The cesium powder and pellets inner container is to be performance tested per the criteria specified in Section 4.0 of HNF-2399, ''Design, Fabrication, and Assembly Criteria for Cesium Powder and Pellet Inner Container.'' The test criteria specifies that the inner container be water tight during decontamination of the exterior surface. Three prototypes will be immersed into a pool of water to simulate a water decontamination process

  6. New separation techniques of cesium by redox type ion exchange materials

    International Nuclear Information System (INIS)

    Tanihara, Koichi

    1998-01-01

    RIECS method, new cesium separation method, was developed in which a porous strong base anionic exchanger with copper ferrocyanide (CuFC) and inhibitor were used. Cesium could be separated from the high concentration nitric solution. By developing new impregnation method, large amount of CuFC was impregnated into the micropolar porous resin and silica gel pores. KFC adhered to outside of pores was recovered. Good complex with CuFC was prepared by use of copper chloride in ethyl alcohol solution. The adsorption ratio of cesium increased radically to 80% level in the very small range of hydrazine concentration 1.7 to 2.4x10 -4 M. The adsorption-desorption ratio of cesium did not decrease by repeating it seven times. The glassificated materials decreased large amount of γ-ray unless increase of volume could be produced by built RIECS method in the high level waste processing system. (S.Y.)

  7. Improvement of cesium retention in uranium dioxide by additional phases; Amelioration de la retention du cesium dans le dioxyde d`uranium au moyen de phases exogenes

    Energy Technology Data Exchange (ETDEWEB)

    Gamaury Dubois, S

    1995-09-19

    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs{sub 2}O-Al{sub 2}O{sub 3}-SiO{sub 2} et Cs{sub 2}O-ZrO{sub 2}-SO{sub 2}. The compounds CsAISi{sub 2}O{sub 6} and Cs{sub 2}ZrSi{sub 6}O{sub 15} were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al{sub 2}O{sub 3} + SiO{sub 2}) or (ZrO{sub 2} + SiO{sub 2}) and the intergranular phase was characterized. In the presence of (Al{sub 2}O{sub 3} + SiO{sub 2}), the sintering is realized at 1610 deg C in H{sub 2}. It is a liquid phase sintering. On the other end, with (ZrO{sub 2} + SiO{sub 2}), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO{sub 2+x}. We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs.

  8. Removal of cesium from red deer meat

    International Nuclear Information System (INIS)

    Jandl, J.; Novosad, J.; Francova, J.; Prochazka, H.

    1989-01-01

    The effect was studied of marinading on the reduction of cesium radionuclide activity in red deer meat contaminated by ingestion of feed containing 134 Cs+ 137 Cs from radioactive fallout following the Chernobyl accident. Two types of marinade were studied, viz., a vinegar infusion and a vinegar infusion with an addition of vegetables and spices. The meat was chopped to cubes of about 1.5 cm in size and the marinading process took place at temperatures of 5 and 11 degC. The drop of cesium content in the meat was determined by gamma spectrometry at given time intervals. The replacement of the marinade and the duration of the process were found to maximally affect efficiency. If the solution was not replaced, about 80% of cesium radionuclides were removed after seven hours of marinading. With one replacement of the infusion the drop in 134 Cs+ 137 Cs radioactivity amounted to up to 90% after seven hours of marinading. No effects were shown of vegetable additions to the vinegar infusion and of the change in temperature from 5 to 11 degC on the efficiency of the process. (author). 3 tabs., 6 refs

  9. Ion exchange flowsheet for recovery of cesium from purex sludge supernatant at B Plant

    International Nuclear Information System (INIS)

    Carlstrom, R.F.

    1977-01-01

    Purex Sludge Supernatant (PSS) contains significant amounts of 137 Cs left after removal of strontium from fission product bearing Purex wastes. To remove cesium from PSS, an Ion Exchange Recovery system has been set up in Cells 17-21 at B Plant. The cesium that is recovered is stored within B Plant for eventual purification through the Cesium Purification process in Cell 38 and eventual encapsulation and storage in a powdered form at the Waste Encapsulation Storage Facility. Cesium depleted waste streams from the Ion Exchange processes are transferred to underground storage

  10. Analysis of cesium extracting solvent using GCMS and HPLC

    International Nuclear Information System (INIS)

    White, T.L.; Herman, C.C.; Crump, S.L.; Marinik, A.R.; Lambert, D.P.; Eibling, R.E.

    2007-01-01

    A high-level waste (HLW) remediation process scheduled to begin in 2007 at the Savannah River Site is the Modular Caustic Side Solvent Extraction (CSSX) Unit (MCU). The MCU will use a hydrocarbon solvent (diluent) containing a cesium extractant, a calix[4]arene compound, to extract radioactive cesium from caustic HLW. The resulting decontaminated HLW waste or raffinate will be processed into grout at the Saltstone Production Facility (SPF). The cesium containing CSSX stream will undergo washing with dilute nitric acid followed by stripping of the cesium nitrate into a very dilute nitric acid or the strip effluent stream and the CSSX solvent will be recycled. The Defense Waste Processing Facility (DWPF) will receive the strip effluent stream and immobilize the cesium into borosilicate glass. Excess CSSX solvent carryover from the MCU creates a potential flammability problem during DWPF processing. Bench-scale DWPF process testing was performed with simulated waste to determine the fate of the CSSX solvent components. A simple high performance liquid chromatography (HPLC) method was developed to identify the modifier (which is used to increase Cs extraction and extractant solubility) and extractant within the DWPF process. The diluent and trioctylamine (which is used to suppress impurity effect and ion-pair disassociation) were determined using gas chromatography mass spectroscopy (GCMS). To close the organic balance, two types of sample preparation methods were needed. One involved extracting aqueous samples with methylene chloride or hexane, and the second was capturing the off gas of the DWPF process using carbon tubes and rinsing the tubes with carbon disulfide for analysis. This paper addresses the development of the analytical methods and the bench-scale simulated waste study results. (author)

  11. Biological effects of cesium-137 injected in beagle dogs of different ages

    International Nuclear Information System (INIS)

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C.

    1995-01-01

    The toxicity of cesium-137 ( 137 Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of 137 Cs are important to understand because 137 Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy

  12. Rocksalt or cesium chloride: Investigating the relative stability of the cesium halide structures with random phase approximation based methods

    Science.gov (United States)

    Nepal, Niraj K.; Ruzsinszky, Adrienn; Bates, Jefferson E.

    2018-03-01

    The ground state structural and energetic properties for rocksalt and cesium chloride phases of the cesium halides were explored using the random phase approximation (RPA) and beyond-RPA methods to benchmark the nonempirical SCAN meta-GGA and its empirical dispersion corrections. The importance of nonadditivity and higher-order multipole moments of dispersion in these systems is discussed. RPA generally predicts the equilibrium volume for these halides within 2.4% of the experimental value, while beyond-RPA methods utilizing the renormalized adiabatic LDA (rALDA) exchange-correlation kernel are typically within 1.8%. The zero-point vibrational energy is small and shows that the stability of these halides is purely due to electronic correlation effects. The rAPBE kernel as a correction to RPA overestimates the equilibrium volume and could not predict the correct phase ordering in the case of cesium chloride, while the rALDA kernel consistently predicted results in agreement with the experiment for all of the halides. However, due to its reasonable accuracy with lower computational cost, SCAN+rVV10 proved to be a good alternative to the RPA-like methods for describing the properties of these ionic solids.

  13. Hybrid micro-particles as a magnetically-guidable decontaminant for cesium-eluted ash slurry

    Science.gov (United States)

    Namiki, Yoshihisa; Ueyama, Toshihiko; Yoshida, Takayuki; Watanabe, Ryoei; Koido, Shigeo; Namiki, Tamami

    2014-09-01

    Decontamination of the radioactive cesium that is widely dispersed owing to a nuclear power station accident and concentrated in fly ash requires an effective elimination system. Radioactive fly ash contains large amounts of water-soluble cesium that can cause severe secondary contamination and represents a serious health risk, yet its complete removal is complicated and difficult. Here it is shown that a new fine-powder formulation can be magnetically guided to eliminate cesium after being mixed with the ash slurry. This formulation, termed MagCE, consists of a ferromagnetic porous structure and alkaline- and salt-resistant nickel ferrocyanide. It has potent cesium-adsorption- and magnetic-separation-properties. Because of its resistance against physical and chemical attack such as with ash particles, as well as with the high pH and salt concentration of the ash slurry, MagCE simplifies the decontamination process without the need of the continued presence of the hazardous water-soluble cesium in the treated ash.

  14. Symmetry breaking nuclear quadrupole coupling tensor orientation for cesium-133 nuclei located in a mirror plane

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Tae Ho; Kim, Jin Eun [Dept. of Chemistry (BK21 plus) and Research Institute of Natural Science, Gyeongsang National University, Jinju (Korea, Republic of); Lee, Kang Yeol [School of Mechanical Engineering, Korea University, Seoul (Korea, Republic of)

    2016-11-15

    Simultaneous multiple data set fits of all transition peaks of {sup 133}Cs nuclei enabled us to obtain accurate cesium-133 nuclear magnetic resonance (NMR) parameters and Euler angles between the principal axis systems of the chemical shift (CS) and quadrupole coupling (Q) tensors of {sup 133}Cs nuclei in Cs{sub 2}CrO{sub 4} . Although in a previous study of Cs{sub 2}CrO{sub 4} by Power et al. (W. P. Power, S. Mooibroek, R. E. Wasylishen, T. S. Cameron, J. Phys. Chem. 1994, 98, 1552), one central transition was observed for cesium sites 1 and 2 in the {sup 133}Cs NMR spectra and one Euler angle between the CS tensors and Q tensors was obtained as 52° and 7° for cesium sites 1 and 2, respectively, the present single-crystal {sup 133}Cs NMR measurements found two Euler angles (10(2)°, 51.9(1)°, 0°) for site 1 and two central transition peaks for site 2. Three principal components of the CS tensor for Cs1 are oriented along the crystallographic a, b, and c axes, whereas none of the principal components of the Q tensor for Cs1 are oriented along the crystal axes. The principal component V{sub 22} of the Q tensor for Cs1 is tilted 10° from the b axis in the bc plane, and the other two components are not located in the ac plane. Therefore, we have found that the requirement that “the quadrupole coupling tensor for a nucleus located in a mirror plane has one principal axis perpendicular to the mirror plane” cannot be applied to Cs1. On the other hand, δ{sub 11} and V{sub 22} for Cs2 are aligned along the b axis, and the other components of the CS and Q tensors deviate at an angle of 1.4(1)° and 10.1(1)°, respectively, from the a and c axes in the ac plane. A distortion-free powder {sup 133}Cs NMR spectrum of Cs{sub 2}CrO{sub 4} was measured using a solid-state spin echo technique.

  15. Test procedures and instructions for Hanford complexant concentrate supernatant cesium removal using CST

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W.

    1997-01-08

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Complexant Concentrate supernatant liquor from tank 241-AN-107, in a bench-scale column. The cesium sorbent to be tested is crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-023, Hanford Complexant Concentrate Supernatant Cesium Removal Test Plan.

  16. 14 CFR 141.93 - Enrollment.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Enrollment. 141.93 Section 141.93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... limitations and simulated emergency landing instructions; and (x) A description of and instructions regarding...

  17. 36 CFR 406.141-406.148 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.141-406.148 [Reserved] ...

  18. 44 CFR 206.141 - Disaster unemployment assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

  19. Photon interactions in a cesium beam

    International Nuclear Information System (INIS)

    Nygaard, K.J.; Jones, J.D.; Hebner, R.E. Jr

    1974-01-01

    Photoionization of excited cesium atoms in the 6 2 P3/2 - state has been studied in a triple crossed-beam experiment. A thermal beam of cesium atoms was intersected by one photon beam of wavelength 8521A that served to excite the atoms and another photon beam with wavelengths below 5060A that served to ionize the excited atoms. The resulting ions were detected with a channel electron multiplier. All background effects were discriminated against by chopping the beam of exciting radiation and by analyzing the net count rate with digital synchronous techniques. The relative cross section for photoionization fo Cs(6 2 P3/2) has been measured from threshold (5060A) to 2500A. The results fall off faster than the theoretical calculations of Weisheit and Norcross

  20. Investigations of the sorption of cesium from acid solutions by various inorganic sorbents

    International Nuclear Information System (INIS)

    Suess, M.; Pfrepper, G.

    1981-01-01

    Studies have been made to investigate the suitability of various inorganic sorbents for separating and obtaining cesium from acid solutions. In greater details, the distribution coefficients of cesium from nitric acid and ammonium nitrate solution were determined. To determine the saturation capacities it was necessary to plot the isotherms of adsorption from 0.5 N and 3.1 N nitric acid. Experimental sorption from a model solution, of which the composition was equal to that of the liquid Purex waste, enabled the suitability of the various exchangers for obtaining cesium from fission product solutions to be determined. From the results obtained it is apparent that ammonium phosphomolybdate is best suited for obtaining cesium from acid fission product solutions. (orig.)

  1. Actual situation of concentration and inventory of radioactive cesium in Matsukawaura Lagoon sediment, Fukushima Prefecture

    International Nuclear Information System (INIS)

    Arita, Koichi; Yabe, Tohru; Hayashi, Seiji

    2014-01-01

    In order to qualitatively evaluate the current status of inventory of radioactive cesium in Matsukawaura Lagoon, profiles of radioactive cesium concentration in sediment cores and sediment characteristics were measured at 36 points. It was shown that sediment characteristics were different even at high concentration of radioactive cesium to the same extent. As a result, the inventory of radioactive cesium were also different. Even at high concentration of radioactive cesium, inventory in southwestern high mud content rate was less than the western. The total inventory of down to 20 cm of sediment throughout Matsukawaura Lagoon was estimated to be about 220 GBq, that more than 80% distributed to 15 cm shallower than has been revealed. (author)

  2. A novel role for methyl cysteinate, a cysteine derivative, in cesium accumulation in Arabidopsis thaliana

    DEFF Research Database (Denmark)

    Adams, Eri; Miyazaki, Takae; Hayaishi-Satoh, Aya

    2017-01-01

    Phytoaccumulation is a technique to extract metals from soil utilising ability of plants. Cesium is a valuable metal while radioactive isotopes of cesium can be hazardous. In order to establish a more efficient phytoaccumulation system, small molecules which promote plants to accumulate cesium we...

  3. 25 CFR 141.48 - Translation of disclosure statements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Translation of disclosure statements. 141.48 Section 141.48 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Translation of disclosure statements. Disclosure required by §§ 141.46 and 141.47 shall be made in writing...

  4. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    International Nuclear Information System (INIS)

    Schultz, F.J.; Tompkins, J.A.; Haff, K.W.; Case, F.N.

    1981-07-01

    Twenty-seven fully loaded 137 Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 1500 0 C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of 137 Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded 137 Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10 -10 kg m -2 s -1 , while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10 -12 kg m -2 s -1 . The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level 137 Cs aluminosilicate pellets were 1.29 x 10 -16 m 2 s -1 , 6.88 x 10 -17 m 2 s -1 , and 1.35 x 10 -17 m 2 s -1 , respectively

  5. Efficiency of fly ash belite cement and zeolite matrices for immobilizing cesium

    International Nuclear Information System (INIS)

    Goni, S.; Guerrero, A.; Lorenzo, M.P.

    2006-01-01

    The efficiency of innovative matrices for immobilizing cesium is presented in this work. The matrix formulation included the use of fly ash belite cement (FABC-2-W) and gismondine-type Na-P1 zeolite, both of which are synthesized from fly ash of coal combustion. The efficiency for immobilizing cesium is evaluated from the leaching test ANSI/ANS 16.1-1986 at the temperature of 40 deg. C, from which the apparent diffusion coefficient of cesium is obtained. Matrices with 100% of FABC-2-W are used as a reference. The integrity of matrices is evaluated by porosity and pore-size distribution from mercury intrusion porosimetry, X-ray diffraction and nitrogen adsorption analyses. Both matrices can be classified as good solidify systems for cesium, specially the FABC-2-W/zeolite matrix in which the replacement of 50% of belite cement by the gismondine-type Na-P1 zeolite caused a decrease of two orders of magnitude of cesium mean Effective Diffusion Coefficient (D e ) (2.8e-09 cm 2 /s versus 2.2e-07 cm 2 /s, for FABC-2-W/zeolite and FABC-2-W matrices, respectively)

  6. Biological effects of cesium-137 injected in beagle dogs of different ages

    Energy Technology Data Exchange (ETDEWEB)

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others

    1995-12-01

    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.

  7. 5 CFR 185.141 - Stay pending appeal.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stay pending appeal. 185.141 Section 185.141 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.141 Stay pending appeal. (a) An initial decision is stayed automatically pending...

  8. 45 CFR 2490.141-2490.148 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.141-2490.148 Section 2490.141-2490.148 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.141-2490.148 [Reserved] ...

  9. The determination of cesium and rubidium in highly radioactive waste liquid

    International Nuclear Information System (INIS)

    Wei Songsheng

    1991-01-01

    Cesium and rubidium in high-level waste liquid were determined by atomic absorption spectrometry with the instrument modified for analyzing radioactive samples. The results show that the method is effective and safe. The error of the method is less than +- 3%, and it has been used in the production of cesium

  10. Lanthanide doped strontium-barium cesium halide scintillators

    Science.gov (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  11. Mineral-deposit model for lithium-cesium-tantalum pegmatites

    Science.gov (United States)

    Bradley, Dwight C.; McCauley, Andrew D.; Stillings, Lisa L.

    2017-06-20

    Lithium-cesium-tantalum (LCT) pegmatites comprise a compositionally defined subset of granitic pegmatites. The major minerals are quartz, potassium feldspar, albite, and muscovite; typical accessory minerals include biotite, garnet, tourmaline, and apatite. The principal lithium ore minerals are spodumene, petalite, and lepidolite; cesium mostly comes from pollucite; and tantalum mostly comes from columbite-tantalite. Tin ore as cassiterite and beryllium ore as beryl also occur in LCT pegmatites, as do a number of gemstones and high-value museum specimens of rare minerals. Individual crystals in LCT pegmatites can be enormous: the largest spodumene was 14 meters long, the largest beryl was 18 meters long, and the largest potassium feldspar was 49 meters long.Lithium-cesium-tantalum pegmatites account for about one-fourth of the world’s lithium production, most of the tantalum production, and all of the cesium production. Giant deposits include Tanco in Canada, Greenbushes in Australia, and Bikita in Zimbabwe. The largest lithium pegmatite in the United States, at King’s Mountain, North Carolina, is no longer being mined although large reserves of lithium remain. Depending on size and attitude of the pegmatite, a variety of mining techniques are used, including artisanal surface mining, open-pit surface mining, small underground workings, and large underground operations using room-and-pillar design. In favorable circumstances, what would otherwise be gangue minerals (quartz, potassium feldspar, albite, and muscovite) can be mined along with lithium and (or) tantalum as coproducts.Most LCT pegmatites are hosted in metamorphosed supracrustal rocks in the upper greenschist to lower amphibolite facies. Lithium-cesium-tantalum pegmatite intrusions generally are emplaced late during orogeny, with emplacement being controlled by pre-existing structures. Typically, they crop out near evolved, peraluminous granites and leucogranites from which they are inferred to be

  12. 25 CFR 141.59 - Customer complaint procedures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Customer complaint procedures. 141.59 Section 141.59... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.59 Customer complaint procedures. (a) Any customer of a licensee may file a complaint with the Commissioner alleging...

  13. Cesium-137 in Norwegian milk 1960-1976

    International Nuclear Information System (INIS)

    Hvinden, T.

    1977-03-01

    Cesium-137 in milk has been measured at 11 sampling sites in Norway since 1960. The results show seasonal variations, normally with a peak during summer, and variations from district to district, depending upon farming and precipitation conditions. The concentration of cesium-137, averaged over the 11 sampling sites, reached a maximum of 0.44 nanocurie/litre in 1964, decreasing to 0.05 in 1975 and 1976. The range of variations within the 11 sites is of the order of 10. At other sites, with high precipitation and low grazing field qualities, the concentration has been found to be higher than at the 11 sites, giving a range of variations of more than 100. (Auth.)

  14. Cesium titanium silicate and method of making

    Science.gov (United States)

    Balmer, Mari L.

    1997-01-01

    The invention is the new material, a ternary compound of cesium, silica, and titania, together with a method of making the ternary compound, cesium titanium silicate pollucite. More specifically, the invention is Cs.sub.2 Ti.sub.2 Si.sub.4 O.sub.13 pollucite which is a new crystalline phase representing a novel class of Ti-containing zeolites. Compositions contain relatively high Cs.sub.2 O and TiO.sub.2 loadings and are durable glass and ceramic materials. The amount of TiO.sub.2 and Cs.sub.2 that can be incorporated into these glasses and crystalline ceramics far exceeds the limits set for the borosilicate high level waste glass.

  15. Modelling the transport of radioactive cesium released from the Fukushima Dai-ichi NPP with sediments through the hydrologic system

    Science.gov (United States)

    Kinouchi, T.; Omata, T.; Wei, L.; Liu, T.; Araya, M.

    2013-12-01

    Due to the accident of the Fukushima Dai-ichi Nuclear Power Plant on March 2011, a huge amount of radionuclides including Cesium-134 and Cesium-137 was deposited over the main island of Japan and the Pacific Ocean, resulting in further transfer and diffusion of Cesium through the atmospheric flow, watershed hydrological processes, and terrestrial ecosystem. Particularly, for the transfer of Cesium-134 and Cesium-137, sediments eroded and transported by the rainfall-runoff processes play an important role as Cesium tends to be strongly adsorbed to soil particles such as clay and silt. In this study, we focus on the transport of sediment and adsorbed Cesium in the watershed-scale hydrologic system to predict the long-term change of distribution of Cesium and its discharge to rivers and ocean. We coupled a physically-based distributed hydrological model with the modules of erosion and transport of sediments and adsorbed Cesium, and applied the coupled model to the Abukuma River watershed, which is located over the area of higher deposition of Cesium. In the model, complex land use and land cover distributions, and the effect of human activities such as irrigation, dam control and urban drainage system are taken into accounts. Simulation was conducted for the period of March 2011 until August 2012, with initial spatial distribution of Cesium-134 and Cesium-137 obtained by the airborne survey. Simulated flow rates and sediment concentrations agreed well with observed, and found that since the accident, two major storms in July and September 2011 transported about 50% of total sediments transported during the simulated periods. Cesium concentration in the sediment was reproduced well except for the difference in the initial periods. This difference is attributable to the uncertainty arisen from the initial distribution of Cesium in the soil and the transfer of Cesium from the forest canopy.

  16. Formation, decomposition and cesium adsorption mechanisms of highly alkali-tolerant nickel ferrocyanide prepared by interfacial synthesis

    International Nuclear Information System (INIS)

    Ichikawa, Tsuneki; Yamada, Kazuo; Osako, Masahiro; Haga, Kazuko

    2017-01-01

    Highly alkali-tolerant nickel ferrocyanide was prepared as an adsorbent for preventing the leaching of radioactive cesium from municipal solid waste incinerator fly ash containing large amounts of calcium hydroxide and potassium chloride, which act as an alkaline source and the suppressor for cesium adsorption, respectively. Nickel ferrocyanide prepared by contacting concentrated nickel and ferrocyanide solutions without mixing adsorbed cesium ions in alkaline conditions even the concentration of coexisting potassium ions was more than ten thousand times higher than that of the cesium ions. Large particles of nickel ferrocyanide slowly grew at the interface between the two solutions, which reduced the surface energy of the particles and therefore increased the alkali tolerance. The interfacially-synthesized nickel ferrocyanide was possible to prevent the leaching of radioactive cesium from cement-solidified fly ash for a long period. The mechanisms of the formation, selective cesium adsorption, and alkali-induced decomposition of the nickel ferrocyanide were elucidated. Comparison of the cesium adsorption mechanism with that of the other adsorbents revealed that an adsorbent can selectively adsorb cesium ions without much interference from potassium ions, if the following conditions are fulfilled. 1) The adsorption site is small enough for supplying sufficient electrostatic energy for the dehydration of ions adsorbed. 2) Both the cesium and potassium ions are adsorbed as dehydrated ions. 3) The adsorption site is flexible enough for permitting the penetration of dehydrated ions with the size comparable to that of the site. (author)

  17. Effect of electrolytes concentration on recovery of cesium from AMP-PAN by Electrodialysis-Ion Exchange (EDIX)

    International Nuclear Information System (INIS)

    Mahendra, Ch.; Rajan, K.K.; SatyaSai, P.M.; Anand Babu, C.

    2014-01-01

    Cesium from the simulated acidic waste solution was separated using Ammonium Molybdophosphate (AMP) - Polyacrylonitrile (PAN) ion exchange resin in column operations. Electrodialysis - Ion exchange (EDIX) has been tried for the recovery of cesium from the AMP-PAN which was saturated with cesium. The electrodialysis setup consists of three compartments; cesium loaded AMP-PAN is placed in the middle compartment and is separated from the anode and cathode compartments by cation exchange membranes. Ammonium sulphate was used as anolyte and HNO 3 as catholyte. 0.1N HNO 3 was circulated in the middle compartment containing AMP-PAN to keep the resin in acidic form. On application of potential, the ammonium ions from the anode compartment migrate towards cathode through the middle compartment where they exchange with cesium ions on the resin and the exchanged cesium ions migrate towards cathode to get concentrated. Some part of cesium is recovered in the middle compartment due to convection. Cesium recovery from the AMP-PAN in the electrodialysis setup was studied at different anolyte and catholyte concentrations. All the experiments were carried out at constant current density of 40 mA/cm 2 for 15h. It was found that more than 50% of cesium recovery was observed for all the experiments studied and recovery percentage increased with increasing the anolyte concentration. It was observed that the electrolytes concentration affects the voltage drop across the cell

  18. 28 CFR 39.141-39.148 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.141-39.148 Section 39.141-39.148 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.141-39.148 [Reserved] ...

  19. 19 CFR 141.43 - Delegation to subagents.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Delegation to subagents. 141.43 Section 141.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.43 Delegation to subagents. (a) Resident...

  20. Cesium absorption from acidic solutions using ammonium molybdophosphate on a polyacrylonitrile support (AMP-PAN)

    International Nuclear Information System (INIS)

    Miller, C.J.; Olson, A.L.; Johnson, C.K.

    1995-01-01

    Recent efforts at the Idaho Chemical Processing Plant (ICPP) have included evaluation of cesium removal technologies as applied to ICPP acidic radioactive waste streams. Ammonium molybdophosphate (AMP) immobilized on a polyacrylonitrile support (AMP-PAN) has been studied as an ion exchange agent for cesium removal from acidic waste solutions. Capacities, distribution coefficients, elutability, and kinetics of cesium-extraction have been evaluated. Exchange breakthrough curves using small columns have been determined from 1M HNO 3 and simulated waste solutions. The theoretical capacity of AMP is 213 g Cs/kg AMP. The average experimental capacity in batch contacts with various acidic solutions was 150 g Cs/kg AMP. The measured cesium distribution coefficients from actual waste solutions were 3287 mL/g for dissolved zirconia calcines, and 2679 mL/g for sodium-bearing waste. The cesium in the dissolved alumina calcines was analyzed for; however, the concentration was below analytical detectable limits resulting in inconclusive results. The reaction kinetics are very rapid (2-10 minutes). Cesium absorption appears to be independent of acid concentration over the range tested (0.1 M to 5 M HNO 3 )

  1. Laboratory plant for the separation of cesium from waste solutions of the PUREX process

    International Nuclear Information System (INIS)

    Richter, M.; Eckert, B.; Riemenschneider, J.; Mallon, C.; Mann, D.

    1983-01-01

    A laboratory plant for the separation of cesium from a fission product waste solution of the fuel reprocessing is described. The plant consists of two stages. In the first stage cesium is adsorbed on ammonium molybdatophosphate (AMP). Then the adsorbent is dissolved. From the solution cesium is adsorbed on a cationic ion exchanger in the second stage. Then AMP can be reproduced from this solution. For the elution of cesium in the second stage a NH 4 NO 3 solution (3 m) is used. Flow sheet, construction and the control device of the plant are described and the results of tests with a model solution are given. (author)

  2. 49 CFR 28.141-28.148 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.141-28.148 Section 28.141-28.148 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.141-28.148 [Reserved] ...

  3. 18 CFR 141.500 - Cash management programs.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.500 Cash management programs. Public utilities and... and § 141.1 or § 141.2 of this title that participate in cash management programs must file these...

  4. Mobility of radioactive cesium in soil originated from the Fukushima Daiichi nuclear disaster. Application of extraction experiments

    International Nuclear Information System (INIS)

    Yoshikazu Kikawada; Takao Oi; Katsumi Hirose; Masaaki Hirose; Atsushi Tsukamoto; Ko Nakamachi; Teruyuki Honda; Hiroaki Takahashi

    2015-01-01

    Extraction experiments on soil radioactively contaminated by the Fukushima Daiichi Nuclear Power Plant accident were conducted by using a variety of extractants to acquire knowledge on the mobility of radioactive cesium in soil. The experimental results revealed that cesium is tightly bound with soil particles and that radioactive cesium newly deposited on soil due to the accident had apparently a higher mobility than stable cesium commonly existing in soil. The results suggested that radioactive cesium deposited on soil hardly migrates via aqueous processes, although chemical and mineralogical conditions of soil affect their mobility. (author)

  5. Efficient non-linear two-photon effects from the Cesium 6D manifold

    Science.gov (United States)

    Haluska, Nathan D.; Perram, Glen P.; Rice, Christopher A.

    2018-02-01

    We report several non-linear process that occur when two-photon pumping the cesium 6D states. Cesium vapor possess some of the largest two-photon pump cross sections in nature. Pumping these cross sections leads to strong amplified spontaneous emission that we observe on over 17 lasing lines. These new fields are strong enough to couple with the pump to create additional tunable lines. We use a heat pipe with cesium densities of 1014 to 1016 cm-3 and 0 to 5 Torr of helium buffer gas. The cesium 6D States are interrogated by both high energy pulses and low power CW sources. We observe four-wave mixing, six-wave mixing, potential two-photon lasing, other unknown nonlinear processes, and the persistence of some processes at low thresholds. This system is also uniquely qualified to support two-photon lasing under the proper conditions.

  6. Review and assessment of technologies for the separation of cesium from acidic media

    Energy Technology Data Exchange (ETDEWEB)

    Orth, R.J.; Brooks, K.P.; Kurath, D.E.

    1994-09-01

    A preliminary literature survey has been conducted to identify and evaluate methods for the separation of cesium from acidic waste. The most promising solvent extraction, precipitation, and ion exchange methods, along with some of the attributes for each method, are listed. The main criteria used in evaluating the separation methods were as follows: (1) good potential for cesium separation must be demonstrated (i.e., cesium decontamination factors on the order of 50 to 100). (2) Good selectivity for cesium over bulk components must be demonstrated. (3) The method must show promise for evolving into a practical and fairly simple process. (4) The process should be safe to operate. (5) The method must be robust (i.e., capable of separating cesium from various acidic waste types). (6) Secondary waste generation must be minimized. (7) The method must show resistance to radiation damage. The most promising separation methods did not necessarily satisfy all of the above criteria, thus key areas requiring further development are suggested for each method. The report discusses in detail these and other areas requiring further development, as well as alternative solvent extraction, precipitation, ion exchange, and {open_quote}other{close_quote} technologies that, based on current information, show less promise for the separation of cesium from acidic wastes because of significant process limitations. When appropriate, the report recommends areas of future development.

  7. Immobilization of aqueous radioactive cesium wastes by conversion to aluminosilicate minerals

    International Nuclear Information System (INIS)

    Barney, G.S.

    1975-05-01

    Radioactive cesium (primarily 137 Cs) is a major toxic constituent of liquid wastes from nuclear fuel processing plants. Because of the long half-life, highly penetrating radiation, and mobility of 137 Cs, it is necessary to convert wastes containing this radioisotope into a solid form which will prevent movement to the biosphere during long-term storage. A method for converting cesium wastes to solid, highly insoluble, thermally stable aluminosilicate minerals is described. Aluminum silicate clays (bentonite, kaolin, or pyrophyllite) or hydrous aluminosilicate gels are reacted with basic waste solutions to form pollucite, cesium zeolite (Cs-D), Cs-F, cancrinite, or nepheline. Cesium is trapped in the aluminosilicate crystal lattice of the mineral and is permanently immobilized. The identity of the mineral product is dependent on the waste composition and the SiO 2 /Al 2 O 3 ratio of the clay or gel. The stoichiometry and kinetics of mineral formation reactions are described. The products are evaluated with respect to leachability, thermal stability, and crystal morphology. (U.S.)

  8. Radioactive cesium content in selected food products. Pt. 2. Radioactive cesium in daily food rations of selected population groups

    International Nuclear Information System (INIS)

    Skibniewska, K.; Smoczynski, S.S.; Wisniewska, I.

    1993-01-01

    The content of radioactive cesium isotopes emitting beta radiation was studied in daily food rations analysed in diets of working-class and non-working-class families from food products from the regions of Olsztyn, Poznan, Lublin, Warsaw and Wroclaw in 1987 and 1988. In 1987 the highest level of radioactive cesium was found in the food rations in Olsztyn, and lowest in the rations in Poznan (3.32 and 0.65 Bq/kg respectively). In 1988 higher radiocesium content was found in rations composed according to the data on the diet consumed daily in non-working-class families. In that case the highest content was in the daily food rations composed in Warsaw - 2.35 Bq/kg and lowest in Poznan - 1.19 Bq/kg in the daily food rations of working-class families about one half of that value was found. The calculated means values of both analysed rations were: 1.35 for Olsztyn, 0.89 for Poznan, and 1.86 Bq/kg for Warsaw. The calculated mean value of the contamination with radioactive cesium was in 1988 0.93 Bq/kg for the rations in working-class families (in 1987 it was 1.80 Bq/kg). (author). 15 refs, 1 tab

  9. 7 CFR 1.41 - Service of process.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Service of process. 1.41 Section 1.41 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Judicial Proceedings § 1.41 Service of... of the General Counsel, in order that service of process may be made. In the event an officer of the...

  10. Removal of cesium from simulated liquid waste with countercurrent two-stage adsorption followed by microfiltration

    Energy Technology Data Exchange (ETDEWEB)

    Han, Fei; Zhang, Guang-Hui [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Gu, Ping, E-mail: guping@tju.edu.cn [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China)

    2012-07-30

    Highlights: Black-Right-Pointing-Pointer The adsorption isotherm of cesium by copper ferrocyanide followed a Freundlich model. Black-Right-Pointing-Pointer Decontamination factor of cesium was higher in lab-scale test than that in jar test. Black-Right-Pointing-Pointer A countercurrent two-stage adsorption-microfiltration process was achieved. Black-Right-Pointing-Pointer Cesium concentration in the effluent could be calculated. Black-Right-Pointing-Pointer It is a new cesium removal process with a higher decontamination factor. - Abstract: Copper ferrocyanide (CuFC) was used as an adsorbent to remove cesium. Jar test results showed that the adsorption capacity of CuFC was better than that of potassium zinc hexacyanoferrate. Lab-scale tests were performed by an adsorption-microfiltration process, and the mean decontamination factor (DF) was 463 when the initial cesium concentration was 101.3 {mu}g/L, the dosage of CuFC was 40 mg/L and the adsorption time was 20 min. The cesium concentration in the effluent continuously decreased with the operation time, which indicated that the used adsorbent retained its adsorption capacity. To use this capacity, experiments on a countercurrent two-stage adsorption (CTA)-microfiltration (MF) process were carried out with CuFC adsorption combined with membrane separation. A calculation method for determining the cesium concentration in the effluent was given, and batch tests in a pressure cup were performed to verify the calculated method. The results showed that the experimental values fitted well with the calculated values in the CTA-MF process. The mean DF was 1123 when the dilution factor was 0.4, the initial cesium concentration was 98.75 {mu}g/L and the dosage of CuFC and adsorption time were the same as those used in the lab-scale test. The DF obtained by CTA-MF process was more than three times higher than the single-stage adsorption in the jar test.

  11. 26 CFR 1.141-13 - Refunding issues.

    Science.gov (United States)

    2010-04-01

    ... management contract and takes over the operation of the facility. In 2009, C issues bonds to refund the 1999... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Refunding issues. 1.141-13 Section 1.141-13...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-13 Refunding issues...

  12. MODELING AN ION EXCHANGE PROCESS FOR CESIUM REMOVAL FROM ALKALINE RADIOACTIVE WASTE SOLUTIONS

    International Nuclear Information System (INIS)

    Smith, F.; Hamm, Luther; Aleman, Sebastian; Michael, Johnston

    2008-01-01

    The performance of spherical Resorcinol-Formaldehyde ion-exchange resin for the removal of cesium from alkaline radioactive waste solutions has been investigated through computer modeling. Cesium adsorption isotherms were obtained by fitting experimental data using a thermodynamic framework. Results show that ion-exchange is an efficient method for cesium removal from highly alkaline radioactive waste solutions. On average, two 1300 liter columns operating in series are able to treat 690,000 liters of waste with an initial cesium concentration of 0.09 mM in 11 days achieving a decontamination factor of over 50,000. The study also tested the sensitivity of ion-exchange column performance to variations in flow rate, temperature and column dimensions. Modeling results can be used to optimize design of the ion exchange system

  13. Cement materials for cesium and iodine confinement

    International Nuclear Information System (INIS)

    Nicolas, G.; Lequeux, N.; Boch, P.; Prene, S.

    2001-01-01

    The following topics were dealt with: radioactive waste storage, cement materials reacting with radioactive cesium and iodine, chemical barrier formation against radioactive pollution, ceramization, long term stability, XRD, PIXE analysis

  14. Web-Based Geospatial Visualization of GPM Data with CesiumJS

    Science.gov (United States)

    Lammers, Matt

    2018-01-01

    Advancements in the capabilities of JavaScript frameworks and web browsing technology have made online visualization of large geospatial datasets such as those coming from precipitation satellites viable. These data benefit from being visualized on and above a three-dimensional surface. The open-source JavaScript framework CesiumJS (http://cesiumjs.org), developed by Analytical Graphics, Inc., leverages the WebGL protocol to do just that. This presentation will describe how CesiumJS has been used in three-dimensional visualization products developed as part of the NASA Precipitation Processing System (PPS) STORM data-order website. Existing methods of interacting with Global Precipitation Measurement (GPM) Mission data primarily focus on two-dimensional static images, whether displaying vertical slices or horizontal surface/height-level maps. These methods limit interactivity with the robust three-dimensional data coming from the GPM core satellite. Integrating the data with CesiumJS in a web-based user interface has allowed us to create the following products. We have linked with the data-order interface an on-the-fly visualization tool for any GPM/partner satellite orbit. A version of this tool also focuses on high-impact weather events. It enables viewing of combined radar and microwave-derived precipitation data on mobile devices and in a way that can be embedded into other websites. We also have used CesiumJS to visualize a method of integrating gridded precipitation data with modeled wind speeds that animates over time. Emphasis in the presentation will be placed on how a variety of technical methods were used to create these tools, and how the flexibility of the CesiumJS framework facilitates creative approaches to interact with the data.

  15. An Experimental Study of the Fluorescence Spectrum of Cesium Atoms in the Presence of a Buffer Gas

    Science.gov (United States)

    Davydov, V. G.; Kulyasov, V. N.

    2018-01-01

    A direct experiment is performed to determine the quantum efficiency of a cesium fluorescence filter. The fluorescence spectra of cesium atoms are recorded under excitation of the upper states of the second resonance doublet with a Bell-Bloom cesium lamp. Introduction of different noble gases into the cell with cesium leads to the appearance of additional fluorescence photons. It is found that a fluorescence filter based on atomic cesium vapor with addition of helium in the working cell has the highest efficiency and response rate of all known fluorescence filters based on alkali-metal atomic vapors.

  16. Studies on the synthesis and characterization of cesium-containing iron phosphate glasses

    Science.gov (United States)

    Joseph, Kitheri; Govindan Kutty, K. V.; Chandramohan, P.; Vasudeva Rao, P. R.

    2009-02-01

    Isotopes of cesium and strontium can be utilized as radiation source for various industrial and medical applications after their separation from high level nuclear waste. However, these elements need to be immobilized in a suitable matrix. In the present work, a systematic approach has been made to immobilize inactive cesium into iron phosphate glass. Up to 36 mol% of Cs 2O has been loaded successfully without crystallization. The glass transition temperature of the cesium loaded glass was found to increase initially and then decrease as a function of Cs 2O content. Mössbauer studies show that the concentration of Fe 3+ ions in the cesium loaded glasses is >95%. Volatilization experiments at 1263 K show that the weight loss is >0.5% for a period of 4 h. The 36 mol% of Cs 2O loaded iron phosphate glass with high Fe 3+ content described in this paper is reported for the first time.

  17. Solid state cesium ion guns for surface studies

    International Nuclear Information System (INIS)

    Souzis, A.E.; Carr, W.E.; Kim, S.I.; Seidl, M.

    1990-01-01

    Three cesium ion guns covering the energy range of 5--5000 V are described. These guns use a novel source of cesium ions that combine the advantages of porous metal ionizers with those of aluminosilicate emitters. Cesium ions are chemically stored in a solid electrolyte pellet and are thermionically emitted from a porous thin film of tungsten at the surface. Cesium supply to the emitting surface is controlled by applying a bias across the pellet. A total charge of 10.0 C can be extracted, corresponding to greater than 2000 h of lifetime with an extraction current of 1.0 μA. This source is compact, stable, and easy to use, and produces a beam with >99.5% purity. It requires none of the differential pumping or associated hardware necessary in designs using cesium vapor and porous tungsten ionizers. It has been used in ultrahigh-vacuum (UHV) experiments at pressures of -10 Torr with no significant gas load. Three different types of extraction optics are used depending on the energy range desired. For low-energy deposition, a simple space-charge-limited planar diode with a perveance of 1x10 -7 A/V 3/2 is used. Current densities of 10.0 μA/cm 2 at the exit aperture for energies ≤20 V are typical. This type of source provides an alternative to vapor deposition with the advantage of precise flux calibration by integration of the ion current. For energies from 50 to 500 V and typical beam radii of 0.5 to 0.2 mm, a high perveance Pierce-type ion gun is used. This gun was designed with a perveance of 1x10 -9 A/V 3/2 and produces a beam with an effective temperature of 0.35 eV. For the energy range of 0.5 to 5 keV, the Pierce gun is used in conjunction with two Einzel lenses, enabling a large range of imaging ratios to be obtained. Beam radii of 60 to 300 μm are typical for beam currents of 50 nA to 1.0 μA

  18. Historical Cost Curves for Hydrogen Masers and Cesium Beam Frequency and Timing Standards

    Science.gov (United States)

    Remer, D. S.; Moore, R. C.

    1985-01-01

    Historical cost curves were developed for hydrogen masers and cesium beam standards used for frequency and timing calibration in the Deep Space Network. These curves may be used to calculate the cost of future hydrogen masers or cesium beam standards in either future or current dollars. The cesium beam standards are decreasing in cost by about 2.3% per year since 1966, and hydrogen masers are decreasing by about 0.8% per year since 1978 relative to the National Aeronautics and Space Administration inflation index.

  19. Effects of mineralogy on sorption of strontium and cesium onto Calico Hills Tuff

    International Nuclear Information System (INIS)

    Meyer, R.E.; Arnold, W.D.; Case, F.I.; O'Kelley, G.D.; Land, J.F.

    1990-04-01

    The sorption properties of tuff formations at the proposed site for the high-level nuclear waste repository at Yucca Mountain, Nevada, have been extensively studied. Sorption and desorption measurements were made of strontium and cesium onto clinoptilolite and Calico Hills Tuff. The object was to see whether there was a correlation between sorption of strontium and cesium onto Calico Hills Tuff and the sorption of strontium and cesium onto clinoptilolite based on the content of clinoptilolite in the Calico Hills Tuff. 13 refs., 10 figs., 6 tabs

  20. Cesium-137 in biota from the Bothnian sea after the Chernobyl accident

    International Nuclear Information System (INIS)

    Notter, M.

    1990-01-01

    The Chernobyl fallout in April 1986 hit the Swedish Bothnian Sea coast to a relatively large extent. Extended sampling programs to follow uptake and mobilization of Cs-137 at different trophic levels in the aquatic environment started immediately after the accident. Water, sediment, algae, fish and food organisms for fish have regularly been sampled during 1986 and 1988. The highest cesium concentration (3400 Bq/m 3 ) in water from the Bothnian sea was detected in May-July 1986. Since September 1986 the cesium concentration has been decreasing and was about 500 Bq/m 3 in March-June 1987. During the same period, green algae (Cladophora), from early top values at 17000 Bq/kg d.w., have rapidly decreased to about 200 Bq/kg d.w. Of the investigated food organisms, fish-spawn rapidly got high values (3000 Bq/kg d.w.) of cesium. There is also reason to believe that this was the case for plankton. The cesium concentration on the other food organisms was lower, about (500-1200 Bq/kg d.w.). The decrease was fast and already during August 1986 they had relatively low concentrations (less than 500 Bq/kg d.w.). The cesium metabolism was rapid in species that feed on plankton and filtered material from the pelagial, such as mussles and herring. The maximum concentration was reached (1000-1500 Bq/kg d.w.) in September 1986. Fish species with algae in the nutrient chain (e.g. roach) reached concentrations of about 1000 Bq/kg d.w. and the decrease is slower. The accessible cesium for prey fish became relatively good depending on the high concentrations in fish-spawn. The maximum value for the cesium concentration in perch and pike was 2000-3000 Bq/kg d.w. and the decrease is slow. From the results from late 1988 the concentration factor (CF) has been calculated for several fish species in brackish water

  1. 21 CFR 146.141 - Canned orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned orange juice. 146.141 Section 146.141 Food... Beverages § 146.141 Canned orange juice. (a) Canned orange juice is the food prepared from orange juice as specified in § 146.135 or frozen orange juice as specified in § 146.137, or a combination of both, to which...

  2. Cesium-137 uptake studies on ammonium phospho molybdate irradiated with electrons

    International Nuclear Information System (INIS)

    Rao, K.L.N.; Balasubramanian, K.R.; Shukla, J.P.

    1992-01-01

    Ammonium phospho molybdate is an important inorganic ion exchanger having high selectivity for cesium. This paper discusses the effects of electron irradiation to a dose of 1 mGy on this exchanger with special reference to its ion exchange performance using cesium-137 as a tracer. An explanation is attempted for the slight increase in the distribution coefficients. (author). 5 refs., 1 tab

  3. Strontium-90 and cesium-137 in sea sediments (from May 1984 to Sep 1984)

    International Nuclear Information System (INIS)

    1984-01-01

    Strontium-90 and cesium-137 monitoring results are presented for sea sediment samples of 12 sampling points located all over Japan from Tomari, Hokkaido to Kinnakagusuku Bay, Okinawa. The samples were collected by considering of enough sea water depth, no significant sedimental movement and sediment characteristics, and by employing a conventional sampling device. Approximately 4 kg-wet sample was dried and was passed through a 20 cm mesh sieve. After adding of strontium and cesium carriers, strontium-90 and cesium-137 were leached with a hot hydrochloric acid solution. The leachate was treated by ion exchange and coprecipitation to concentrate and isolate strontium-90 or cesium-137. Radiation counting was carried out by employing a low background beta counter usually for 60 minutes for the samples of strontium carbonate or cesium chloroplatinate. Determined strontium-90 contents in sea sediment were distributed from 0 +- 2.7 pCi/kg-dry (Mutsu Bay, Aomori, Yamaguchi Bay, Yamaguchi) to 14 +- 3.2 pCi/kg-dry (Mutsu Bay), and those of cesium-137 were from 9 +- 3.5 pCi/kg-dry (Mutsu Bay) to 250 +- 9 pCi/kg-dry (Off-Niigata Port, Niigata). Local variation of the contents of these radionuclides was very large, and for seasonal variation, it was also found large for the both nuclides content in the Mutsu Bay samples of May, 1984 and August 1984, as for strontium-90, 0 +- 2.7 pCi/kg and 14 +- 3.2 pCi/kg, for cesium-137, 9 +- 3.5 pCi/kg and 200 +- 8 pCi/kg, respectively. (Takagi, S.)

  4. Studies of cesium and strontium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    Gillham, R.W.; Lindsay, L.E.; Reynolds, W.D.; Kewen, T.J.; Cherry, J.A.; Reddy, M.R.

    1981-06-01

    Distribution coefficients (Ksub(d)) were measured for cesium and strontium in 16 samples of Canadian unconsolidated geological materials. The samples were collected to cover a wide range of grain size, clay-mineral composition, cation exchange capacity and carbonate mineral content. Distribution coefficients ranged between 10 2 and 2.0 x 10 4 ml/g for cesium and between 2.5 and 10 2 ml/g for strontium, indicating that most unconsolidated geological materials have a substantial ability to retard the migration of cesium, while strontium could generally be expected to be somewhat more mobile. The measured K values were not significantly correlated with the measured soil properties, but appeared to be significantly affected by the background concentration of stable isotopes of the respective radionuclides

  5. Transfer of radio-cesium from forest soil to woodchips using fungal activities

    Science.gov (United States)

    Kaneko, Nobuhiro; Huang, Yao; Tanaka, Yoichiro; Fujiwara, Yoshihiro; Sasaki, Michiko; Toda, Hiroto; Takahashi, Terumasa; Kobayashi, Tatsuaki; Harada, Naoki; Nonaka, Masahiro

    2014-05-01

    Raido-cesium released to terrestrial ecosystems by nuclear accidents is know to accumulate forest soil and organic layer on the soil. Forests in Japan are not exceptions. Practically it is impossible to decontaminate large area of forests. However, there is a strong demand from local people, who has been using secondary forests (Satoyama) around croplands in hilly areas, to decontaminate radio-cesium, because those people used to collect wild mushrooms and edible plants, and there are active cultures of mushrooms using logs and sawdusts. These natural resource uses consist substantial part of their economical activities, Therefore it is needed to decontaminate some selected part of forests in Japan to local economy. Clear cutting and scraping surface soil and organic matter are common methods of decontamination. However the efficiency of decontamination is up to 30% reduction of aerial radiation, and the cost to preserve contaminated debris is not affordable. In this study we used wood chips as a growth media for saprotrophic fungi which are known to accumulate redio-cesium. There are many studies indicated that mushrooms accumulated redio-cesium from forest soil and organic layer. It is not practical to collect mushrooms to decontaminate redio-cesium, because biomass of mushrooms are not enough to collect total contaminants. Mushrooms are only minor part of saprotrophic fungi. Fungal biomass in forest soil is about 1% of dead organic matter on forest floor. Our previous study to observe Cs accumulation to decomposing leaf litter indicated 18% absorption of total soil radio-Cs to litter during one year field incubation (Kaneko et al., 2013), and Cs concentration was proportional to fungal biomass on litter. This result indicated that fungi transferred radio-cesium around newly supplied leaf litter free of contamination. Therefore effective decontamination will be possible if we can provide large amount of growth media for saprotrophic fungi, and the media can be

  6. A solution for cesium removal from high-salinity acidic or alkaline liquid waste: The crown calix[4]arenes

    International Nuclear Information System (INIS)

    Dozol, J.F.; Simon, N.; Lamare, V.; Rouquette, H.; Eymard, S.; Tournois, B.; Marc, D. de; Macias, R.M.

    1999-01-01

    Calix[4]arenes monocrown or biscrown, blocked in 1,3 alternative cone conformation, display an exceptional efficiency for cesium extraction, even from very acid or alkaline media. Moreover, they possess an important selectivity for cesium over sodium that makes possible the extraction of cesium from media containing high sodium nitrate loadings. Another advantage, since the extraction of cesium is reversible, is that the stripping of cesium can be carried out in deionized water, a property which leads to very high concentration factors. 79 refs., 10 figs., 6 tabs

  7. Distribution and Translocation of 141Ce (III) in Horseradish

    Science.gov (United States)

    Guo, Xiaoshan; Zhou, Qing; Lu, Tianhong; Fang, Min; Huang, Xiaohua

    2007-01-01

    Background and Aims Rare earth elements (REEs) are used in agriculture and a large amount of them contaminate the environment and enter foods. The distribution and translocation of 141Ce (III) in horseradish was investigated in order to help understand the biochemical behaviour and toxic mechanism of REEs in plants. Method The distribution and translocation of 141Ce (III) in horseradish were investigated using autoradiography, liquid scintillation counting (LSC) and electron microscopic autoradiography (EMARG) techniques. The contents of 141Ce (III) and nutrient elements were analysed using an inductively coupled plasma-atomic emission spectrometer (ICP-AES). Results The results from autoradiography and LSC indicated that 141Ce (III) could be absorbed by horseradish and transferred from the leaf to the leaf-stalk and then to the root. The content of 141Ce (III) in different parts of horseradish was as follows: root > leaf-stalk > leaf. The uptake rates of 141Ce (III) in horseradish changed with the different organs and time. The content of 141Ce (III) in developing leaves was greater than that in mature leaves. The results from EMARG indicated that 141Ce (III) could penetrate through the cell membrane and enter the mesophyll cells, being present in both extra- and intra-cellular deposits. The contents of macronutrients in horseradish were decreased by 141Ce (III) treatment. Conclusions 141Ce (III) can be absorbed and transferred between organs of horseradish with time, and the distribution was found to be different at different growth stages. 141Ce (III) can enter the mesophyll cells via apoplast and symplast channels or via plasmodesmata. 141Ce (III) can disturb the metabolism of macronutrients in horseradish. PMID:17921527

  8. 40 CFR 141.155 - Report delivery and recordkeeping.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Report delivery and recordkeeping. 141.155 Section 141.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Consumer Confidence Reports § 141.155...

  9. Measurements of cesium-137 in residents of Seascale and its environs

    Energy Technology Data Exchange (ETDEWEB)

    Fry, F A; Sumerling, T J

    1984-07-01

    Measurements of the body content of cesium-137 have been made on almost 300 members of the public residing in or near Seascale, a community in west Cumbria close to the nuclear installation at Sellafield operated by British Nuclear Fuels plc. The major objective of this study was to compare the levels found in the population with those predicted from environmental measurements. No artificially-produced radionuclides were detected in the overwhelming majority of those measured. Cesium-137 was detected in about 7% of the measured population but, in general, the levels were much lower than those expected. The highest body content found was comparable with the average predicted from environmental measurements and estimates of food consumption rates; this body content corresponds to intake of cesium-137 at a rate of somewhat less than 2% of the appropriate annual limit on intake for members of the public. From this study, it is concluded that contamination of foodstuffs with cesium-137 leads to exposure of the local population at levels that are of low radiological significance, and that estimates of intake obtained from environmental monitoring data are cautious for most of the population.

  10. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Baiyang [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Fugetsu, Bunshi, E-mail: hu@ees.hokudai.ac.jp [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Yu, Hongwen [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Abe, Yoshiteru [Kyoei Engineering Corporation, Niigata 959-1961 (Japan)

    2012-05-30

    Highlights: Black-Right-Pointing-Pointer Prussian blue was sealed in cavities of diatomite using carbon nanotubes. Black-Right-Pointing-Pointer The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. Black-Right-Pointing-Pointer Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  11. Environmental application of cesium-137 irradiation technology: sludges and foods

    International Nuclear Information System (INIS)

    Sivinski, J.S.

    1983-01-01

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation. (author)

  12. Environmental application of cesium-137 irradiation technology: Sludges and foods

    Science.gov (United States)

    Sivinski, Jacek S.

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation.

  13. Tungstate-based glass-ceramics for the immobilization of radio cesium

    Science.gov (United States)

    Drabarek, Elizabeth; McLeod, Terry I.; Hanna, John V.; Griffith, Christopher S.; Luca, Vittorio

    2009-02-01

    The preparation of tungstate-containing glass-ceramic composites (GCC) for the potential immobilization of radio cesium has been considered. The GCC materials were prepared by blending two oxide precursor compositions in various proportions. These included a preformed Cs-containing hexagonal tungsten bronze (HTB) phase (Cs 0.3Ti 0.2W 0.8O 3, P6 3/ mcm) and a blend of silica and other oxides. The use of the HTB phase was motivated on the assumption that a HTB-based adsorbent could be used to remove cesium directly from aqueous high level liquid waste feeds. In the absence of the HTB, glass-ceramics were relatively easily prepared from the Cs-containing glass-forming oxide blend. On melting the mixture a relative complex GCC phase assemblage formed. The principal components of this phase assemblage were determined using X-ray powder diffraction, 133Cs MAS-NMR, and cross-sectional SEM and included glass, various zeolites, scheelite (CaWO 4) and a range of other oxide phases and Cs-containing aluminosilicate. Importantly, under no circumstance was cesium partitioned into the glass phase irrespective of whether or not the composition included the preformed Cs-containing HTB compound. For compositions containing the HTB, cesium was partitioned into one of four major phases including zeolite; Cs-silica-tungstate bronze, pollucite (CsAlSi 2O 6), and an aluminosilicate with an Al/Si ratio close to one. The leach resistance of all materials was evaluated and related to the cesium distribution within the GCC phase assemblages. In general, the GCCs prepared from the HTB had superior durability compared with materials not containing tungsten. Indeed the compositions in many cases had leach resistances comparable to the best ceramics or glass materials.

  14. 40 CFR 141.172 - Disinfection profiling and benchmarking.

    Science.gov (United States)

    2010-07-01

    ... benchmarking. 141.172 Section 141.172 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Disinfection-Systems Serving 10,000 or More People § 141.172 Disinfection profiling and benchmarking. (a... sanitary surveys conducted by the State. (c) Disinfection benchmarking. (1) Any system required to develop...

  15. 40 CFR 141.101 - Use of bottled water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Use of bottled water. 141.101 Section 141.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Use of Non-Centralized Treatment Devices § 141.101...

  16. SIMS diagnostics of nanometer semiconductor structures with the use of cesium ions

    International Nuclear Information System (INIS)

    Pustovit, A.N.; Vyatkin, A.F.

    2006-01-01

    The modernization of cesium ion source was carried out to increase the lifetime, the power range of primary ions and temporary stability of primary ion beam. The elements depth profiles obtained with the help of primary cesium ions and primary iodine ions are in good agreement with transmission electron microscopy data [ru

  17. Transition of cesium in food chains [after Chernobyl catastrophe

    International Nuclear Information System (INIS)

    Procházka, H.; Brunclík, T.; Jandl, J.; Jirásek, V.; Novosad, J.; Hampl, J.

    1990-01-01

    An investigation of 25,000 samples of foodstuffs and feedstuffs in Czechoslovakia, contaminated by fall-out cesium after the accident in the Chernobyl nuclear power plant, performed from May 5, 1986 to March 31, 1988, revealed that both the values of cesium transfer-factors in food--animal tissues--milk transitions and the values of biological half-life of cesium are functions of internal and external conditions of contamination. Organism individuality as the main internal condition causes the variance of about +/- 50% of the mean value of the respective transfer-factor. Through the external conditions, mainly the environmental contamination level, type of ingested food and time of ingestion, the mean values of transfer-factors are influenced up to 500%, e.g. to the value of 0.5. But this value converges with growing up contamination of food and environment to the limit of 0.3. The first two to three biological half-lives after the last ingestion of contaminated food are up to ten-times shorter than those at stabilized state

  18. Ion-exchange properties of cesium and strontium into zeolites from sodium salt solutions

    International Nuclear Information System (INIS)

    Kanno, Takuji; Hashimoto, Hiroyuki; Ohtani, Tozo.

    1978-01-01

    The ion-exchange properties of cesium and strontium into zeolite from sodium salt solution has been studied in zeolite A, zeolite X, zeolite Y, mordenite and clinoptilolite. The distribution of cesium into mordenite from about 1 -- 2 M sodium chloride and sodium hydroxide solutions is considerably larger than that into zeolite A. The distribution coefficient for 2 M solution of sodium salts was about 300. Therefore, the separation of cesium from sodium salt solution is possible by using mordenite. The distribution of strontium into zeolites form 1 -- 2 M solutions of sodium chloride and sodium nitrate were in the order of zeolite A>zeolite X>zeolite Y asymptoticaly equals mordenite. The distribution coefficient of 230 was obtained for 1 M solutions of sodium salts. The anion in solutions had no effect on the distribution of cesium and strontium into zeolite from sodium salt solution. (author)

  19. Validation and Application of Concentrated Cesium Eluate Physical Property Models

    International Nuclear Information System (INIS)

    Choi, A.S.

    2004-01-01

    This work contained two objectives. To verify the mathematical equations developed for the physical properties of concentrated cesium eluate solutions against experimental test results obtained with simulated feeds. To estimate the physical properties of the radioactive AW-101 cesium eluate at saturation using the validated models. The Hanford River Protection Project (RPP) Hanford Waste Treatment and Immobilization Plant (WTP) is currently being built to extract radioisotopes from the vast inventory of Hanford tank wastes and immobilize them in a silicate glass matrix for eventual disposal at a geological repository. The baseline flowsheet for the pretreatment of supernatant liquid wastes includes removal of cesium using regenerative ion-exchange resins. The loaded cesium ion-exchange columns will be eluted with nitric acid nominally at 0.5 molar, and the resulting eluate solution will be concentrated in a forced-convection evaporator to reduce the storage volume and to recover the acid for reuse. The reboiler pot is initially charged with a concentrated nitric acid solution and kept under a controlled vacuum during feeding so the pot contents would boil at 50 degrees Celsius. The liquid level in the pot is maintained constant by controlling both the feed and boilup rates. The feeding will continue with no bottom removal until the solution in the pot reaches the target endpoint of 80 per cent saturation with respect to any one of the major salt species present

  20. Kinetics of 137cesium in cerebral structures and blood

    International Nuclear Information System (INIS)

    Ribas, B.; Gonzalez, M.D.; Rio, J. del; Reus, M.I.S.; Gonzalez-Baron, M.

    1987-01-01

    The old clinical use of cesium in epilepsy expresses a relation of this metal with the central nervous system. Two groups of male Wistar rats of 200 g were administered single doses of 50μCi intravenously for blood kinetics and 2μCi 137 CsCl in each lateral ventricle of the brain for the kinetics in the cerebral structures, respectively. In both cases under ether anesthesia. Blood samples of IV gouts were weighed, and cerebral structure hypothalamus, hypocampus, striatum, cortex, cerebellum, mesencephalon and medulla oblongata dissected, cleaned, washed, dried, weighed, and in both cases cpm of the samples evaluated submitting it to the gamma radiations detector. In both experimental values of the 137 CsCl kinetics are expressed and applying the retroprojection method; parameters and constants are obtained. tsub(1/2) alpha = 0.0358 h and tsub(1/2) beta = 6.7159 h. In tables the equations of the alpha and beta phases are expressed. In blood after the rapid diminution of the radioactivity in the first 5 min the equilibrium phase is reached in 30 min afterwards, and the values remain almost the same 4 h after the injection and cesium is slowly eliminated by the rat. Cerebral structures after its intracerebroventricular application show that cesium has a great uptake velocity, it is rapidly incorporated by hypothalamus and after by cortex, hypocampus, striatum, mesencephalon and medulla oblongata, the two last showing the slower incorporation. After 24 h the cesium radioactivity declines slowly and progressively. (author)

  1. 9 CFR 3.141 - Terminal facilities.

    Science.gov (United States)

    2010-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.141 Section 3.141 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  2. 40 CFR 141.704 - Analytical methods.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.704 Section... Monitoring Requirements § 141.704 Analytical methods. (a) Cryptosporidium. Systems must analyze for Cryptosporidium using Method 1623: Cryptosporidium and Giardia in Water by Filtration/IMS/FA, 2005, United States...

  3. 17 CFR 141.8 - Procedures for salary offset.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Procedures for salary offset. 141.8 Section 141.8 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION SALARY OFFSET § 141.8 Procedures for salary offset. (a) Deductions to liquidate an employee's debt will be by...

  4. 20 CFR 1001.141 - Functions of DVOP staff.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Functions of DVOP staff. 1001.141 Section 1001.141 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING... Veterans Outreach Program (DVOP) § 1001.141 Functions of DVOP staff. Each DVOP specialist shall carry out...

  5. Release and transport of fission product cesium in the TMI-2 accident

    International Nuclear Information System (INIS)

    Lorenz, R.A.; Collins, J.L.

    1986-01-01

    Approximately 50% of the fission product cesium was released from the overheated UO 2 fuel in the TMI-2 accident. Steam that boiled away from a water pool in the bottom of the reactor vessel transported the released fission products throughout the reactor coolant system (RCS). Some fission products passed directly through a leaking valve with steam and water into the containment structure, but most deposited on dry surfaces inside of the RCS before being dissolved or resuspended when the RCS was refilled with water. A cesium transport model was developed that extended measured cesium in the RCS back to the first day of the accident. The model revealed that ∼62% of the released 137 Cs deposited on dry surfaces inside of the RCS before being slowly leached and transported out of the RCS in leaked or letdown water. The leach rates from the model agreed reasonably well with those measured in the laboratory. The chemical behavior of cesium in the TMI-2 accident agreed with that observed in fission product release tests at Oak Ridge National Laboratory (ORNL)

  6. Studies on synthesis of some composites and their uses for cesium separation

    International Nuclear Information System (INIS)

    Someda, H.H.; El-Zahhar, A.A.; Shehata, M.K.K.; El-Naggar, H.A.

    2002-01-01

    In this study some composite sorbents were prepared by supporting hexacyanoferrate complexes of some transition metals like Co, Ni, Fe and Zn on some different solid supports e.g. cellulose and other natural materials as wood powder. These composites were used for cesium sorption and showed that the highest sorption capacity is for zinc composite and the lowest is for cobalt composite. Also the factors affecting the sorption capacity like acid concentration, competing ions and cesium ion concentration were studied. The release of the sorbed cesium from the composite materials was also studied under different concentrations of different solutions like sodium nitrate, silver nitrate, ammonium nitrate and a mixture of ammonium nitrate and silver nitrate solutions

  7. Use of cesium-137 methodology in the evaluation of superficial erosive processes

    International Nuclear Information System (INIS)

    Andrello, Avacir Casanova; Appoloni, Carlos Roberto; Guimaraes, Maria de Fatima; Nascimento Filho, Virgilio Franco do

    2003-01-01

    Superficial erosion is one of the main soil degradation agents and erosion rates estimations for different edaphic climate conditions for the conventional models, as USLE and RUSLE, are expensive and time-consuming. The use of cesium- 137 anthropogenic radionuclide is a new methodology that has been much studied and its application in the erosion soil evaluation has grown in countries as USA, UK, Australia and others. A brief narration of this methodology is being presented, as the development of the equations utilized for the erosion rates quantification through the cesium- 137 measurements. Two watersheds studied in Brazil have shown that the cesium- 137 methodology was practicable and coherent with the survey in field for applications in erosion studies. (author)

  8. Distribution of plutonium and cesium in alluvial soils of the Los Alamos environs

    International Nuclear Information System (INIS)

    Nyhan, J.W.; Miera, F.R. Jr.; Peters, R.J.

    1976-01-01

    The alluvial soils of three liquid waste disposal areas at Los Alamos were sampled to determine plutonium and cesium distributional relationships and correlations with soil physical-chemical properties. Radionuclide concentrations were determined for soil samples as a function of soil depth and distance from the waste outfall. The cesium-plutonium data were correlated with levels of organic carbon, carbonates, exchangeable and water-soluble cations, pH, cation exchange capacity, bulk density, surface area and geometric particle size of these soils. The distribution patterns of soil plutonium and cesium were also compared to the waste use history of the three study areas

  9. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    Directory of Open Access Journals (Sweden)

    Houssni El-Saied

    2013-01-01

    Full Text Available In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+ on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the kaolin. Paper handsheets were prepared containing various percentages of the modified kaolin. The mechanical and optical properties of paper handsheets were studied. The prepared paper handsheets were irradiated by gamma irradiation using different doses. Fourier transform infrared (FTIR spectroscopy was used to study the effect of kaolin modification by cesium and gamma irradiation on paper handsheets properties. The results indicated that modified kaolin enhanced the mechanical and optical properties of paper handsheets. Electron spin resonance (ESR spectroscopy and laser-induced breakdown spectroscopy (LIBS were also used. They provided rapid, sensitive and nondestructive techniques in differentiating between different questioned documents. This study presents a new concept in manufacturing security papers and anticounterfeiting applications.

  10. Adsorption of iodine and cesium onto some cement materials

    Energy Technology Data Exchange (ETDEWEB)

    Mine, Tatsuya [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan); Mihara, Morihiro; Ito, Masaru [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Kato, Hiroshige [IDC, Tokai, Ibaraki (Japan)

    1997-06-01

    Cement materials, being expected to be used in structural materials in underground disposals of radioactive wastes, may adsorb nuclides resulting in retardation of their migration in environment. In this report adsorption behaviors of cement pastes toward iodine (as anion) and cesium (as cation) were studied. Adsorption of iodine was remarkable for OPC and MHP pastes that are known to have high molar ratio CaO/SiO{sub 2}, partition coefficient being 100 ml/g for initial tracer concentration of 10{sup -5} mol/l. Partition coefficient for cesium for PFA paste was found to be 5 ml/g on average. (S. Ohno)

  11. Adsorption of iodine and cesium onto some cement materials

    International Nuclear Information System (INIS)

    Mine, Tatsuya; Mihara, Morihiro; Ito, Masaru

    1997-06-01

    Cement materials, being expected to be used in structural materials in underground disposals of radioactive wastes, may adsorb nuclides resulting in retardation of their migration in environment. In this report adsorption behaviors of cement pastes toward iodine (as anion) and cesium (as cation) were studied. Adsorption of iodine was remarkable for OPC and MHP pastes that are known to have high molar ratio CaO/SiO 2 , partition coefficient being 100 ml/g for initial tracer concentration of 10 -5 mol/l. Partition coefficient for cesium for PFA paste was found to be 5 ml/g on average. (S. Ohno)

  12. Efficiency of Dry (Psidium guava) Leaves for The Removal of Cesium-137 from Aqueous Solutions

    International Nuclear Information System (INIS)

    Omar, H.A.; Abu-Kharda, S.A.; Abd El -Baset, L.A.; Abu-Shohba, R.M.

    2012-01-01

    Batch experiments for the removal of cesium-137 from aqueous solution onto guava leaves (psidium guava) and carbonized guava leaves were studied as a function of contact time, dosage, ph value and initial concentration ion. The sorption process was described by pseudo first-order, pseudo second-order, Morris and Elovich kinetic models. Cesium concentrations were ranged between 2x10 -5 - 1x10 -3 M. Sorption data have been interpreted in terms of Langmuir, Freundlich and Dubinin-Radushkevich isotherms. The maximum sorption capacity of carbonized guava leaves adsorbent for cesium removal was 8.02 mgg -1 . The results of the present study suggest that carbonized guava leaves can be used beneficially for cesium removal from aqueous solution.

  13. Caustic-Side Solvent Extraction: Prediction of Cesium Extraction from Actual Wastes and Actual Waste Simulants

    International Nuclear Information System (INIS)

    Delmau, L.H.; Haverlock, T.J.; Sloop, F.V. Jr.; Moyer, B.A.

    2003-01-01

    This report presents the work that followed the CSSX model development completed in FY2002. The developed cesium and potassium extraction model was based on extraction data obtained from simple aqueous media. It was tested to ensure the validity of the prediction for the cesium extraction from actual waste. Compositions of the actual tank waste were obtained from the Savannah River Site personnel and were used to prepare defined simulants and to predict cesium distribution ratios using the model. It was therefore possible to compare the cesium distribution ratios obtained from the actual waste, the simulant, and the predicted values. It was determined that the predicted values agree with the measured values for the simulants. Predicted values also agreed, with three exceptions, with measured values for the tank wastes. Discrepancies were attributed in part to the uncertainty in the cation/anion balance in the actual waste composition, but likely more so to the uncertainty in the potassium concentration in the waste, given the demonstrated large competing effect of this metal on cesium extraction. It was demonstrated that the upper limit for the potassium concentration in the feed ought to not exceed 0.05 M in order to maintain suitable cesium distribution ratios

  14. 19 CFR 141.41 - Surety on Customs bonds.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Surety on Customs bonds. 141.41 Section 141.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.41 Surety on Customs bonds. Powers of...

  15. 25 CFR 141.55 - Price monitoring and control.

    Science.gov (United States)

    2010-04-01

    ... be made a survey of the prices of flour, sugar, fresh eggs, lard, coffee, ground beef, bread, cheese... 25 Indians 1 2010-04-01 2010-04-01 false Price monitoring and control. 141.55 Section 141.55... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.55 Price...

  16. Multiphoton ionization of atomic cesium

    International Nuclear Information System (INIS)

    Compton, R.N.; Klots, C.E.; Stockdale, J.A.D.; Cooper, C.D.

    1984-01-01

    We describe experimental studies of resonantly enhanced multi-photon ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photo-electron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photo-ionization signal. For both ns and np states the ''field induced'' MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength

  17. Strontium-90 and cesium-137 in freshwater (from September, 1982, to December, 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in fresh water measured at 4 locations across Japan from September to December, 1982, are given in pCi/l, respectively. The methods of the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, and the counting are also described. The sample was passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The sample solution prepared was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitate was counted for activity using a low background beta counter normally for 60 min. The radioactivity ranged 0.08 to 0.22 pCi/l for Sr-90 and 0.003 to 0.020 pCi/l for Cs-137 in the freshwater. (J.P.N.)

  18. Metabolism of {sup 137}cesium, {sup 137}barium in the rat. Therapeutics of the contamination; Metabolisme du {sup 137}cesium, {sup 137}baryum chez le rat. Therapeutique de la contamination

    Energy Technology Data Exchange (ETDEWEB)

    Remy, J; Philippon, A; Lafuma, J; Walter, C [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie

    1967-07-01

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of {sup 137}Cs - {sup 137}Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [French] Les auteurs etudient experimentalement la cinetique de distribution, le metabolisme et l

  19. Metabolism of {sup 137}cesium, {sup 137}barium in the rat. Therapeutics of the contamination; Metabolisme du {sup 137}cesium, {sup 137}baryum chez le rat. Therapeutique de la contamination

    Energy Technology Data Exchange (ETDEWEB)

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie

    1967-07-01

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of {sup 137}Cs - {sup 137}Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [French] Les auteurs etudient experimentalement la cinetique de distribution, le metabolisme et l

  20. Therapeutic effects of cesium-137 radiation in head and neck malignancy

    International Nuclear Information System (INIS)

    Lee, J.W.

    1978-01-01

    In radiation therapy, many fundamental physical and biological facts and theories must be applied in order to establish a scientific level of practice. There is a voluminous amount of information pertaining to these matters. Cesium-137 is a radioactive nuclide available as a fission product from nuclear reactions. Cesium-137 emits gamma rays at 0.663 MeV. Its half life of about 30 years is an advantage over that of cobalt-60, but cesium-137 is lower, and the specific activity is much less. Author has clinically observed of 150 cases of cesium-137 therapy on head and neck malignancies from Jan. 1971 to Oct. 1978. The following results were observed: 1) Age distribution showed predilection in fifth and decades and sex ratio revealed higher in male than female about 4 times. 2) Laryngeal cancer (34%) maxillary cancer (20.7%) and tongue cancer (12%) occupied high incidence in classification of disease. 3) The cases of radiation only therapeutic group (5000-7000 rad) revealed 61 cases (41.2%) and pre and post operative radiation group (1000-3000 rad) revealed 36 cases (24.3%). 4) In combined therapy (60 cases) arterial infusion group revealed 29 cases and 10 cases of operative group, 11 cases of well prognostic group respectively. (author)

  1. Immobilisation of radio cesium loaded ammonium molybdo phosphate in glass matrices

    International Nuclear Information System (INIS)

    Yalmali, Vrunda S.; Singh, I.J.; Sathi Sasidharan, N.; Deshingkar, D.S.

    2004-11-01

    Long half life and easy availability from high level wastes make 137 Cesium most economical radiation source. High level liquid waste processing for 137 Cesium removal has become easier due to development of Cesium specific granulated ammonium molybdophosphate (AMP) composite. In such applications, resulting spent composite AMP itself represents high active solid waste and immobilization of these materials in cement may not be acceptable. Studies on immobilization of 137 Cs loaded AMP were taken up in order to achieve twin goals of increasing safety and minimizing processing costs of the final matrix. Studies indicated that phosphate modified sodium borosilicate SPNM glasses prepared under usual oxidizing conditions are not suitable for immobilization of 137 Cs loaded on AMP .Phosphate glasses containing Na 2 O, P 2 O 5 , B 2 O 3 , Fe 2 O 3 , Al 2 O 3 and SiO 2 as major constituents are capable of incorporating 6 to 8 % AMP. The Normalized Leach rates of these glasses for sodium, cesium, boron and silica are 10 -4 to 10 -6 gm/cm 2 /day which are comparable to or better than those reported for NBS glasses incorporating HLW. Homogeneity of the final matrix was confirmed by x-ray diffraction analysis. Further studies on characterization of these glasses would establish their acceptability. (author)

  2. Strontium-90 and cesium-137 in freshwater from May 1984

    International Nuclear Information System (INIS)

    1984-01-01

    Strontium-90 and cesium-137 in freshwater measured in May 1984 are given in pCi/l. The sampling point is 1, Kasumigaura-Lake (Ibaraki). Collection and pretreatment of samples, preparation of samples for analysis, separation of strontium-90 and cesium-137, determination of stable strontium, calcium and potassium, and counting are described. The sample was passed through a cation exchange column. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 minutes. (Mori, K.)

  3. 40 CFR 141.621 - Routine monitoring.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Routine monitoring. 141.621 Section....621 Routine monitoring. (a) Monitoring. (1) If you submitted an IDSE report, you must begin monitoring..., you must monitor at the location(s) and dates identified in your monitoring plan in § 141.132(f...

  4. Modeling approach to various time and spatial scale environmental issues in Fukushima. Related to radioactive cesium migration in aquatic systems

    International Nuclear Information System (INIS)

    Kurikami, Hiroshi; Kitamura, Akihiro; Yamada, Susumu; Machida, Masahiko

    2015-01-01

    Several numerical models have been prepared to deal with various time- and spatial-scale issues related to radioactive cesium migration in environment in Fukushima area. The SACT (Soil and Cesium Transport) model developed by the Japan Atomic Energy Agency (JAEA) predicts middle- to long-term evolution of radioactive cesium distribution due to soil erosion, subsequent sediment transport and deposition, and radioactive cesium migration based on the Universal Soil Loss Equation (USLE). The TODAM (Time-dependent One-dimensional Degradation and Migration) model, iRIC/Nays2D and the FLESCOT (Flow, Energy, Salinity, Sediment, Contaminant Transport) model are one-, two- and three-dimensional river/reservoir/coastal models, respectively. Based on conservation equations of sediment and radioactive cesium, they treat advection and diffusion of suspended sediment and cesium, deposition of sediment to bed, re-suspension from bed and adsorption/desorption of radioactive cesium. These models are suitable for small and short time scale issues such as high discharges of sediment and radioactive cesium from rivers due to heavy rainfall events. This paper describes fragments of the JAEA’s approaches of modeling to deal with the issues corresponding to radioactive cesium migration in environment with some case studies. (author)

  5. Test procedures and instructions for single shell tank saltcake cesium removal with crystalline silicotitanate

    Energy Technology Data Exchange (ETDEWEB)

    Duncan, J.B.

    1997-01-07

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Single Shell Tank Saltcake from tanks 24 t -BY- I 10, 24 1 -U- 108, 24 1 -U- 109, 24 1 -A- I 0 1, and 24 t - S-102, in a bench-scale column. The cesium sorbent to be tested is crystalline siticotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-024, Hanford Single Shell Tank Saltcake Cesium Removal Test Plan.

  6. Decorporation of mixture of strontium and cesium isotopes with domestic mineral waters

    International Nuclear Information System (INIS)

    Slavov, S.; Filev, G.; Kiradzhiev, G.

    1990-01-01

    The possibilities of Bulgarian mineral waters to decorporate mixtures of strontium and cesium radioisotopes, simultaneous entering the body, were studied. A modified effect in respect to radioactive strontium was found. Modification of the effect of mixing two diferent types of mineral waters was not proven. No effect was found of potassium-containing mineral water on radioactive cesium kinetics. 1 tab., 7 refs

  7. Decontamination of Radioactive Cesium Released from Fukushima Daiichi Nuclear Power Plant - 13277

    Energy Technology Data Exchange (ETDEWEB)

    Parajuli, Durga; Minami, Kimitaka; Tanaka, Hisashi; Kawamoto, Tohru [Nanosystem Research Institute, National Institute of Advanced Industrial Science and Technology - AIST (Japan)

    2013-07-01

    Peculiar binding of Cesium to the soil clay minerals remained the major obstacle for the immediate Cs-decontamination of soil and materials containing clay minerals like sludge. Experiments for the removal of Cesium from soil and ash samples from different materials were performed in the lab scale. For soil and sludge ash formed by the incineration of municipal sewage sludge, acid treatment at high temperature is effective while washing with water removed Cesium from ashes of plants or burnable garbage. Though total removal seems a difficult task, water-washing of wood-ash or garbage-ash at 40 deg. C removes >90% radiocesium, while >60% activity can be removed from soil and sludge-ash by acid washing at 95 deg. C. (authors)

  8. Cesium injection system for negative ion duoplasmatrons

    International Nuclear Information System (INIS)

    Kobayashi, M.; Prelec, K.; Sluyters, T.J.

    1978-01-01

    A design for admitting cesium vapor into a hollow hydrogen plasma discharge in a duoplasmatron ion source for the purpose of increasing the negative hydrogen ion output current is described. 60 mA beam currents for negative hydrogen ions are reported

  9. Efficient electron injection from solution-processed cesium stearate interlayers in organic light-emitting diodes

    NARCIS (Netherlands)

    Wetzelaer, G. A. H.; Najafi, A.; Kist, R. J. P.; Kuik, M.; Blom, P. W. M.

    2013-01-01

    The electron-injection capability of solution-processed cesium stearate films in organic light-emitting diodes is investigated. Cesium stearate, which is expected to exhibit good solubility and film formation due to its long hydrocarbon chain, is synthesized using a straightforward procedure.

  10. Detection of the actinides and cesium from environmental samples

    Science.gov (United States)

    Snow, Mathew Spencer

    Detection of the actinides and cesium in the environment is important for a variety of applications ranging from environmental remediation to safeguards and nuclear forensics. The utilization of multiple different elemental concentrations and isotopic ratios together can significantly improve the ability to attribute contamination to a unique source term and/or generation process; however, the utilization of multiple elemental "signatures" together from environmental samples requires knowledge of the impact of chemical fractionation for various elements under a variety of environmental conditions (including predominantly aqueous versus arid conditions). The research reported in this dissertation focuses on three major areas: 1. Improving the understanding of actinide-mineral interactions at ultra-low concentrations. Chapter 2 reports a batch sorption and modeling study of Np(V) sorption to the mineral goethite from attomolar to micromolar concentrations. 2. Improving the detection capabilities for Thermal Ionization Mass Spectrometry (TIMS) analyses of ultra-trace cesium from environmental samples. Chapter 4 reports a new method which significantly improves the chemical yields, purification, sample processing time, and ultimately, the detection limits for TIMS analyses of femtogram quantities of cesium from a variety of environmental sample matrices. 3. Demonstrating how actinide and cesium concentrations and isotopic ratios from environmental samples can be utilized together to determine a wealth of information including environmental transport mechanisms (e.g. aqueous versus arid transport) and information on the processes which generated the original material. Chapters1, 3 and 5 demonstrate these principles using Pu, Am, Np, and Cs concentrations and isotopic ratios from contaminated soils taken near the Subsurface Disposal Area (SDA) of Idaho National Laboratory (INL) (a low level radioactive waste disposal site in southeastern Idaho).

  11. High spin states of 141Pm

    Science.gov (United States)

    Bhattacharyya, Sarmishtha; Chanda, Somen; Bhattacharjee, Tumpa; Basu, Swapan Kumar; Bhowmik, R. K.; Muralithar, S.; Singh, R. P.; Ghugre, S. S.

    2004-01-01

    The high spin states in the N=80 odd- A141Pm nucleus have been investigated by in-beam γ-spectroscopic techniques following the reaction 133Cs( 12C, 4n) 141Pm at E=65 MeV using a modest γ detector array, consisting of seven Compton-suppressed high purity germanium detectors and a multiplicity ball of 14 bismuth germanate elements. Thirty new γ rays have been assigned to 141Pm on the basis of γ-ray singles and γγ-coincidence data. The level scheme of 141Pm has been extended upto an excitation energy of 5.2 MeV and spin {35}/{2}ℏ and 16 new levels have been proposed. Spin-parity assignments for most of the newly proposed levels have been made on the basis of the deduced directional correlation orientation ratios for strong transitions. The meanlives of a few excited states have been determined from the pulsed beam- γγ coincidence data using the generalised centroid-shift method. The level structure is discussed in the light of known systematics of neighbouring N=80 isotonic nuclei.

  12. Preliminary Evaluation of Cesium Distribution for Wet Sieving Process Planned for Soil Decontamination in Japan - 13104

    Energy Technology Data Exchange (ETDEWEB)

    Enokida, Y.; Tanada, Y.; Hirabayashi, D. [Graduate School of Engineering, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan); Sawada, K. [EcoTopia Science Institute, Nagoya University, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan)

    2013-07-01

    For the purpose of decontaminating radioactive cesium from a huge amount of soil, which has been estimated to be 1.2x10{sup 8} m{sup 3} by excavating to a 5-cm depth from the surface of Fukushima Prefecture where a severe nuclear accident occurred at TEPCO's power generating site and has emitted a significant amount of radioactive materials, mainly radioactive cesium, a wet sieving process was selected as one of effective methods available in Japan. Some private companies have demonstrated this process for soil treatment in the Fukushima area by testing at their plants. The results were very promising, and a full-fledged application is expected to follow. In the present study, we spiked several aqueous samples containing soil collected from an industrial wet sieving plant located near our university for the recycling of construction wastes with non-radioactive cesium hydroxide. The present study provides scientific data concerning the effectiveness in volume reduction of the contaminated soil by a wet sieving process as well as the cesium distribution between the liquid phase and clay minerals for each sub-process of the full-scale one, but a simulating plant equipped with a process of coagulating sedimentation and operational safety fundamentals for the plant. Especially for the latter aspect, the study showed that clay minerals of submicron size strongly bind a high content of cesium, which was only slightly removed by coagulation with natural sedimentation (1 G) nor centrifugal sedimentation (3,700 G) and some of the cesium may be transferred to the effluent or recycled water. By applying ultracentrifugation (257,000 G), most of submicron clay minerals containing cesium was removed, and the cesium amount which might be transferred to the effluent or recycled water, could be reduced to less than 2.3 % of the original design by the addition of a cesium barrier consisting of ultracentrifugation or a hollow fiber membrane. (authors)

  13. LFCM [liquid-fed eramic melter] emission and off-gas system performance for feed component cesium

    International Nuclear Information System (INIS)

    Goles, R.W.; Andersen, C.M.

    1986-09-01

    Except for volatile off-gas effluents, overall adequacy of the liquid-fed ceramic melter (LFCM) system depends most upon its effectiveness in dealing with cesium. However, the mechanism responsible for melter cesium losses has proved insensitive to many LFCM operating and processing conditions. As a result, variations in inleakage, plenum temperature, feeding rate and waste loading do not significantly influence melter cesium performance. Feed composition, specifically halogen content, is the only processing variable that has had a significant effect. Due to the submicron nature of LFCM-generated aerosols, melter disengagement design features are not expected to be particularly effective in reducing cesium emission rates. For the same reason, the cesium performance of conventional quench scrubbers is quite low, being dependent only upon the magnitude of melter entrainment losses. Although a deep bed washable filter has been effective in removing submicron aerosols from the process exhaust, high performance has only been achieved under dry operating conditions. The melter's idling state does not appear to place additional demands upon the off-gas treatment system

  14. Measurement of cesium and mercury emissions from the vitrification of simulated high level radioactive waste

    International Nuclear Information System (INIS)

    Zamecnik, J.R.

    1992-01-01

    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to measure non-radioactive cesium in the offgas system from the glass melter. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICP-MS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. In addition, total particulate measurements were also made. Measurements of mercury decontamination factors were made on the same equipment; the results indicate that most of the mercury in the offgas system probably exists as elemental mercury and HgCl 2 , with some HgO and Hg 2 Cl 2 . The decontamination factors determined for cesium, total particulate, and mercury all compared favorably with the design values

  15. A preliminary deposit model for lithium-cesium-tantalum (LCT) pegmatites

    Science.gov (United States)

    Bradley, Dwight; McCauley, Andrew

    2013-01-01

    This report is part of an effort by the U.S. Geological Survey to update existing mineral deposit models and to develop new ones. We emphasize practical aspects of pegmatite geology that might directly or indirectly help in exploration for lithium-cesium-tantalum (LCT) pegmatites, or for assessing regions for pegmatite-related mineral resource potential. These deposits are an important link in the world’s supply chain of rare and strategic elements, accounting for about one-third of world lithium production, most of the tantalum, and all of the cesium.

  16. Knudsen cell--mass spectrometer studies of cesium--urania interactions

    International Nuclear Information System (INIS)

    Collins, J.L.; Osborne, M.F.; Malinauskas, A.P.; Lorenz, R.A.; Manning, S.R.

    1976-06-01

    Limited Knudsen cell--mass spectrometer studies were made of the partial pressures of cesium-containing species [assumed to be primarily Cs(g)] over Cs 2 CO 3 and over phase equilibria involving UO 2 and probable Cs-U-O compounds formed from mixtures that initially contained either Cs 2 CO 3 -UO 2 or CsOH-UO 2 . Although additional work is required to further define the equilibria involved, the data demonstrate unambiguously a significant reduction in cesium partial pressures due to probable Cs-U-O compound formation and indicate essentially identical behavior with either CsOH or Cs 2 CO 3 as the starting material with UO 2

  17. Cesium accumulation in native trees from the Brazilian Cerrado

    International Nuclear Information System (INIS)

    Franca, E.J.D.; Miranda, M.V.F.E.S.; Santos, T.O.; Cantinha, R.S.; Fernandes, E.A.D.N.

    2016-01-01

    Even considered not essential for plants, cesium may cycle within forest ecosystems. Taking into account the lack of knowledge on the distribution of this chemical element in Brazilian ecosystems, this work encompasses the unexpected cesium accumulation in native plant leaves from Cerradao, a Brazilian hotspot of world biodiversity. Some trees were Cs accumulators, achieving mass fractions in leaves 700 times higher (up to 12.7 mg kg -1 ) when compared to other Brazilian native tree leaves from the Atlantic Forest. In fact, such trace element accumulation in leaves was not previously noticed for Brazilian ecosystems despite the intra- and inter-species variability observed in Cerrado tree leaves. (author)

  18. Next Generation Extractants for Cesium Separation from High-Level Waste: From Fundamental Concepts to Site Implementation

    International Nuclear Information System (INIS)

    Moyer, Bruce A.; Bazelaire, Eve; Bonnesen, Peter V.; Bryan, Jeffrey C.; Delmau, Latitia H.; Engle, Nancy L.; Gorbunova, Maryna G.; Keever, Tamara J.; Levitskaia, Tatiana G.; Sachleben, Richard A.; Tomkins, Bruce A.; Bartsch, Richard A.

    2004-01-01

    General project objectives. This project seeks a fundamental understanding and major improvement in cesium separation from high-level waste by cesium-selective calixcrown extractants. Systems of particular interest involve novel solvent-extraction systems containing specific members of the calix[4]arene-crown-6 family, alcohol solvating agents, and alkylamines. Questions being addressed pertain to cesium binding strength, extraction selectivity, cesium stripping, and extractant solubility. Enhanced properties in this regard will specifically benefit cleanup projects funded by the USDOE Office of Environmental Management to treat and dispose of high-level radioactive wastes currently stored in underground tanks at the Savannah River Site (SRS), the Hanford site, and the Idaho National Environmental and Engineering Laboratory.1 The most direct beneficiary will be the SRS Salt Processing Project, which has recently identified the Caustic-Side Solvent Extraction (CSSX) process employing a calixcrown as its preferred technology for cesium removal from SRS high level tank waste.2 This technology owes its development in part to fundamental results obtained in this program

  19. Next Generation Extractants for Cesium Separation from High-Level Waste: From Fundamental Concepts to Site Implementation

    International Nuclear Information System (INIS)

    Moyer, Bruce A; Bazelaire, Eve; Bonnesen, Peter V.; Bryan, Jeffrey C.; Delmau, Laetitia H.; Engle, Nancy L.; Gorbunova, Maryna G.; Keever, Tamara J.; Levitskaia, Tatiana G.; Sachleben, Richard A.; Tomkins, Bruce A.; Bartsch, Richard A.; Talanov, Vladimir S.; Gibson, Harry W.; Jones, Jason W.; Hay, Benjamin P.

    2003-01-01

    This project seeks a fundamental understanding and major improvement in cesium separation from high-level waste by cesium-selective calixcrown extractants. Systems of particular interest involve novel solvent-extraction systems containing specific members of the calix[4]arene-crown-6 family, alcohol solvating agents, and alkylamines. Questions being addressed pertain to cesium binding strength, extraction selectivity, cesium stripping, and extractant solubility. Enhanced properties in this regard will specifically benefit cleanup projects funded by the USDOE Office of Environmental Management to treat and dispose of high-level radioactive wastes currently stored in underground tanks at the Savannah River Site (SRS), the Hanford site, and the Idaho National Environmental and Engineering Laboratory.1 The most direct beneficiary will be the SRS Salt Processing Project, which has recently identified the Caustic-Side Solvent Extraction (CSSX) process employing a calixcrown as its preferred technology for cesium removal from SRS high-level tank waste.2 This technology owes its development in part to fundamental results obtained in this program

  20. Effect of Cesium and Xenon Seeding in Negative Hydrogen Ion Sources

    International Nuclear Information System (INIS)

    Bacal, M.; Brunteau, A.M.; Deniset, C.; Elizarov, L.I.; Sube, F.; Tontegode, A.Y.; Whealton, J.H.

    1999-01-01

    It is well known that cesium seeding in volume hydrogen negative ion sources leads to a large reduction of the extracted electron current and in some cases to the enhancement of the negative ion current. The cooling of the electrons due to the addition of this heavy impurity was proposed as a possible cause of the mentioned observations. In order to verify this assumption, the authors seeded the hydrogen plasma with xenon, which has an atomic weight almost equal to that of cesium. The plasma properties were studied in the extraction region of the negative ion source Camembert III using a cylindrical electrostatic probe while the negative ion relative density was studied using laser photodetachment. It is shown that the xenon mixing does not enhance the negative ion density and leads to the increase of the electron density, while the cesium seeding reduces the electron density

  1. Reduction of cesium levels in the diet through management of food

    International Nuclear Information System (INIS)

    Gerzabek, M.H.

    1990-01-01

    Several processes influence the radionuclide concentration of food products during processing: dilution, losses, concentration. Boiling of leaf vegetables yields a decontamination effect of up to 80% in the case of radioiodine. Peeling of potato tubers results in a reduction of the cesium concentration of 30%. The cesium and strontium concentration of flour is a factor of two lower as compared to the corresponding cereal grain due to the milling process. Significant discrimination occurs during the milk processing. The skimmed milk is significantly richer in cesium, iodine and especially in strontium than the cream. It follows that butter is depleted in its radionuclide contents as compared to other milk produce. Strontium is concentrated in the casein. Pressurized cooking in combination with salting or a treatment with acetic acid results in an Cs-activity loss of beef, veal and lamb meat of 50 to 90%. (Author) 3 figs., 7 tabs., 13 refs

  2. Cesium-137

    International Nuclear Information System (INIS)

    Ammerich, Marc; Frot, Patricia; Gambini, Denis-Jean; Gauron, Christine; Moureaux, Patrick; Herbelet, Gilbert; Lahaye, Thierry; Pihet, Pascal; Rannou, Alain

    2014-06-01

    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  3. Progress toward Brazilian cesium fountain second generation

    Science.gov (United States)

    Bueno, Caio; Rodriguez Salas, Andrés; Torres Müller, Stella; Bagnato, Vanderlei Salvador; Varela Magalhães, Daniel

    2018-03-01

    The operation of a Cesium fountain primary frequency standard is strongly influenced by the characteristics of two important subsystems. The first is a stable frequency reference and the second is the frequency-transfer system. A stable standard frequency reference is key factor for experiments that require high accuracy and precision. The frequency stability of this reference has a significant impact on the procedures for evaluating certain systematic biases in frequency standards. This paper presents the second generation of the Brazilian Cesium Fountain (Br-CsF) through the opto-mechanical assembly and vacuum chamber to trap atoms. We used a squared section glass profile to build the region where the atoms are trapped and colled by magneto-optical technique. The opto-mechanical system was reduced to increase stability and robustness. This newest Atomic Fountain is essential to contribute with time and frequency development in metrology systems.

  4. Diffusion of cesium in sodium-borosilicate glasses for nuclear waste immobilisation. Diffusie van cesium in natrium borosilicaat glazen voor het immobiliseren van radioaktief afval

    Energy Technology Data Exchange (ETDEWEB)

    Janssen, F.J.J.G.; Sengers, E.G.F. (Keuring van Electrotechnische Materialen NV, Arnhem (Netherlands)); Waal, H. de (TPD-TNO-Glass technology, Eindhoven (Netherlands))

    1989-09-26

    Diffusion of cesium in borosilicate glass for high-level radioactive waste is discussed. For this purpose model glasses with non-radioactive elements are being made, in accordance with the specifications of the reprocessing plants, from which concentration couples are composed. A concentration couple consists of two cylinders of borosilicate glass which contain different amounts of cesium. After heat treatment the couples are studied by means of the scanning electron microscopy and X-ray microanalysis. The model study will provide a basis for predictions of the containment achieved over a longer period of time. (author). 11 refs.; 2 figs.; 2 tabs.

  5. Metabolism of 137cesium, 137barium in the rat. Therapeutics of the contamination

    International Nuclear Information System (INIS)

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C.

    1967-01-01

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of 137 Cs - 137 Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [fr

  6. Physical barrier effect of geopolymeric waste form on diffusivity of cesium and strontium.

    Science.gov (United States)

    Jang, J G; Park, S M; Lee, H K

    2016-11-15

    The present study investigates the physical barrier effect of geopolymeric waste form on leaching behavior of cesium and strontium. Fly ash-based geopolymers and slag-blended geopolymers were used as solidification agents. The leaching behavior of cesium and strontium from geopolymers was evaluated in accordance with ANSI/ANS-16.1. The diffusivity of cesium and strontium in a fly ash-based geopolymer was lower than that in Portland cement by a factor of 10(3) and 10(4), respectively, showing significantly improved immobilization performance. The leaching resistance of fly ash-based geopolymer was relatively constant regardless of the type of fly ash. The diffusivity of water-soluble cesium and strontium ions were highly correlated with the critical pore diameter of the binder. The critical pore diameter of the fly ash-based geopolymer was remarkably smaller than those of Portland cement and slag-blended geopolymer; consequently, its ability physically to retard the diffusion of nuclides (physical barrier effect) was superior. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Conductivity of cesium-seeded atmospheric pressure plasmas near thermal equilibrium

    Energy Technology Data Exchange (ETDEWEB)

    Harris, L. P.

    1963-04-15

    Measurements were made of the electric conductivities of gaseous mixtures formed by the addition of small fractions of cesium vapor to nitrogen, helium, neon, or argon. The mixtures studied were maintained near thermal equilibrium at temperatures in the 1500 to 2000 deg K range and a total pressure of 1 atm. The cesium vapor pressures ranged over two decades, from 0.1 to 10 torr. The apparatus consists, in essence, of two heated zones connected by a slow flow. The first zone is a low-temperature (200 to 400 deg C) oven where the body-gas flow picks up the cesium vapor. The second zone is a small electrically heated furnace (1250 to 1850 deg C) containing a diode test section. The principal measurements taken were the seeding temperature, furnace temperature, and voltages and currents in the test section. The results exhibit variations with temperature, seeding pressure, and gas species that correlate reasonably well with simple theory and values for electron collision frequencies and cross sections taken from the literature. (auth)

  8. Fabrication of stimuli-sensitive hydrogel for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Man; Bong, Sang Bum; Park, Chan Woo; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment.1 Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. 2 Various surface including road, roof, house, building were contaminated with Cs-137. These coating materials have some problems and limitation such as toxic component, and lack of reusability of materials related to the cost. Thus, a more cost-effective and environmental friendly coating materials is still desired. 3 In the present study, the stimuli-sensitive hydrogel were fabricated for the removal of radioactive Cs from solid surface. We describe the morphology, structure, and physical property of these stimuli sensitive hydrogel. In addition, their ability to eliminate cesium was also evaluated. The smart hydrogel coating materials showed an excellent morphology change from the liquid to film by addition of Ca ion. Therefore, the stimuli-sensitive hydrogel demonstrated good potential for the treatment of contaminated surface for the removal of radioactive cesium.

  9. Fabrication of stimuli-sensitive hydrogel for the removal of cesium

    International Nuclear Information System (INIS)

    Yang, Hee-Man; Bong, Sang Bum; Park, Chan Woo; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon

    2015-01-01

    The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment.1 Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. 2 Various surface including road, roof, house, building were contaminated with Cs-137. These coating materials have some problems and limitation such as toxic component, and lack of reusability of materials related to the cost. Thus, a more cost-effective and environmental friendly coating materials is still desired. 3 In the present study, the stimuli-sensitive hydrogel were fabricated for the removal of radioactive Cs from solid surface. We describe the morphology, structure, and physical property of these stimuli sensitive hydrogel. In addition, their ability to eliminate cesium was also evaluated. The smart hydrogel coating materials showed an excellent morphology change from the liquid to film by addition of Ca ion. Therefore, the stimuli-sensitive hydrogel demonstrated good potential for the treatment of contaminated surface for the removal of radioactive cesium

  10. Summary report on partitioning cesium from the Chinese high level liquid waste(HLLW) by calixcrown

    International Nuclear Information System (INIS)

    Wang Jianchen; Chen Jing

    2011-01-01

    The partitioning of Cesium from the HLLW with a higher-salts liquid from PUREX is a better choice for its further treatment or disposal. In this work, the progress of partitioning Cesium from the Chinese HLLW by 25,27-bis(2-propyloxy) calix[4]-26,28-crown-6(iPr-C[4]C-6) were introduced, including the synthesis method of calixcrown, selection of diluents, extraction properties, the radiolytic stability, cold test and hot test of cascade extraction for removing cesium from HLLW. (author)

  11. Utilization of cesium-137 environmental contamination from fallout in erosion and sedimentation studies

    International Nuclear Information System (INIS)

    Guimaraes, M.F. da; Pessenda, L.C.R.; Fernandes, E.A.N.; Freire, O.; Nascimento Filho, V.F. do; Ferraz, E.S.B.

    1988-01-01

    The radioactivity of cesium-137 from fallout in different soils profiles for erosion and sedimentation studies are described. The potential of this technique for hydrographic basin in Piracicaba/Sao Paulo is evaluated. Due to the existence of natural radionuclides in soil, with energy near to cesium-137, the soil samples are determined by a high-purity Ge detectors. (author)

  12. 40 CFR 141.42 - Special monitoring for corrosivity characteristics.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for corrosivity characteristics. 141.42 Section 141.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations and Prohibition on Lead Use § 141.42 Special monitoring for corrosivity characteristics. (a)-(c...

  13. Effect of Suez Canal Marine Sediment on Sorption of Cesium

    International Nuclear Information System (INIS)

    Hassan, H.B.

    2016-01-01

    Suez Canal is surrounded by navigation, industrial, agricultural activities and suffers from high rate of population growth that discharging waste into Suez Canal. The Suez Canal coastal waters are influenced by a complex variety of physical, geochemical and biological processes, which influence the behavior, transport and fate of containments released into the marine environment. Sorption of releasing containment such as cesium in Suez Canal water is investigated because of its toxic effect on the marine environment. The object of present study is to determine the effects some of physical and chemical characteristics of collected sediment samples from the three important locations on Suez Canal (Suez Bay, Bitter Lakes and El- Temsah Lake beaches) on sorption behavior of cesium by using batch experiment. Batch experiment was used to study the sorption of the cesium ion. The sorption process is dependent on mineral constituents of Suez Canal sediment and their characteristics. Analytical methods which included particle size and X-ray diffraction (XRD) analyses found that particle size of Suez Canal sediment samples is characterized by sand to fine sand and quartz is the main mineralogical species. Distribution coefficient (K d ) which represent geochemical processes and particle size of these sediment samples effect on the degree of cesium sorption to the sediment. Also (K d ) increase with increase cation exchangeable capacity (CEC). The Suez Canal sediment samples have low (K d ) values which effected by their physical and chemical properties. Sample (2) has highest distribution coefficient (K d ) between measured samples due to containing ratio 30% of fine sand and high ratio of organic matter.

  14. Electrically switched cesium ion exchange. FY 1997 annual report

    International Nuclear Information System (INIS)

    Lilga, M.A.; Orth, R.J.; Sukamto, J.P.H.

    1997-09-01

    This paper describes the Electrically Switched Ion Exchange (ESIX) separation technology being developed as an alternative to ion exchange for removing radionuclides from high-level waste. Progress in FY 1997 for specific applications of ESIX is also outlined. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution can be controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. Based on the ferrocyanide film capacity, stability, rate of uptake, and selectivity shown during performance testing, it appears possible to retain a consistent rate of removal and elute cesium into the same elution solution over several load/unload cycles. In batch experiments, metal hexacyanoferrate films showed high selectivities for cesium in concentrated sodium solutions. Cesium uptake was unaffected by Na/Cs molar ratios of up to 2 x 10 4 , and reached equilibrium within 18 hours. During engineering design tests using 60 pores per inch, high surface area nickel electrodes, nickel ferrocyanide films displayed continued durability. losing less than 20% of their capacity after 1500 load/unload cycles. Bench-scale flow system studies showed no change in capacity or performance of the ESIX films at a flow rate up to 13 BV/h, the maximum flow rate tested, and breakthrough curves further supported once-through waste processing. 9 refs., 24 figs

  15. Cesium relocation in mixed-oxide fuel pins resulting from increased temperature reirradiation

    International Nuclear Information System (INIS)

    Lawrence, L.A.; Woodley, R.E.; Weber, E.T.

    1976-06-01

    Mixed-oxide fuel pins from EBR-II test subassemblies PNL-3 and PNL-4 were reirradiated in the GETR to study effects of increased fuel and cladding temperatures on chemical and thermomechanical behavior. Radial and axial distributions of cesium were obtained using postirradiation nondestructive precision gamma-scanning techniques. Data presented relate to the dependence of cesium distribution and transport processes on temperature gradients which were altered after substantial steady-state operation

  16. Radioactive cesium removal from seawater using adsorptive fibers prepared by radiation-induced graft polymerization

    International Nuclear Information System (INIS)

    Goto, Shota; Kawai-Noma, Shigeko; Umeno, Daisuke; Saito, Kyoichi; Fujiwara, Kunio; Sugo, Takanobu; Kikuchi, Takahiro; Morimoto, Yasutomi

    2015-01-01

    The meltdown of three reactors of the TEPCO Fukushima Daiichi nuclear power station (NPS) caused by the Great East Japan Earthquake on March 11th 2011 resulted in the emission of radionuclides such as cesium-137 and strontium-90 to the environment. For example, radioactive cesium exceeding the legal discharge limit (90 Bq/L, 2×10 -13 M) was detected in the seawater of the seawater-intake area of the NPS at the end of September 2014. Adsorbents with a high selectivity for cesium ions over other alkali metal ions such as sodium and potassium ions are required for cesium removal from seawater because sodium and potassium ions dissolve respectively at much higher concentrations of 5×10 -1 and 1×10 -2 M than cesium ions (2×10 -9 M). In addition, the simple operations of the immersion in seawater and the recovery of the adsorbents from seawater are desirable at decontamination sites. We prepared a cobalt-ferrocyanide-impregnated fiber capable of specifically capturing cesium ions in seawater by radiation-induced graft polymerization and chemical modifications. First, a commercially available 6-nylon fiber was irradiated with γ-rays. Second, an epoxy-group-containing vinyl monomer, glycidyl methacrylate, was graft-polymerized onto the γ-ray-irradiated nylon fiber. Third, the epoxy ring of the grafted polymer chain was reacted with triethylenediamine to obtain an anion-exchange fiber. Fourth, ferrocyanide ions, [Fe(CN) 6 ] 4 - , were bound to the anion-exchange group of the polymer chains. Finally, the ferrocyanide-ion-bound-fiber was placed in contact with cobalt chloride to precipitate insoluble cobalt ferrocyanide onto the polymer chains. Insoluble cobalt ferrocyanide was immobilized at the periphery of the fiber. However, the impregnation structure remains unclear. Here, we clarified the structure of insoluble cobalt ferrocyanide impregnated onto the polymer chain grafted onto the fiber to ensure the chemical and physical stability of the adsorptive fiber in

  17. Retrospective radiation-hygienic assessment of cesium-137 intake with feeding in the organisms of the Altai Territory habitants

    International Nuclear Information System (INIS)

    Meshkov, N.A.; Val'tseva, E.A.

    2016-01-01

    Radioactive precipitations as the result of atmospheric nuclear tests on the Semipalatinsk test site turned to local soil contamination by cesium-137 on the territory of the Altai Territory and Gorny Altai. The distribution of long-lived radioisotopes, cesium-137 in particular, in the main food staffs for local population is investigated. The retrospective analysis of cesium-137 specific activity in food products produced on these territories is carried out. It is ascertained that cesium-137 in meat has the general contribution to intake with food into organisms of adult population [ru

  18. Local mat-forming cyanobacteria effectively facilitate decontamination of radioactive cesium in rice fields

    International Nuclear Information System (INIS)

    Yamamoto, Atsushi; Yoshida, Shigeru; Okumura, Hiroshi; Inagaki, Masayo; Yamanishi, Hirokuni; Ito, Tetsuo; Furukawa, Michio

    2015-01-01

    The most effective and widespread method to decontaminate radioactive cesium from the Fukushima Daiichi Nuclear Power Plant Disaster was peeling topsoil. But the method had problems, such as large amounts of discarded soil and large-scale work. In nature, cyanobacteria formed biomats on the ground surface and facilitated peeling topsoil when the biomats dried. The cyanobacteria-facilitating peeling decontamination method utilized these cyanobacterial properties. Cyanobacteria are located all over Japan and 'local' cyanobacteria could be used for decontamination without introducing new species. Utilizing cyanobacteria could decrease the amount of discarded soil to about 30% and downsize the execution-scale to individual locations. Cyanobacterial biomats were easily cultivated, especially in rice fields, by maintaining wet conditions and exposure to 100 - 83% solar radiation. Shading by a thin net was helpful in maintaining an environment suitable for cyanobacteria. Nowadays, to prevent uptake of radioactive cesium into rice, K + is usually added to fertilizer in rice fields. The K + fertilization in rice fields might also enhance cyanobacterial capture of radioactive cesium, because high concentrations of K + enhanced cyanobacterial uptake of Cs + . Cyanobacteria could also mitigate the risk of radioactive cesium moving away from a decontaminating rice field. Therefore, the cyanobacteria-facilitating peeling decontamination method was proposed as an easy and safe 'D.I.Y.' method for both farmers and the environment. Besides, plowing rice fields with water before peeling improved the efficiency of this method, because plowing increased the radioactive cesium concentration in the topsoil. (author)

  19. Development program for magnetically assisted chemical separation: Evaluation of cesium removal from Hanford tank supernatant

    International Nuclear Information System (INIS)

    Nunez, L.; Buchholz, B.A.; Ziemer, M.; Dyrkacz, G.; Kaminski, M.; Vandegrift, G.F.; Atkins, K.J.; Bos, F.M.; Elder, G.R.; Swift, C.A.

    1994-12-01

    Magnetic particles (MAG*SEP SM ) coated with various absorbents were evaluated for the separation and recovery of low concentrations of cesium from nuclear waste solutions. The MAG*SEP SM particles were coated with (1) clinoptilolite, (2) transylvanian volcanic tuff, (3) resorcinol formaldehyde, and (4) crystalline silico-titanate, and then were contacted with a Hanford supernatant simulant. Particles coated with the crystalline silico-titanate were identified by Bradtec as having the highest capacity for cesium removal under the conditions tested (variation of pH, ionic strength, cesium concentration, and absorbent/solution ratio). The MAG*SEP SM particles coated with resorcinol formaldehyde had high distribution ratios values and could also be used to remove cesium from Hanford supernant simulant. Gamma irradiation studies were performed on the MAG*SEP SM particles with a gamma dose equivalent to 100 cycles of use. This irradiation decreased the loading capacity and distribution ratios for the particles by greater than 75%. The particles demonstrated high sensitivity to radiolytic damage due to the degradation of the polymeric regions. These results were supported by optical microscopy measurements. Overall, use of magnetic particles for cesium separation under nuclear waste conditions was found to be marginally effective

  20. Cesium-137: psychological and social consequences of the Goiania's accident

    International Nuclear Information System (INIS)

    Helou, Suzana; Costa Neto, Sebastiao Benicio da

    1995-01-01

    The book care for radioactive accident occurred in 1987 in Goiania - brazilian city. The accident had origin by the hospitable equipment incorrect handling which contained a stainless steel capsule, in which interior there was cesium-137 chloride. The main boarded aspects are: psychological and social aspects verified after the accident; psychological and social analysis of population of Goiania three years after the accident; essay on the pertinence of Luscher's abbreviate test in psychological evaluation of the radioactive accident victims of Goiania; and psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

  1. Thallous and cesium halide materials for use in cryogenic applications

    International Nuclear Information System (INIS)

    Lawless, W.N.

    1983-01-01

    Certain thallous and cesium halides, either used alone or in combination with other ceramic materials, are provided in cryogenic applications such as heat exchange material for the regenerator section of a closed-cycle cryogenic refrigeration section, as stabilizing coatings for superconducting wires, and as dielectric insulating materials. The thallous and cesium halides possess unusually large specific heats at low temperatures, have large thermal conductivities, are nonmagnetic, and are nonconductors of electricity. They can be formed into a variety of shapes such as spheres, bars, rods, or the like and can be coated or extruded onto substrates or wires. (author)

  2. Using Cesium for 3D Thematic Visualisations on the Web

    Science.gov (United States)

    Gede, Mátyás

    2018-05-01

    Cesium (http://cesiumjs.org) is an open source, WebGL-based JavaScript library for virtual globes and 3D maps. It is an excellent tool for 3D thematic visualisations, but to use its full functionality it has to be feed with its own file format, CZML. Unfortunately, this format is not yet supported by any major GIS software. This paper intro- duces a plugin for QGIS, developed by the author, which facilitates the creation of CZML file for various types of visualisations. The usability of Cesium is also examined in various hardware/software environments.

  3. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium.

    Science.gov (United States)

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru

    2012-05-30

    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent. Copyright © 2012 Elsevier B.V. All rights reserved.

  4. Pilot unit for cesium-137 separation; Unite pilote de separation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Raggenbass, A; Quesney, M; Fradin, J; Dufrene, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of {sup 137}Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain {sup 137}Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author)Fren. [French] L'interet des utilisateurs de rayonnement se porte de plus en plus vers le caesium-137. Parallelement, la mise en oeuvre de l'ensemble industriel de Marcoule nous permettra de disposer dans un avenir proche de stocks importants de produits de fission qu'il sera interessant de valoriser au plus vite. L'installation que nous decrivons est un pilote de production de caesium-137 qui doit nous permettre: - de verifier la methode chimique sur des solutions de produits de fission reelles en traitant environ 100 curies de {sup 137}Cs par operation; - d'obtenir des renseignements techniques sur l'appareillage chimique (telecommandes, corrosion, entretien, etc...); - d'obtenir du {sup 137}Cs en quantite suffisante pour mettre au point la technique de fabrication des sources scellees. (auteur)

  5. Quantitative analysis on dose to humans as a result of consuming tuna fish contaminated by cesium radionuclides

    International Nuclear Information System (INIS)

    Khani, J.; Donev, J.M.K.C.

    2014-01-01

    Quantitative empirical data is presented on the dose exposure to North Americans consuming tuna fish that have accumulated concentrations of radioactive isotopes. The two particular radioactive isotopes of interest are cesium-137 and cesium-134. Though biological effects of radiation are a widely debatable topic, the consumption of tuna fish does not support significant increased risk of cancer to humans. An important comparison is made between the elevated levels of radioactive cesium concentrations to naturally occurring radionuclides, namely potassium-40 and polonium-210. It is calculated that naturally occurring radioactive isotopes are in the orders of magnitude greater than the cesium radionuclides in tuna fish. (author)

  6. Quantitative analysis on dose to humans as a result of consuming tuna fish contaminated by cesium radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Khani, J.; Donev, J.M.K.C., E-mail: jykhani@ucalgary.ca, E-mail: jason.donev@ucalgary.ca [Univ. of Calgary, Calgary, AB (Canada)

    2014-07-01

    Quantitative empirical data is presented on the dose exposure to North Americans consuming tuna fish that have accumulated concentrations of radioactive isotopes. The two particular radioactive isotopes of interest are cesium-137 and cesium-134. Though biological effects of radiation are a widely debatable topic, the consumption of tuna fish does not support significant increased risk of cancer to humans. An important comparison is made between the elevated levels of radioactive cesium concentrations to naturally occurring radionuclides, namely potassium-40 and polonium-210. It is calculated that naturally occurring radioactive isotopes are in the orders of magnitude greater than the cesium radionuclides in tuna fish. (author)

  7. Strontium 90 and cesium 137 content in the daily diet of two groups of people in Plovdiv

    International Nuclear Information System (INIS)

    Babakova, I.; Trendafilov, I.; Todorov, D.

    1975-01-01

    The contents of strontium 90 and cesium 137 in the daily diet of children, 7-11 years old, and teenagers, 14-18 years old, living under boarding house conditions is determined. The daily strontium 90 intake in the organism of children and teenagers amounts to 9,78 pCi, respectively 17,96 pCi and the daily intake of cesium 137 - to 13,21 pCi, respectively 21,33 pCi. The bigger part of the strontium 90 and cesium 137 intake comes from the bread, accounting for 4,85 pCi stroncium 90 and 5,08 to 7,0 pCi cesium 137. (author)

  8. Cesium-137 in ash from combustion of biofuels. Application of regulations from the Swedish Radiation Safety Authority

    International Nuclear Information System (INIS)

    Sjoeblom, Rolf

    2009-01-01

    The Swedish Radiation Safety Authority, SSM, has issued an ordinance on ash contaminated with Cesium-137. It implies amongst other things that ash containing 0,5 - 10 kBq/kg Cesium-137 (so-called contaminated ash) can be used for geotechnical purposes provided that the content in a near-by well does not exceed 1 Bq/litre and that the increase in a near-by fish producing recipient does not exceed 0,1 Bq/litre. The initial plan with the presently reported work was to provide a compilation of how the ordinance for Cesium-137 can be applied in practical work. It became evident, however, in the course of the work that issues related to the co-variation between potassium and Cesium needed further investigation. As a result, the present report comprises also a compilation of this extended information search. Cesium-137 is present in ash as a result of the accident in a nuclear power reactor in Chernobyl in 1986 during which material having a very small grain size was spread to a high altitude. A few days later, Cesium-137 was deposited during rains over large parts of Sweden. This activity penetrated to a depth of one or a few decimetres during the course of the subsequent few days and weeks, after which it was partially taken up by plants and spread in the ecosystem. Section 2 has the character of a handbook. It provides basic information on radiation, and also about the ordinance and other material from the SSI. Section 3 comprises compilations of relevant international status of knowledge. This regards how potassium and Cesium behave in soil and ash, and also how spreading of Cesium can be modelled. Cesium behaves similarly to Potassium but with the difference that Cesium is bonded much more strongly to mineral soil and ash. Potassium and Cesium appears in soil in four different forms: dissolved in the pore water, exchangeable, non-exchangeable and as bonded to minerals. The amount dissolved in the pore water is the smallest and that bonded to minerals is the largest

  9. Electronic band structure, optical, dynamical and thermodynamic properties of cesium chloride (CsCl from first-principles

    Directory of Open Access Journals (Sweden)

    Bingol Suat

    2015-01-01

    Full Text Available The geometric structural optimization, electronic band structure, total density of states for valence electrons, density of states for phonons, optical, dynamical, and thermodynamical features of cesium chloride have been investigated by linearized augmented plane wave method using the density functional theory under the generalized gradient approximation. Ground state properties of cesium chloride are studied. The calculated ground state properties are consistent with experimental results. Calculated band structure indicates that the cesium chloride structure has an indirect band gap value of 5.46 eV and is an insulator. From the obtained phonon spectra, the cesium chloride structure is dynamically stable along the various directions in the Brillouin zone. Temperature dependent thermodynamic properties are studied using the harmonic approximation model.

  10. Total deposition of cesium-137 measured in Finland during the exercise 'RESUME 95' in August 1995

    International Nuclear Information System (INIS)

    Geer, L.E. De; Vintersved, I.; Arntsing, R.

    1997-01-01

    In the exercise called 'RESUME 95' the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au)

  11. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Energy Technology Data Exchange (ETDEWEB)

    Geer, L.E. De; Vintersved, I.; Arntsing, R. [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)

    1997-12-31

    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  12. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Energy Technology Data Exchange (ETDEWEB)

    Geer, L.E. De; Vintersved, I; Arntsing, R [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)

    1998-12-31

    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  13. Advance in the study of removal of cesium from radioactive wastewater by inorganic ion exchangers

    International Nuclear Information System (INIS)

    Wang Songping; Wang Xiaowei; Du Zhihui

    2014-01-01

    The excellent performance in the removal of cesium from radioactive wastewater by inorganic ion exchangers has received extensive attention due to their characteristic physico-chemical features. The paper summarized research progress of removal of cesium by different inorganic ion exchangers such as silicoaluminate, salts of hetero polyacid, hexacyanoferrate, insoluble salts of acid with multivalent metals, insoluble hydrous oxides of multivalent metals and silicotitanate and reviewed several removal systems of cesium by inorganic ion exchangers which might offer China some reference in treatment and disposal of radioactive wastewater. (authors)

  14. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Man; Jang, Sung-Chan; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-10-15

    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe{sub 3}O{sub 4} nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired.

  15. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    International Nuclear Information System (INIS)

    Yang, Hee-Man; Jang, Sung-Chan; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon

    2014-01-01

    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe 3 O 4 nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired

  16. Thermochemical evaluation and preparation of cesium uranates

    International Nuclear Information System (INIS)

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku; Sato, Seichi; Ohashi, Hiroshi.

    1997-03-01

    Two kinds of cesium uranates, Cs 2 UO 4 and Cs 2 U 2 O 7 , which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U 3 O 8 and Cs 2 CO 3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs 2 UO 4 and Cs 2 U 2 O 7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs 2 UO 4 and Cs 2 U 2 O 7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  17. Separation of radio cesium from PUREX feed solution by sorption on composite ammonium molybdo phosphate (AMP)

    International Nuclear Information System (INIS)

    Singh, I.J.; Achuthan, P.V.; Jain, S.; Janardanan, C.; Gopalakrishnan, V.; Wattal, P.K.; Ramanujam, A.

    2001-01-01

    Composite AMP exchanger was developed and evaluated for separation of radio cesium from dissolver solutions of PUREX process using a column experiment. The composite shows excellent sorption of radio cesium from dissolver solutions without any loss of plutonium and uranium. The removal of radio cesium from dissolver solutions will help in lowering the degradation of tri-n-butyl phosphate (TBP) in the solvent extraction process and will also help in reducing the radiation related problems. (author)

  18. Cesium accumulation by bacterium Thermus sp.TibetanG7: hints for biomineralization of cesiumbearing geyserite in hot springs in Tibet, China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The bacterium Thermus sp. TibetanG7, isolated from hot springs in Tibet, China, was examined for the ability to accumulate cesium from solutions. Environmental conditions were simulated and the effects of pH, K+, Na+ and K+-regimes were then studied to determine the possible role of the bacterium in the formation of cesium-bearing geyserite around these hot springs. In despite of the inhibition of K+ and Na+, the bacterium Thermus sp. TibetanG7 revealed noticeable accumulation of cesium from solutions, with maximum accumulations of 53.49 and 40.41 μmol Cesium/g cell dry weight in Na+ and K+ inhibition experiments, respectively. The accumulation of cesium by this microorganism is rapid, with 40%―50% accumulated within the first 5 min. K+-deficient cells showed a much higher capacity of cesium accumulation compared with K+-sufficient cells. It is evident that the bacteria within the genus thermus play a significant role in the cesium assembly. The formation of cesium-bearing geyserite is also considered.

  19. Ab Initio investigation of cesium monoxide of CsO and CsO+

    International Nuclear Information System (INIS)

    Zialenina, M.; Kelloe, V.; Cernusak, I.

    2015-01-01

    Cesium is material with a low work function and, accordingly, atomic Cs has a low value of ionization energy. Therefore cesium is regarded as a good source material for electrons in plasma heating module. One of plasma heating technologies using Cs grid is foreseen as a candidate for the tokamak within the framework of project ITER. Among the possible impurities that can coexist in this module are CsO or CsO + , due to presence of oxygen traces in the heating chamber. We conducted CCSD(T) energy calculations of the cesium oxide (X 2 Σ + ) and its cation (X 3 Σ - ). Here are presented the bond lengths and spectroscopic parameters of both species and ionization energy (IE). Our IE (6.88 eV) is in good agreement with previous theoretical results, experiment indicates substantially lower value (6.22 eV). (authors)

  20. 14 CFR 141.11 - Pilot school ratings.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot school ratings. 141.11 Section 141.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... rating course. (x) Aircraft type rating course. (2) Special preparation courses. (Appendix K). (i) Pilot...

  1. Deviation from local thermodynamic equilibrium in a cesium-seeded argon plasma

    International Nuclear Information System (INIS)

    Stefanov, B.; Zarkova, L.

    1985-11-01

    The possibility of deviations from local thermodynamic equilibrium of a cesium seeded argon plasma has been analyzed. A four level model of cesium has been employed. Overpopulations of the ground state and the first excited state as well as the corresponding reduction of the electron density are calculated for cylindrical discharge structures by solving stationary rate equations. Numerical results are presented. These results indicate that in a large regime of plasma conditions the LTE assumption is valid for electron temperatures larger than 3000 K. (orig.)

  2. Results from annual testing of ARECO cesium capsules from 1990-1994

    Energy Technology Data Exchange (ETDEWEB)

    Lundeen, J.E.

    1994-10-01

    The purpose of this report is to compile the results of the cesium capsule inspections and testing at the Applied Radiant Energy Corporation (ARECO) facility in Lynchburg, VA, performed in 1990, 1991, 1992, 1993, and 1994. The 25 cesium capsules at the ARECO facility were visually identified and clunk tested. A Go/No Go gauge test was required for capsules failing the clunk test. A visual inspection of capsules was required for the initial testing (1990). All 25 capsules passed the inspections and testing each year.

  3. Phase equilibria and critical phenomena in the cesium nitrate-water-diethylamine ternary system

    International Nuclear Information System (INIS)

    Il'in, K.K.; Kurskij, V.F.; Cherkasov, D.G.

    2008-01-01

    Phase equilibria and critical events in ternary cesium nitrate-water-diethylamine system, where border binary liquid system is characterized by aliquation with lower critical temperature of solution (LCTS), have been investigated by visual-polythermal method in the 60-150 Deg C range. Interaction of cesium nitrate in the water-diethylamine system leads to lowering of its LCTS from 146.1 to 69.3 Deg C and decrease of mutual solubility. Distribution ratios of diethylamine between water and organic phases of monotectic equilibrium are calculated at different temperatures. Diethylamine salting out from aqueous solutions by cesium nitrates becomes stronger with rising temperature. Plotted isotherms of phase confirms generalized scheme of topological transformations of ternary systems phase diagrams: salt-binary solvent with salting out

  4. Strontium-90 and cesium-137 in sea water (from Jul 1984 to Sep 1984)

    International Nuclear Information System (INIS)

    1984-01-01

    Monitoring results are presented on strontium-90 and cesium-137 contents in sea water of 11 sampling points all over Japan from Hokkaido to Okinawa coast. Sampling points were selected by the criterion that the effect of terrestrial fresh water and atmospheric precipitation was expected to be ignorable. Sample collection was carried out in the Period from July to September, 1984. With a special care for prevention of any contamination. The collected sea water samples were acidified immediately and they were served for radiochemical separation and purification of strontium-90 and cesium-137. Radiation counting was made for yttrium-90 hydroxide sample and cesium chloroplatinate sample with a low background beta counter normally for 60 minutes. As for strontium-90 contents in sea water, they were ranged from 0.07 +- 0.010 pCi/l (Mutsu Bay, Aomori) to 0.11 +- 0.012 pCi/l (Off Niigata Port, Niigata) and the average value was 0.09 pCi/l. As for cesium-137 contents, they were ranged from 0.08 +- 0.011 pCi/l (Ise Bay, Aichi) to 0.14 +- 0.012 pCi/l (Yamaguchi Bay, Yamaguchi) and the average value was 0.106 pCi/l. It is clarified that no abnormal values were determined for strontium-90 or cesium-137 contents in coastal sea water around Japan from a fallout origin. (Takagi, S.)

  5. 14 CFR 121.141 - Airplane flight manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

  6. 37 CFR 1.41 - Applicant for patent.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Applicant for patent. 1.41 Section 1.41 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Who May Apply for A...

  7. Re-suspension of Cesium-134/137 into the Canadian Environment and the Contribution Stemming from the Fukushima-Daiichi Nuclear Incident

    Science.gov (United States)

    Mercier, Jean-Francois; Zhang, Weihua; Loignon-Houle, Francis; Cooke, Michael W.; Ungar, Kurt R.; Pellerin, Eric R.

    2013-04-01

    Cesium-137 (t1/2 = 30 yr) and cesium-134 (t1/2 = 2yr) constitute major fission by-products observed as the result of a nuclear incident. Such radioisotopes become integrated into the soil and biomass, and can therefore undergo re-suspension into the environment via activities such as forest fires. The Canadian Radiological Monitoring Network (CRMN), which consists of 26 environmental monitoring stations spread across the country, commonly observes cesium-137 in air filters due to re-suspension of material originating from long-past weapons testing. Cesium-134 is not observed owing to its relatively short half-life. The Fukushima-Daiichi nuclear power plant incident of March 2011 caused a major release of radioactive materials into the environment. In Canada, small quantities of both cesium-137 and cesium-134 fallout were detected with great frequency in the weeks which followed, falling off rapidly beginning in July 2011. Since September 2011, the CRMN has detected both cesium-137 and cesium-134 from air filters collected at Yellowknife, Resolute, and Quebec City locations. Using the known initial cesium-134/cesium-137 ratio stemming from this incident, along with a statistical assessment of the normality of the data distribution, we herein present evidence that strongly suggests that these activity spikes are due to re-suspended hot particles originating from the Fukushima-Daiichi nuclear power plant incident. Moreover, we have evidence to suggest that this re-suspension is localized in nature. This study provided empirical insight into the transport and uptake of radionuclides over vast distances, and it demonstrates that the CRMN was able to detect evidence of a re-suspension of Fukushima-Daiichi related isotopes.

  8. Physical barrier effect of geopolymeric waste form on diffusivity of cesium and strontium

    Energy Technology Data Exchange (ETDEWEB)

    Jang, J.G.; Park, S.M.; Lee, H.K., E-mail: haengki@kaist.ac.kr

    2016-11-15

    Highlights: • Physical immobilization of radionuclides in geopolymer was quantitatively assessed. • Fly ash-based geopolymer showed excellent immobilization performance. • Diffusivity of soluble Cs and Sr was highly correlated with critical pore diameter. - Abstract: The present study investigates the physical barrier effect of geopolymeric waste form on leaching behavior of cesium and strontium. Fly ash-based geopolymers and slag-blended geopolymers were used as solidification agents. The leaching behavior of cesium and strontium from geopolymers was evaluated in accordance with ANSI/ANS-16.1. The diffusivity of cesium and strontium in a fly ash-based geopolymer was lower than that in Portland cement by a factor of 10{sup 3} and 10{sup 4}, respectively, showing significantly improved immobilization performance. The leaching resistance of fly ash-based geopolymer was relatively constant regardless of the type of fly ash. The diffusivity of water-soluble cesium and strontium ions were highly correlated with the critical pore diameter of the binder. The critical pore diameter of the fly ash-based geopolymer was remarkably smaller than those of Portland cement and slag-blended geopolymer; consequently, its ability physically to retard the diffusion of nuclides (physical barrier effect) was superior.

  9. A distribution of adsorbed forms of cesium 137 and strontium 90 in flood-plain formations of Sozh river

    International Nuclear Information System (INIS)

    Kuznetsov, V.A.; Generalova, V.A.

    1999-01-01

    The distribution of strontium 90 and cesium 137 forms in flood-plain geochemical system 'alluvial deposits - flood-plain turf - humus horizon - soil-source rock', where sorption and colloidal processes play main role in the isotopes migration, was studied. The bulk amount of strontium 90 is presented in adsorbed form in all investigated objects, whereas only 6% of cesium 137 amount in alluvial deposits, flood-plain turf and humus horizon is in adsorbed form. The content of exchange forms of cesium 137 and strontium 90 increases with the depth of the layer. The race of this increase for strontium 90 is large than for cesium 137. The distribution of radionuclides through the different parts of flood-plain of Sozh river has some distinctions due to more lability of adsorbed strontium 90 forms in comparison with cesium 137 ones

  10. Thermal Performance Analysis For Small Ion-Exchange Cesium Removal Process

    International Nuclear Information System (INIS)

    Lee, S.; King, W.

    2009-01-01

    The In-Riser Ion Exchange program focuses on the development of in-tank systems to decontaminate high level waste (HLW) salt solutions at the Savannah River Site (SRS) and the Hanford Site. Small Column Ion Exchange (SCIX) treatment for cesium removal is a primary in-riser technology for decontamination prior to final waste immobilization in Saltstone. Through this process, radioactive cesium from the salt solution is adsorbed onto the ion exchange media which is packed within a flow-through column. Spherical Resorcinol-Formaldehyde (RF) is being considered as the ion exchange media for the application of this technology at both sites. A packed column loaded with media containing radioactive cesium generates significant heat from radiolytic decay. Under normal operating conditions, process fluid flow through the column can provide adequate heat removal from the columns. However, in the unexpected event of loss of fluid flow or fluid drainage from the column, the design must be adequate to handle the thermal load to avoid unacceptable temperature excursions. Otherwise, hot spots may develop locally which could degrade the performance of the ion-exchange media or the temperature could rise above column safety limits. Data exists which indicates that performance degradation with regard to cesium removal occurs with RF at 65C. In addition, the waste supernate solution will boil around 130C. As a result, two temperature limits have been assumed for this analysis. An additional upset scenario was considered involving the loss of the supernate solution due to inadvertent fluid drainage through the column boundary. In this case, the column containing the loaded media could be completely dry. This event is expected to result in high temperatures that could damage the column or cause the RF sorbent material to undergo undesired physical changes. One objective of these calculations is to determine the range of temperatures that should be evaluated during testing with the RF

  11. Distribution Coefficient Kd of Cesium in Soils from Areas in Perak

    International Nuclear Information System (INIS)

    Azian Hashim; Mohd Suhaimi Hamzah; Shamsiah Abdul Rahman; Nazaratul Ashifa Abdullah Salim; Md Suhaimi Elias; Shakirah Shukor; Muhd Azfar Azman; Siti Aminah Omar

    2015-01-01

    This is the paper reports on the study of distribution coefficient or Kd value in soil collected from the Western of Perak, which is Manjung, Setiawan, and Lahat with two different depths using lab batch method. Particle sizes were analyzed using the conventional technique known as pipette method. pH of the sample were 2-3. Determinations for cesium were performed using Inductively Coupled Plasma-Mass (ICP-MS). From the results, distribution factor for cesium, Kd value, was found to be influenced by the particle size of soil. (author)

  12. Alkali-iodide/urania systems at high temperatures. 1. Cesium uranate chemistry

    International Nuclear Information System (INIS)

    McFarlane, J.; LeBlanc, J.C.

    1994-09-01

    Uranate compounds are likely to form in irradiated fuel from the reaction between UO 2 and fission products along UO 2 grain boundaries and in the fuel-cladding gap. Literature on the high-temperature chemistry of cesium and rubidium uranates was reviewed. Results from Knudsen cell experiments from 900 to 2600 K on cesium uranates are discussed. These studies indicate that the uranate phases formed depend on the oxygen potential of the system, which varies with the composition of the condensed phase. 62 refs., 12 figs., 6 tabs., 2 appendices

  13. Application of the complex equilibrium code QUIL to cesium-impurity equilibria in the primary coolant of high-temperature gas-cooled reactors

    International Nuclear Information System (INIS)

    Feber, R.D.; Lunsford, J.L.; Stark, W.A. Jr.

    1976-05-01

    An equilibrium analysis has been made of the fission-product cesium in the primary coolant loop of the high-temperature gas-cooled reactor (HTGR). The species distributions that result at equilibrium have been calculated for various conditions of reactor operation. The cesium species considered were the monomer, dimer, oxides, hydroxides, and the hydride. The effect of cesium sorption isotherms on graphite also was included in the analysis. During normal reactor operations, the abundant species of cesium were calculated to be elemental cesium, Cs, and the monomeric hydroxide, CsOH. Under most conditions of steam ingress, the abundant species was calculated to be CsOH. Cesium adsorbed onto graphite was stable under all steam-ingress conditions considered. Thermal transients above 1500 0 K were required for equilibrium transport of cesium from the core to the coolant. The analysis was carried out using the complex equilibrium code QUIL, designed and written with special emphasis on features that make it applicable to the fission-product problem

  14. Experiments and simulations for the dynamics of cesium in negative hydrogen ion sources for ITER N-NBI

    Energy Technology Data Exchange (ETDEWEB)

    Gutser, Raphael

    2010-07-21

    The injection of fast neutral particles (NBI) into a fusion plasma is an important method for plasma heating and current drive. A source for negative deuterium ions delivering an 1 MeV beam that is accelerated to a specific energy and neutralized by a gas target is required for the ITER-NBI. Cesium seeding is required to extract high negative ion current densities from these sources. The optimization of the cesium homogeneity and control are major objectives to achieve the source requirements imposed by ITER. Within the scope of this thesis, the Monte Carlo based numerical transport simulation CsFlow3D was developed, which is the first computer model that is capable of simulating the flux and the accumulation of cesium on the surfaces of negative-ion sources. Basic studies that support the code development were performed at a dedicated experiment at the University of Augsburg. Input parameters of the ad- and desorption of cesium at ion source relevant conditions were taken from systematic measurements with a quartz micro balance, while the injection rate of the cesium oven at the ion source was determined by surface ionization detection. This experimental setup was used for further investigations of the work function of cesium-coated samples during plasma exposure. (orig.)

  15. Experiments and simulations for the dynamics of cesium in negative hydrogen ion sources for ITER N-NBI

    International Nuclear Information System (INIS)

    Gutser, Raphael

    2010-01-01

    The injection of fast neutral particles (NBI) into a fusion plasma is an important method for plasma heating and current drive. A source for negative deuterium ions delivering an 1 MeV beam that is accelerated to a specific energy and neutralized by a gas target is required for the ITER-NBI. Cesium seeding is required to extract high negative ion current densities from these sources. The optimization of the cesium homogeneity and control are major objectives to achieve the source requirements imposed by ITER. Within the scope of this thesis, the Monte Carlo based numerical transport simulation CsFlow3D was developed, which is the first computer model that is capable of simulating the flux and the accumulation of cesium on the surfaces of negative-ion sources. Basic studies that support the code development were performed at a dedicated experiment at the University of Augsburg. Input parameters of the ad- and desorption of cesium at ion source relevant conditions were taken from systematic measurements with a quartz micro balance, while the injection rate of the cesium oven at the ion source was determined by surface ionization detection. This experimental setup was used for further investigations of the work function of cesium-coated samples during plasma exposure. (orig.)

  16. Intense non-relativistic cesium ion beam

    International Nuclear Information System (INIS)

    Lampel, M.C.

    1984-02-01

    The Heavy Ion Fusion group at Lawrence Berkeley Laboratory has constructed the One Ampere Cesium Injector as a proof of principle source to supply an induction linac with a high charge density and high brightness ion beam. This is studied here. An electron beam probe was developed as the major diagnostic tool for characterizing ion beam space charge. Electron beam probe data inversion is accomplished with the EBEAM code and a parametrically adjusted model radial charge distribution. The longitudinal charge distribution was not derived, although it is possible to do so. The radial charge distribution that is derived reveals an unexpected halo of trapped electrons surrounding the ion beam. A charge fluid theory of the effect of finite electron temperature on the focusing of neutralized ion beams (Nucl. Fus. 21, 529 (1981)) is applied to the problem of the Cesium beam final focus at the end of the injector. It is shown that the theory's predictions and assumptions are consistent with the experimental data, and that it accounts for the observed ion beam radius of approx. 5 cm, and the electron halo, including the determination of an electron Debye length of approx. 10 cm

  17. Strontium-90 and cesium-137 in service water (from June, 1982, to December, 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in service water measured at 19 locations across Japan from June to December, 1982, are given in pCi/l, respectively. The methods of the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, and the counting are also described. Service water was collected at an intake of the water-treatment plant and at the tap. The sample was then passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The sample solution prepared was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitate was counted for activity using a low background beta counter normally for 60 min. The radioactivity ranged 0.01 to 0.10 pCi/l for Sr-90 and 0.001 to 0.010 pCi/l for Cs-137 in the service water. (J.P.N.)

  18. Determination of the cesium distribution coeficient in Goiania and Abadia de Goias cities soils

    International Nuclear Information System (INIS)

    Marumo, J.T.; Suarez, A.A.

    1989-01-01

    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias's city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57 th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficient for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author) [pt

  19. Determination of the cesium distribution coefficient in Goiania and Abadia de Goias cities soils

    International Nuclear Information System (INIS)

    Marumo, J.T.; Suarez, A.A.

    1989-10-01

    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57 th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficent for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author) [pt

  20. Cesium Ion Exchange Program at the Hanford River Protection Project Waste Treatment Plant

    International Nuclear Information System (INIS)

    CHARLES, NASH

    2004-01-01

    The River Protection Project - Hanford Tank Waste Treatment and Immobilization Plant will use cesium ion exchange to remove 137Cs from Low Activity Waste down to 0.3 Ci/m3 in the Immobilized LAW, ILAW product. The project baseline for cesium ion exchange is the elutable SuperLig, R, 644, SL-644, resin registered trademark of IBC Advanced Technologies, Inc., American Fork, UT or the Department of Energy approved equivalent. SL-644 is solely available through IBC Advanced Technologies. To provide an alternative to this sole-source resin supply, the RPP--WTP initiated a three-stage process for selection and qualification of an alternative ion exchange resin for cesium removal in the RPPWTP. It was recommended that resorcinol formaldehyde RF be pursued as a potential alternative to SL-644

  1. Multiphoton ionization of atomic cesium

    International Nuclear Information System (INIS)

    Compton, R.N.; Klots, C.E.; Stockdale, J.A.D.; Cooper, C.D.

    1984-01-01

    We describe experimental studies of resonantly enhanced multiphoton ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photoelectron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photoionization signal. For both ns and np states the field induced MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength. Finally, we note that the classical two-photon field-ionization threshold is lower for the case in which the laser polarization and the electric field are parallel than it is when they are perpendicular. 22 references, 11 figures

  2. Thermal properties of cesium molybdate

    International Nuclear Information System (INIS)

    Minato, Kazuo; Fukuda, Kousaku; Takano, Masahide; Sato, Seichi; Ohashi, Hiroshi

    1996-01-01

    Cesium is one of the most important fission products to aid in the understanding and prediction of the behavior of oxide nuclear fuels because of its high mobility, chemical reactivity, and large yield. In postirradiation examinations of the Phoenix reactor fuel pins, the accumulation of cesium and molybdenum between the fuel pellet and cladding was observed, though the chemical form was not determined. In the thermodynamic analyses of chemical states of fission products, Cs 2 MoO 4 was often predicted to exist as a stable compound in oxide fuels. The Cs 2 MoO 4 compound is thermodynamically stable under the conditions of light water reactors, fast breeder reactors, and high-temperature gas-cooled reactors. In the Cs-Mo-O system several phases have been found, and the structural and thermodynamic properties were studied. At room temperature, Cs 2 MoO 4 has an orthorhombic structure and a phase transition occurs at 841 K to a hexagonal structure. Both structures are expected to exist in the fuel, depending on the fuel temperature. However, no data has been available on the thermal properties of CS 2 MoO 4 . In the current work, the thermal expansion and thermal conductivity of Cs 2 MoO 4 were determined, which are the basic data needed to understand and predict the fuel/clad mechanical interaction and fuel temperature

  3. Cesium-137. Environment. Man

    International Nuclear Information System (INIS)

    Moiseev, A.A.

    1985-01-01

    Analysis of all main sourses of cerium-137 formation and intake into the external medium is given. Special attention is paid to the estimation of possible influence of rapidly developing nuclear power industry on contamination of the external medium by the radionuclide. Levels of contamination of the external medium by cerium-137, main regularities of its migration through food chains, levels of its intake and accumulation in population's organisms in USSR and its separate regions, are considered. Great attention is paid to the control methods of external environmental contamination by cesium-137 and to its measurements in human body

  4. Decontamination of radioactive cesium in soil using nano-size metallic calcium dispersing

    International Nuclear Information System (INIS)

    Mitoma, Yoshiharu; Fukuoka, Takezo; Matsue, Hideaki; Kobayashi, Hidemasa; Shiraishi, Hiroaki; Kajitani, Mikio

    2013-01-01

    In Japan, the major concern on radioactive cesium ( 134 Cs and 137 Cs) deposition and soil contamination due to the emission form the Fukushima Dai-ichi nuclear power plant showed up after a massive quake on March 11, 2011. Soil contamination with radioactive cesium has a long-term radiological impact due to its long half-life (30 years for 137 Cs) and its high biological hazard. Therefore, much attention has been paid to decontaminate Cs-contaminated soil with washing and/or extraction by adopting solvents. However, such wet methods have some disadvantages, i.e. forming of secondary effluents and additional cost for their treatment. We have recently shown that the nano-size metallic calcium/calcium oxide/iron dispersing mixture (Fe-nCa) is most effective for heavy metals immobilization and volume reduction method under dry condition. Thus, we applied this method to treat real radioactive cesium contaminated soils in dry condition. Simple stirring of the contaminated soil with Fe-nCa achieved about above 90% of radioactive Cs decontamination rate and the volume reduction level also reached around 50-60%. In this paper, we showed the effectiveness of a Fe-nCa method for the rapid remediation and volume reduction method of real radioactive cesium contaminated soils under dry conditions and our challenges for sophistication applying machine and reagents. (author)

  5. Removal of cesium and strontium from low active waste solutions by zeolites

    International Nuclear Information System (INIS)

    Jain, Savita; Ramaswamy, M.; Theyyunni, T.K.

    1994-01-01

    Ion exchange, crystallographic and thermal characteristics of sodium, cesium and strontium forms of locally available synthetic zeolites have been investigated. X-ray and differential thermal analyses have confirmed that the synthetic materials AR1 and 4A belonged to the mordenite and A type families of zeolites respectively. Equilibrium uptake of cesium and strontium ions by sodium forms of zeolite was studied as a function of time, pH and sodium concentration. It was found that the rate of sorption by AR1 was higher than that by 4A. In regard to pH, distribution of nuclides on zeolites was found to pass through maxima at a pH value of around 9. Sodium ion interfered with the sorption of cesium and strontium by zeolites. However, at sodium concentration ≤ 0.01 M, distribution coefficient values for these nuclides were sufficiently high to merit consideration of these zeolites for low level waste treatment. Lab-scale column runs using 5 ml beds of materials showed that the zeolites AR1 and 4A were very effective in removing cesium and strontium nuclides respectively from large volumes (a decontamination factor of 50 for a throughput of 6000 bed volumes) of actual low level waste solutions. Thus, the zeolite system has a potential future for large scale application in the treatment of low level wastes. (author). 6 refs., 5 figs., 6 tabs

  6. 40 CFR 141.62 - Maximum contaminant levels for inorganic contaminants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for inorganic contaminants. 141.62 Section 141.62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.62 Maximum...

  7. Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

    International Nuclear Information System (INIS)

    Jalali-Rad, R.; Ghafourian, H.; Asef, Y.; Dalir, S.T.; Sahafipour, M.H.; Gharanjik, B.M.

    2004-01-01

    Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q max values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles

  8. Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

    Energy Technology Data Exchange (ETDEWEB)

    Jalali-Rad, R. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of)]. E-mail: rjalali@aeoi.org.ir; Ghafourian, H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Asef, Y. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Dalir, S.T. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Sahafipour, M.H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Gharanjik, B.M. [Offshore Fisheries Research Center, Chabahar (Iran, Islamic Republic of)

    2004-12-10

    Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q{sub max} values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles.

  9. Recovery of palladium, cesium, and selenium from heavy metal alkali borosilicate glass by combination of heat treatment and leaching processes

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zhanglian; Okada, Takashi, E-mail: t-okada@u-fukui.ac.jp; Nishimura, Fumihiro; Yonezawa, Susumu

    2017-06-05

    Highlights: • A separation technique of both noble and less noble metal from glass is studied. • Via reductive heat treatment, 80% of palladium is extracted in liquid bismuth. • Sodium–potassium-rich materials with cesium and selenium are phase separated. • From the materials, over 80% of cesium and selenium are extracted in water. - Abstract: Reductive heat-treatment and leaching process were applied to a simulated lead or bismuth soda-potash-borosilicate glass with palladium, cesium, and selenium to separate these elements. In the reductive heat treatment, palladium is extracted in liquid heavy metal phase generated by the reduction of the heavy metal oxides, whereas cesium and selenium are concentrated in phase separated Na–K-rich materials on the glass surface. From the materials, cesium and selenium can be extracted in water, and the selenium extraction was higher in the treatment of the bismuth containing glass. The chemical forms of palladium in the glass affected the extraction efficiencies of cesium and selenium. Among the examined conditions, in the bismuth glass treatment, the cesium and selenium extraction efficiencies in water were over 80%, and that of palladium in liquid bismuth was over 80%.

  10. Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.

    1996-01-01

    At Los Alamos National Laboratory, cesium-137 ( 137 Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles ≤2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of 137 Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of 137 Cs

  11. 40 CFR 141.61 - Maximum contaminant levels for organic contaminants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for organic contaminants. 141.61 Section 141.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.61 Maximum contaminant...

  12. 12 CFR 410.141-410.148 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.141-410.148 Section 410.141-410.148 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  13. Strontium-90 and cesium-137 in service water

    International Nuclear Information System (INIS)

    1979-01-01

    Prefectural public health laboratories and institutes and Japan Chemical Analysis Center have analysed the contents of strontium-90 and cesium-137 in service water under the commission of Science and Technology Agency. At each prefectural public health laboratories and institutes, 100 literes of service water (8 prefectures, water from the intake of each station of water works) and tap water (32 prefectures) were collected as sample twice a year. The samples were filtrated with large filter papers after addition and mixture of both some carries. The filtration was then applied on a column filled the sodium cation exchange resin, and all the cations were absorbed on it. These resin and filter papers were collected at Japan Chemical Analysis Center. At Japan Chemical Analysis Center, these collected samples were radiochemically analysed for strontium-90 and cesium-137 using the method applied for the analysis of rain and dry fallout materials. (author)

  14. Datablock: hd141

    Indian Academy of Sciences (India)

    2016-01-15

    Jan 15, 2016 ... checkCIF/PLATON page 2 http://checkcif.iucr.org/cgibin/checkcif_hkl.pl. 1/3. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). Structure factors have been supplied for datablock(s) hd141. THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW.

  15. Prussian blue as an antidote for radioactive thallium and cesium poisoning

    Directory of Open Access Journals (Sweden)

    Altagracia-Martinez M

    2012-06-01

    Full Text Available Marina Altagracia-Martínez, Jaime Kravzov-Jinich, Juan Manuel Martínez-Núñez, Camilo Ríos-Castañeda, Francisco López-NaranjoDepartments of Biological Systems and Health Care, Biological and Health Sciences Division, Universidad Autónoma Metropolitana-Xochimilco, Mexico DF, MexicoBackground: Following the attacks on the US on September 11, 2001, potentially millions of people might experience contamination from radioactive metals. However, before the specter of such accidents arose, Prussian blue was known only as an investigational agent for accidental thallium and cesium poisoning. The purpose of this review is to update the state of the art concerning use of Prussian blue as an effective and safe drug against possible bioterrorism attacks and to disseminate medical information in order to contribute to the production of Prussian blue as a biodefense drug.Methods: We compiled articles from a systematic review conducted from January 1, 1960 to March 30, 2011. The electronic databases consulted were Medline, PubMed, the Cochrane Library, and Scopus.Results: Prussian blue is effective and safe for use against radioactive intoxications involving cesium-137 and thallium. The US Food and Drug Administration has approved Prussian blue as a drug, but there is only one manufacturer providing Prussian blue to the US. Based on the evidence, Prussian blue is effective for use against radioactive intoxications involving cesium-137 and thallium, but additional clinical research on and production of Prussian blue are needed.Keywords: Prussian blue, radioactive cesium, thallium, intoxication, biodefense drug

  16. Synthesis of condensed double cesium manganese phosphates in melts of polyphosphoric acids

    International Nuclear Information System (INIS)

    Guzeeva, L.S.; Tananaev, I.V.

    1988-01-01

    This work is a continuation of investigations to establish the composition and formation conditions of condensed double cesium manganese phosphates and obtain x-ray and other characteristics of the compounds isolated. We studied cross sections of Cs 2 O-MnO 2 -P 2 O 5 -H 2 O systems at 150-400 degree C and three initial P : Mn ratios - 5, 7.5, and 10 - and at a constant P : Mn ratio of 15. The reaction of manganese and cesium oxides with melts of polyphosphoric acids at 150-400 degree C leads to the separation of three types of trivalent manganese and cesium condensed double phosphates - Cs 2 MnH 3 (P 2 O 7 ) 2 , triphosphate CsMnHP 3 O 10 , and cyclohexaphosphate Cs 3 Mn 3 -(P 6 O 18 ) 2 - in addition to a divalent manganese double cyclotriphosphate CsMnP 3 O 9 . The compounds separated were characterized by chemical, x-ray phase analysis, IR spectroscopic, and thermogravimetric methods

  17. 40 CFR 141.171 - Criteria for avoiding filtration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...

  18. Development of an ion-exchange process for removing cesium from high-level radioactive liquid wastes

    International Nuclear Information System (INIS)

    Baumgarten, P.K.; Wallace, R.M.; Whitehurst, D.A.; Steed, J.M.

    1979-11-01

    Methods to determine resin characteristics, i.e., cesium equilibria and diffusion rates, were developed. These parameters can now guide resin selection and aid in interpreting column performance. The K/sub D/ cesium ion concentration relation gives evidence of three different types of ion exchange sites. The countercurrent load/elution/regeneration cycle for the removal of cesium by ion exchange repeatedly reached the goal decontamination factor (DF) of 10,000 at throughputs up to 60 column volumes. Resin backwashing appears feasible, but further development of column geometry will be required. The proposed ammonium elutriant is satisfactory. Regeneration end-point can be controlled by electrical conductivity monitoring

  19. Performance modeling of an integral, self-regulating cesium reservoir for the ATI-TFE

    International Nuclear Information System (INIS)

    Thayer, K.L.; Ramalingam, M.L.; Young, T.J.

    1993-01-01

    This work covers the performance modeling of an integral metal-matrix cesium-graphite reservoir for operation in the Advanced Thermionic Initiative-Thermionic Fuel Element (ATI-TFE) converter configuration. The objectives of this task were to incorporate an intercalated cesium-graphite reservoir for the 3C 24 Cs→2C 36 Cs+Cs (g) two phase equilibrium reaction into the emitter lead region of the ATI-TFE. A semi two-dimensional, cylindrical TFE computer model was used to obtain thermal and electrical converter output characteristics for various reservoir locations. The results of this study are distributions for the interelectrode voltage, output current density, and output power density as a function of axial position along the TFE emitter. This analysis was accomplished by identifying an optimum cesium pressure for three representative pins in the ATI ''driverless'' reactor core and determining the corresponding position of the graphite reservoir in the ATI-TFE lead region. The position for placement of the graphite reservoir was determined by performing a first-order heat transfer analysis of the TFE lead region to determine its temperature distribution. The results of this analysis indicate that for the graphite reservoirs investigated the 3C 24 Cs→2C 36 Cs+Cs (g) equilibrium reaction reservoir is ideal for placement in the TFE emitter lead region. This reservoir can be directly coupled to the emitter, through conduction, to provide the desired cesium pressure for optimum performance. The cesium pressure corresponding to the optimum converter output performance was found to be 2.18 torr for the ATI core least power TFE, 2.92 torr for the average power TFE, and 4.93 torr for the maximum power TFE

  20. Feasibility Assessment of Cesium Removal using Microaglae

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Ilgook; Ryu, Byung-Gon; Seo, Bum-Kyoung; Moon, Jei Kwon; Choi, Jong-Won [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    The aim of this work is to assess the feasibility of selected one of microalgae in the uptake of Cs+. The obtained results showed the maximum Cs+ removal by D. armatus SCK was 280μM indicating 70% removal efficiency. Also, D. armatus SCK could uptake Cs+ in the presence of K+, is particularly known to be transported into cells as an analog of Cs+ in freshwater condition. Recently, increased attention has been directed on the use of biological technologies for the removal of radionuclides as the cheap and eco-friendly alternative to the non-biological methods. Metal including radioactive compounds uptake by microorganisms can be occurred by metabolism –independent and/or -dependent processes. One involves biosorption based on the ability of microbial cells to bind dissolved metals; on the other involves bioaccumulation, which depends on the metabolic ability of cells to transport metals into the cytoplasm. The purpose of this work is to investigate the feasibility of microalgae in bioaccumulation system to remove cesium from solution. The effect of different environmental parameters on cesium removal was also examined.

  1. Thermochemical evaluation and preparation of cesium uranates

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Seichi; Ohashi, Hiroshi

    1997-03-01

    Two kinds of cesium uranates, Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7}, which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U{sub 3}O{sub 8} and Cs{sub 2}CO{sub 3} for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  2. Use of cesium-137 to assess soil erosion rates under soybean, coffee and pasture

    International Nuclear Information System (INIS)

    Andrello, A.C.; Appoloni, C.R.; Guimaraes, M.F.

    2003-01-01

    The methodology cesium-137 was used to assess soil erosion and deposition rates in a small watershed with varied crops, at 23 deg 16' S and 51 deg 17' W, in a district of Cambe, Parana State, Brazil. A theoretical equation which considers soil loss or gain directly proportional to the cesium-137 redistribution was utilized in this study. In the watershed, soil redistribution was assessed by transect sampling, and the regional input of cesium-137 by radioactive rainfall determined based on samples from a point in the native forest. Most sampled pasture points presented soil loss, as well as the points in the soybean area under conventional tillage, while in the coffee crop there was neither soil loss nor gain. (author)

  3. Incorporation of cesium into phosphates of apatitic and rhabdophane lattices. Application to the conditioning of separated radionuclides; Incorporation du cesium dans des phosphates de structure apatitique et rhabdophane. Application au conditionnement des radionucleides separes

    Energy Technology Data Exchange (ETDEWEB)

    Campayo, L

    2003-04-01

    Two phosphate-based materials were investigated for cesium immobilization after its partitioning from spent nuclear fuel: apatites and rhabdophanes. The incorporation of cesium into the apatitic lattice creates steric stresses. These stresses induce the formation of secondary phases which are rapidly leached. The effectiveness of the cesium immobilization in this material is not therefore validated. A second phosphate CsCaNd(PO{sub 4}){sub 2} was consistently found at the end of the leach test and its properties were further characterized. The structure of CsCaNd(PO{sub 4}){sub 2}, which is rhabdophane-like, is made of large channels which enable the incorporation of the largest alkaline cations. The synthesis involves two intermediates: the monazite, NdPO{sub 4}, and a soluble phosphate, CsCaPO{sub 4}. The study of a rhabdophane with 10 wt.% of cesium reveals satisfactory intrinsic properties: a thermal stability up to 1100 C and a leach rate of 10{sup -2} g/(m{sup 2}.d). The next step will be to improve the reaction yield. (author)

  4. 40 CFR 141.400 - General requirements and applicability.

    Science.gov (United States)

    2010-07-01

    ... system with fecally contaminated source water or with significant deficiencies subject to the treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements and applicability. 141.400 Section 141.400 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

  5. Strontium-90 and cesium-137 in tea (Japanese tea)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in tea (Japanese tea) were determined. Five hundred grams of manufactured green tea was collected from six sampling locations in Japan. The results are shown in a table. (Namekawa, K.)

  6. Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.

    1996-06-01

    At Los Alamos National Laboratory, cesium-137 ({sup 137}Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles {<=}2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of {sup 137}Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of {sup 137}Cs.

  7. 25 CFR 141.27 - Trade in imitation Indian crafts prohibited.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Trade in imitation Indian crafts prohibited. 141.27 Section 141.27 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.27 Trade in imitation...

  8. Cadmium, lead, mercury and 137cesium in fruticose lichens of northern Quebec

    International Nuclear Information System (INIS)

    Crete, M.; Zikovsky, L.

    1992-01-01

    Cadmium, lead and mercury concentration averaged 0.171, 4.09 and 0.09 μg·g -1 (dry wt.) in terrestrial lichens over a 640000-km 2 study area of northern Quebec; average cesium level reached 378 Bq·kg -1 (dry wt.). Cadmium and lead were the most closely related pollutants in lichens, while there was little relationship between 137 Cs and the 3 trace metals. Distribution of elements over the territory was not uniform and the altitude influenced 3 of them. The cesium concentration increased along with this variable, while lead levels were higher in the middle altitude class (200-400 m) than in the 2 other classes. There was a significant interaction between altitude and biome for mercury concentration, this element being almost twice more abundant in tundra below 400m than in forest tundra and boreal forest. Mercury level was related to percent ground cover by Alectoria ochroleuca, Cornicularia divergens and Cetraria nivalis, 3 lichen species typical of a wind-exposed habitat. Lead concentration was related only to Cornicularia divergens ground cover. In general concentration of cadmium, lead and mercury was higher in the northwest quarter of the study area than elsewhere, while cesium contamination was highest in the southeast quarter. It seems preferable that caribou should be harvested at low elevation when they are taken in winter in order to minimize the risk associated with cesium consumption by humans. (author). 37 refs.; 2 figs.; 5 tabs

  9. Strontium-90 and cesium-137 in total diet

    International Nuclear Information System (INIS)

    1977-01-01

    Under the commission of Science and Technology Agency, Japan Chemical Analysis Center has analysed total diet samples collected from 30 prefectures (2 times per year), and determined to content of strontium-90 and cesium-137 in these samples. Each Prefectural public health laboratories and institutes have collected all the daily regular diet consumed for five persons, namely three meals and other eating between meals, for radiochemical analysis in polyethylene containers. These samples were collected to Japan Chemical Analysis Center after carbonization without smoke rising in the large stainless dish. At Japan Chemical Analysis Center, these samples were asked in an electric muffle furnance. And the ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The nuclides were dissolved into hydrochloric acid and filtrated, after it was added with nitric acid and heated to dryness. The filtrates was analysed for strontium-90 and cesium-137 using the method recommended by Science and Technology Agency. (author)

  10. Cesium removal from liquid acidic wastes with the primary focus on ammonium molybdophosphate as an ion exchanger: A literature review

    International Nuclear Information System (INIS)

    Miller, C.J.

    1995-03-01

    Many articles have been written concerning the selective removal of cesium from both acidic and alkaline defense wastes. The majority of the work performed for cesium removal from defense wastes involves alkaline feed solutions. Several different techniques for cesium removal from acidic solutions have been evaluated such as precipitation, solvent extraction, and ion exchange. The purpose of this paper is to briefly review various techniques for cesium removal from acidic solutions. The main focus of the review will be on ion exchange techniques, particularly those involving ammonium molybdophosphate as the exchanger. The pertinent literature sources are condensed into a single document for quick reference. The information contained in this document was used as an aid in determining techniques to evaluate cesium removal from the acidic Idaho Chemical Processing Plant waste matrices. 47 refs., 2 tabs

  11. 40 CFR 141.25 - Analytical methods for radioactivity.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods for radioactivity... § 141.25 Analytical methods for radioactivity. (a) Analysis for the following contaminants shall be conducted to determine compliance with § 141.66 (radioactivity) in accordance with the methods in the...

  12. 21 CFR 150.141 - Artificially sweetened fruit jelly.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit jelly. 150.141 Section 150.141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... locust bean gum), guar gum, gum karaya, gum tragacanth, algin (sodium alginate), sodium...

  13. Separation of cesium from simulated active waste using zinc hexacyanoferrate supported composite

    International Nuclear Information System (INIS)

    Somida, H.H.; El Zahhar, A.A.; Shehata, M.K.; El Naggar, H.A.

    2003-01-01

    Potassium zinc hexacyanoferrate (KZnHCF) was prepared and supported on polyacrylonitrile (PAN) binding polymer. This composite was characterized and used to study the elimination of cesium from acidic radioactive waste containing Sr(II), Eu(II), Am(II), Zr(IV), Hf(IV) and Nb(V) using batch and column techniques. The sorption capacity of this composite for cesium was found to be 1.14 meq/g for column technique. The effect of presence of NH 4 SCN, NaNo 3 and other complexing agents in the aqueous solutions was studied

  14. Study of the removal of cesium from aqueous solutions by graphene oxide

    International Nuclear Information System (INIS)

    Bueno, Vanessa N.; Rodrigues, Debora F.; Vitta, Patricia B. Di

    2013-01-01

    Graphene oxide, used in this work, was synthesized from the oxidation of graphite by Hummer method. The experiments were performed in batch and analyzed for the following parameters: contact time, pH, cesium ion concentration in aqueous solution and removing capacity of the graphene oxide. After the experiments the samples were vacuum filtered and the remaining cesium in solution was quantified by Inductively Coupled Plasma Optical Emission Spectrometry (ICP-OES). The equilibrium was reached after 60 minutes of contact in neutral solution. The percentage of removal was around 80%

  15. Physical Property Modeling of Concentrated Cesium Eluate Solutions, Part I - Derivation of Models

    Energy Technology Data Exchange (ETDEWEB)

    Choi, A.S.; Pierce, R. A.; Edwards, T. B.; Calloway, T. B.

    2005-09-15

    Major analytes projected to be present in the Hanford Waste Treatment Plant cesium ion-exchange eluate solutions were identified from the available analytical data collected during radioactive bench-scale runs, and a test matrix of cesium eluate solutions was designed within the bounding concentrations of those analytes. A computer model simulating the semi-batch evaporation of cesium eluate solutions was run in conjunction with a multi-electrolyte aqueous system database to calculate the physical properties of each test matrix solution concentrated to the target endpoints of 80% and 100% saturation. The calculated physical properties were analyzed statistically and fitted into mathematical expressions for the bulk solubility, density, viscosity, heat capacity and volume reduction factor as a function of temperature and concentration of each major analyte in the eluate feed. The R{sup 2} of the resulting physical property models ranged from 0.89 to 0.99.

  16. Strontium-90 and cesium-137 in freshwater (from Sept. 1983 to Dec. 1983)

    International Nuclear Information System (INIS)

    1983-01-01

    Fresh water, 100 l each, was collected, and to which the carriers of strontium and cesium were added immediately after the sampling. The sample was vigorously stirred and filtered, and passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The eluate was used for radiochemical analysis. The chemical separation of strontium-90 and cesium-137 was carried out, and the chemical yields were determined. The precipitates were counted for the activity using low background beta counters normally for 60 min. The net sample counting rate was corrected for the counter efficiency, recovery, self-absorption and decay, to obtain the radioactivity per sample aliquot, and the concentrations of these nuclides in the original samples were calculated. The data at six sampling locations in Japan from September to December, 1983, on fresh water are reported. (Kako, I.)

  17. Investigations on cesium uranates. Pt. 7

    International Nuclear Information System (INIS)

    Cordfunke, E.H.P.

    1979-01-01

    The thermochemical properties of Cs 2 U 4 O 12 have been evaluated using new experimental data, including the low-temperature heat capacities, the enthalpy of formation at room temperature, and the high-temperature enthaply increments by drop calorimetry. From the results a section of the Cs-U-O phase diagram at 1000 K has been constructed showing the stability of the compound as a function of cesium and oxygen pressure. (orig.) [de

  18. Cesium migration experiments in different media

    International Nuclear Information System (INIS)

    Tello, C.C.O. de

    1992-01-01

    The environmental impact caused by the radioactive waste disposal depends on many factors, mainly on the release pathways of the radionuclides from the waste product to the environment. The migration of the radioelements through the different barriers, which compose the disposal system, is considered the main via for this release. This paper describes the experiments carried out to improve the cemented waste quality, as well to assess the cesium migration in different media. (author)

  19. Strontium-90 and cesium-137 in soil (from Jun. 1983 to Sept. 1983)

    International Nuclear Information System (INIS)

    1983-01-01

    Results are presented for the determination of strontium-90 and cesium-137 in soils in Japan. Twenty-seven sampling points were selected all over Japan from Hokkaido to Okinawa by the criteria that the points were spacious and flat without past disturbance and those located in a forest, in a stony area or inside of river banks should be avoided. Soils were taken from two layers of depth, 0 to 5 cm and 5 to 20 cm. After drying, soils were passed through a 2 mm sieve and were employed for radiochemical leaching, separation, and purification of strontium-90 or cesium-137. Radioactivity of strontium-90 or cesium-137 was determined with a low background beta counter normally for 60 minutes. Determined values are presented as pCi/kg and mCi/km 2 for two different depth layers. As for strontium-90 contents, they were ranged from 13.0 +- 3.3 pCi/kg-dry (Aomori, 5 to 20 cm) to 1300 +- 20 pCi/kg-dry (Oota, Shimane Pref., 0 to 5 cm), or from 1.1 +- 0.14 mCi/km 2 (Tsuyama, Okayama Pref., 0 to 5 cm) to 50.0 +- 1.7 mCi/km 2 (Sapporo, 5 to 20 cm). As for cesium-137 contents, they were ranged from 0.5 +- 2.2 pCi/kg-dry (Saga, 5 to 20 cm) to 4700 +- 40 pCi/kg-dry (Oota, Shimane Pref., 0 to 5 cm) or from 0.1 +- 0.42 mCi/km 2 (Saga, 5 to 20 cm) to 120.0 +- 2.0 mCi/km 2 (Oota, Shimane Pref., 5 to 20 cm), and the variance for cesium-137 values were larger than those for strontium-90. Seasonal or local tendency for the contents of the two nuclides were not clarified. (Takagi, S.)

  20. Characterization of pollucite as a material for the long term storage of cesium-137

    International Nuclear Information System (INIS)

    Strachan, D.M.; Schulz, W.W.

    1977-06-01

    Storage of nuclear waste requires materials which are thermodynamically stable. Pollucite (Cs 2 O . Al 2 O 3 . 4SiO 2 ) may be an acceptable material for the long-term storage of the purified 137 CsCl. Pollucite is made at near theoretical yields when CsCl (or any cesium salt) reacts at about 970 0 K with a montmorillonite-containing clay. Pollucite dissolves in deionized water at rates which are less than 2 x 10 -9 kg/(m 2 . s) based on cesium. Microstructural analyses show that cesium reacts with the montmorillonite clay to form ill-defined pollucite crystals which contain low concentrations of the impurities found in the clay. Although further work needs to be done, pollucite is considered to be an excellent material for the long-term storage of 137 Cs

  1. Cesium platinide hydride 4Cs{sub 2}Pt.CsH: an intermetallic double salt featuring metal anions

    Energy Technology Data Exchange (ETDEWEB)

    Smetana, Volodymyr [Ames Laboratory, US Department of Energy, and Critical Materials Institute, Ames, Iowa, 50011-3020 (United States); Mudring, Anja-Verena [Ames Laboratory, US Department of Energy, and Critical Materials Institute, Ames, Iowa, 50011-3020 (United States); Department of Materials Sciences and Engineering, Iowa State University, Ames, Iowa, 50011-3111 (United States)

    2016-11-14

    With Cs{sub 9}Pt{sub 4}H a new representative of ionic compounds featuring metal anions can be added to this rare-membered family. Cs{sub 9}Pt{sub 4}H exhibits a complex crystal structure containing Cs{sup +} cations, Pt{sup 2-} and H{sup -} anions. Being a red, transparent compound its band gap is in the visible range of the electromagnetic spectrum and the ionic type of bonding is confirmed by quantum chemical calculations. This cesium platinide hydride can formally be considered as a double salt of the ''alloy'' cesium-platinum, or better cesium platinide, Cs{sub 2}Pt, and the salt cesium hydride CsH according to Cs{sub 9}Pt{sub 4}H≡4 Cs{sub 2}Pt.CsH. (copyright 2016 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. 40 CFR 141.41 - Special monitoring for sodium.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for sodium. 141.41... and Prohibition on Lead Use § 141.41 Special monitoring for sodium. (a) Suppliers of water for... distribution system for the determination of sodium concentration levels; samples must be collected and...

  3. 40 CFR 141.134 - Reporting and recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... meeting the criterion in § 141.135(a)(2)(vi). (vi) The running annual average of source water alkalinity for systems meeting the criterion in § 141.135(a)(2)(iii) and of treated water alkalinity for systems...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Disinfectant Residuals...

  4. Behaviour of cesium in contaminated soils with and without agricultural practices

    International Nuclear Information System (INIS)

    Arapis, G.; Martinez, A.; Millan, R.; Gutierrez, J.

    1992-01-01

    The migration of cesium into affected agricultural soils, five years after the Chernobyl accident, is examined in this study. Samples of soil were taken from an undisturbed non-cultivated rural area in the north of Greece, where an important contamination has been detected. The migration of 137 Cs into these soils was measured by γ spectrometry. Slight movement of 137 Cs was observed during the five year period following the accident. The agricultural practices, used in this area from 1986 up to now, have diluted the contamination into the 0-40 cm horizon and thus only low concentration of cesium in the cultivated soils was detected. (orig.)

  5. Small Column Ion Exchange Analysis for Removal of Cesium from SRS Low Curie Salt Solutions Using Crystalline Silicotitanate (CST) Resin

    International Nuclear Information System (INIS)

    ALEMAN, SEBASTIAN

    2004-01-01

    Savannah River Technology Center (SRTC) researchers modeled ion exchange removal of cesium from dissolved salt waste solutions. The results assist in evaluating proposed configurations for an ion exchange process to remove residual cesium from low curie waste streams. A process for polishing (i.e., removing small amounts) of cesium may prove useful should supernate draining fail to meet the Low Curie Salt (LCS) target limit of 0.1 Ci of Cs-137 per gallon of salt solution. Cesium loading isotherms and column breakthrough curves for Low Curie dissolved salt solutions were computed to provide performance predictions for various column designs

  6. Removal of cesium from simulated liquid waste with countercurrent two-stage adsorption followed by microfiltration.

    Science.gov (United States)

    Han, Fei; Zhang, Guang-Hui; Gu, Ping

    2012-07-30

    Copper ferrocyanide (CuFC) was used as an adsorbent to remove cesium. Jar test results showed that the adsorption capacity of CuFC was better than that of potassium zinc hexacyanoferrate. Lab-scale tests were performed by an adsorption-microfiltration process, and the mean decontamination factor (DF) was 463 when the initial cesium concentration was 101.3μg/L, the dosage of CuFC was 40mg/L and the adsorption time was 20min. The cesium concentration in the effluent continuously decreased with the operation time, which indicated that the used adsorbent retained its adsorption capacity. To use this capacity, experiments on a countercurrent two-stage adsorption (CTA)-microfiltration (MF) process were carried out with CuFC adsorption combined with membrane separation. A calculation method for determining the cesium concentration in the effluent was given, and batch tests in a pressure cup were performed to verify the calculated method. The results showed that the experimental values fitted well with the calculated values in the CTA-MF process. The mean DF was 1123 when the dilution factor was 0.4, the initial cesium concentration was 98.75μg/L and the dosage of CuFC and adsorption time were the same as those used in the lab-scale test. The DF obtained by CTA-MF process was more than three times higher than the single-stage adsorption in the jar test. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Cesium sorption from concentrated acidic tank wastes using ammonium molybdophosphate-polyacrylonitrile composite sorbents

    International Nuclear Information System (INIS)

    Todd, T.A.; Mann, N.R.; Tranter, T.J.; Sebesta, F.; John, J.; Motl, A.

    2002-01-01

    Ammonium molybdophosphate-polyacrylonitrile (AMP-PAN) composite sorbents have been evaluated for the removal of cesium from Idaho National Engineering and Environmental Laboratory (INEEL) concentrated acidic tank waste. Batch contacts were performed to qualitatively evaluate the effects of increased nitric acid, sodium and potassium. An equilibrium isotherm was generated with simulated concentrated tank waste solutions and fit to the Langmuir equation. Additional batch contact experiments were performed to determine if mercury, plutonium and americium would sorb onto AMP-PAN. Dynamic sorption was evaluated in column tests employing 1.5 cm 3 columns operating at 5, 10 and 20 bed volumes of flow per hour. Results indicate, as expected, that dynamic cesium sorption capacity is reduced as the flowrate is increased. Calculated dynamic capacities for cesium were 22.5, 19.8 and 19.6 mg Cs/g sorbent, for 5, 10 and 20 bed volume per hour flows, respectively. The thermal stability of loaded AMP-PAN was evaluated by performing thermogravimetric analysis (TGA) on samples of AMP, PAN (polymer), and AMP-PAN. Results indicate that AMP-PAN is stable to 400 deg C, with less than a 10% loss of weight, which is at least partially due to loss of water of hydration. The evaluation of AMP-PAN indicates that it will effectively remove cesium from concentrated acidic tank waste solutions. (author)

  8. Hydrological methods preferentially recover cesium from nuclear waste salt cake

    International Nuclear Information System (INIS)

    Brooke, J.N.; Hamm, L.L.

    1997-01-01

    The Savannah River Site is treating high level radioactive waste in the form of insoluble solids (sludge), crystallized salt (salt cake), and salt solutions. High costs and operational concerns have prompted DOE to look for ways to improve the salt cake treatment process. A numerical model was developed to evaluate the feasibility of pump and treat technology for extracting cesium from salt cake. A modified version of the VAM3DCG code was used to first establish a steady-state flow field, then to simulate 30 days of operation. Simulation results suggest that efficient cesium extraction can be obtained with low displacement volumes. The actual extraction process will probably be less impressive because of nonuniform properties. 2 refs., 2 figs

  9. Modelling the release behaviour of cesium during severe fuel degradation

    International Nuclear Information System (INIS)

    Lewis, B.J.; Andre, B.; Morel, B.

    1995-01-01

    An analytical model has been applied to describe the diffusional release of fission product cesium from Zircaloy-clad fuel under high-temperature reactor accident conditions. The present treatment accounts for the influence of the atmosphere (i.e., changing oxygen potential) on the state of fuel oxidation and the release kinetics. The effects of fuel dissolution on the volatile release behaviour (under reducing conditions) is considered in terms of earlier crucible experiments and a simple model based on bubble coalescence and transport in metal pools. The model has been used to interpret the cesium release kinetics observed in steam and hydrogen experiments at the Vertical Irradiation (VI) Facility in the Oak Ridge National Laboratory and at the HEVA/VERCORS Facility in the Commissariat a l'Energie Atomique. (author)

  10. 7 CFR 58.141 - Alternate quality control program.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Alternate quality control program. 58.141 Section 58... Service 1 Quality Specifications for Raw Milk § 58.141 Alternate quality control program. When a plant has in operation an acceptable quality program, at the producer level, which is approved by the...

  11. 25 CFR 141.14 - Trade in livestock restricted.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Trade in livestock restricted. 141.14 Section 141.14... livestock restricted. (a) No person other than an enrolled member of the tribe or any association... livestock from tribal members without a special permit issued by the Commissioner. (b) The Commissioner...

  12. Immobilization of Cesium Traps from the BN-350 Fast Reactor (Aktau, Kazakhstan)

    Energy Technology Data Exchange (ETDEWEB)

    J. A. Michelbacher; C. Knight; O. G. Romanenko; I. L. Tazhibaeva; I. L. Yakovlev; A. V. Rovneyko; V. I. Maev; D. Wells; A. Herrick

    2011-03-01

    During BN-350 reactor operations and also during the initial stages of decommissioning, cesium traps were used to decontaminate the reactor’s primary sodium coolant. Two different types of carbon-based trap were used – the MAVR series, low ash granulated graphite adsorber (LAG) contained in a carrier designed to be inserted into the reactor core during shutdown; and a series of ex-reactor trap accumulators(TAs) which used reticulated vitreous carbon (RVC) to reduce Cs-137 levels in the sodium after final reactor shutdown. In total four MAVRs and seven TAs were used at BN-350 to remove an estimated cumulative 755 TBq of cesium. The traps, which also contain residual sodium, need to be immobilized in an appropriate way to allow them to be consigned as waste packages for long term storage and, ultimately, disposal. The present paper reports on the current status of the implementation phase, with particular reference to the work done to date on the trap accumulators, which have the most similarity with the cesium traps used at other reactors.

  13. Sorption behavior of cesium on various soils under different pH levels

    International Nuclear Information System (INIS)

    Giannakopoulou, F.; Haidouti, C.; Chronopoulou, A.; Gasparatos, D.

    2007-01-01

    In the present study we investigated the sorption behavior of Cs in four different soils (sandyloam, loam, clayloam and clay) by using batch experiment. Cs sorption characteristics of the studied soils were examined at 4 mg L -1 Cs concentration, at various pH levels, at room temperature and with 0.01 M CaCl 2 as a background electrolyte. Among different soils the decrease of k d (distribution coefficient) of cesium, at all pH levels, followed the sequence sandyloam > loam > clayloam > clay, indicating that the particle size fractions and especially the clay content plays predominant role on sorption of Cs. The effect of pH on cesium sorption displays a similar pattern for all soils, depending on soil type. At acid pH levels less cesium was sorbed, due to a greater competition with other cations for available sorption sites. The maximum sorption of Cs was observed at pH 8, where the negative charge density on the surface of the absorbents was the highest. For all soils was observed significantly lower Cs sorption at pH 10

  14. Sorption and desorption of cesium and strontium on TA-2 and TA-41 soils and sediments

    International Nuclear Information System (INIS)

    Kung, K. Stephen; Li, Benjamin W.; Longmire, P.A.; Fowler, M.M.

    1996-04-01

    Current environmental monitoring has detected radioactive contaminants in alluvial groundwater, soils, and sediments in the TA-2 and TA-41 areas along the north central edge of Los Alamos National Laboratory. Because of this contamination, this study was initiated. The objective of this study is to quantify the sorptivity of cesium and strontium onto TA-2 and TA-41 site specific soil samples under a controlled environment in the laboratory. The purposes of this work are to determine cesium and strontium sorption coefficient for these sit specific soils and to evaluate the potential transport of cesium and strontium. Based on this information, a risk assessment and remediation strategy can be developed

  15. Behaviour of cesium 134 and 137 in lake ecosystems

    International Nuclear Information System (INIS)

    Huebel, K.; Saenger, W.; Luensmann, W.

    1989-01-01

    The time dependent cesium activity concentration observed in surface water samples from South Bavarian lakes after the Chernobyl accident is analysed by use of a two-compartment model simulating the accidental transport of radiocesium from surface water to suspended particles. (orig.)

  16. 40 CFR 141.63 - Maximum contaminant levels (MCLs) for microbiological contaminants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels (MCLs) for microbiological contaminants. 141.63 Section 141.63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.63 Maximum...

  17. 40 CFR 141.403 - Treatment technique requirements for ground water systems.

    Science.gov (United States)

    2010-07-01

    ... ground water systems. 141.403 Section 141.403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Ground Water Rule § 141... customer as follows: (i) Chemical disinfection—(A) Ground water systems serving greater than 3,300 people...

  18. High Chloride Doping Levels Stabilize the Perovskite Phase of Cesium Lead Iodide.

    Science.gov (United States)

    Dastidar, Subham; Egger, David A; Tan, Liang Z; Cromer, Samuel B; Dillon, Andrew D; Liu, Shi; Kronik, Leeor; Rappe, Andrew M; Fafarman, Aaron T

    2016-06-08

    Cesium lead iodide possesses an excellent combination of band gap and absorption coefficient for photovoltaic applications in its perovskite phase. However, this is not its equilibrium structure under ambient conditions. In air, at ambient temperature it rapidly transforms to a nonfunctional, so-called yellow phase. Here we show that chloride doping, particularly at levels near the solubility limit for chloride in a cesium lead iodide host, provides a new approach to stabilizing the functional perovskite phase. In order to achieve high doping levels, we first co-deposit colloidal nanocrystals of pure cesium lead chloride and cesium lead iodide, thereby ensuring nanometer-scale mixing even at compositions that potentially exceed the bulk miscibility of the two phases. The resulting nanocrystal solid is subsequently fused into a polycrystalline thin film by chemically induced, room-temperature sintering. Spectroscopy and X-ray diffraction indicate that the chloride is further dispersed during sintering and a polycrystalline mixed phase is formed. Using density functional theory (DFT) methods in conjunction with nudged elastic band techniques, low-energy pathways for interstitial chlorine diffusion into a majority-iodide lattice were identified, consistent with the facile diffusion and fast halide exchange reactions observed. By comparison to DFT-calculated values (with the PBE exchange-correlation functional), the relative change in band gap and the lattice contraction are shown to be consistent with a Cl/I ratio of a few percent in the mixed phase. At these incorporation levels, the half-life of the functional perovskite phase in a humid atmosphere increases by more than an order of magnitude.

  19. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences; Localisation moleculaire de l'americium, du technetium et du cesium chez des animaux marins comestibles leur comportement metabolique et ses consequences

    Energy Technology Data Exchange (ETDEWEB)

    Pieri, J; Goudard, F; Milcent, M C [Laboratoire de Biochimie et Radiochimie, Faculte des Sciences et des Techniques, Nantes Cedex (France)

    1992-07-01

    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  20. Cesium diffusion in graphite

    International Nuclear Information System (INIS)

    Evans, R.B. III; Davis, W. Jr.; Sutton, A.L. Jr.

    1980-05-01

    Experiments on diffusion of 137 Cs in five types of graphite were performed. The document provides a completion of the report that was started and includes a presentation of all of the diffusion data, previously unpublished. Except for data on mass transfer of 137 Cs in the Hawker-Siddeley graphite, analyses of experimental results were initiated but not completed. The mass transfer process of cesium in HS-1-1 graphite at 600 to 1000 0 C in a helium atmosphere is essentially pure diffusion wherein values of (E/epsilon) and ΔE of the equation D/epsilon = (D/epsilon) 0 exp [-ΔE/RT] are about 4 x 10 -2 cm 2 /s and 30 kcal/mole, respectively

  1. Fine Structure in Proton Emission from the Deformed 141g.sHo and 141mHo

    International Nuclear Information System (INIS)

    Karny, M.; Rykaczewski, Krzysztof Piotr; Grzywacz, R.; Batchelder, J.C.; Bingham, C.R.; Goodin, C. T.; Gross, Carl J.; Hamilton, J.H.; Korgul, A.; Krolas, W.; Liddick, S. N.; Li, K.; Maier, Karl; Mazzocchi, C.; Piechaczek, A.; Shapira, Dan; Simpson, D.; Tantawy, M.N.; Winger, J.A.; Yu, Chang-Hong; Zganjar, E. F.

    2007-01-01

    Fine structure in proton emission from the deformed states 141g.s Ho (T 1/2 = 4.1 ms) and 141 mHo (T 1/2 = 7.4 (micro)s) has been discovered at Oak Ridge by detecting fusion evaporation residues with the Recoil Mass Spectrometer, Si-detectors and digital signal processing electronics. The branching ratios to the first 2 + excited state in 140 Dy were measured to be I p g.s. (2 + ) = 0.9±0.1% and I p m (2 + ) = 1.7±0.5%. A comparison of the available calculations to the experimental values calls for further development of the theoretical models

  2. Chernobyl cesium in the soil of Montenegro, eight years after the accident

    International Nuclear Information System (INIS)

    Borisov, G. I.; Kuzmic, V. V.; Vukotic, P.; Dapcevic, S.; Antovic, N.; Mirkovic, M.; Fustic, B.

    1996-01-01

    Radioactive cesium contamination of the territory of Montenegro is measured by in situ method of semiconductor gamma-spectrometry at the end of the end of the year 1994. On basis of geological and pedological characteristics of the region, 42 measurement sites are chosen, which are representative for large area and uniformly distributed over the territory of Republic. It is found that degree of contamination varies strongly from region to region. Surface activities of 137 Cs span 3700 to 74000 Bq/m 2 range. Radioactive cesium is mostly remained in the surface part of uncultivated soil. 14 refs.; 3 figs

  3. Intercomparison of numerical simulations on oceanic dispersion of the radioactive cesium released because of the Fukushima disaster

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, H.; Kobayshi, T.; Furuno, A. [Japan Atomic Energy Agency, Ibaraki (Japan); Usui, N.; Kamachi, M. [Japan Meteorological Agency, Meteorological Research Inst., Ibaraki (Japan); Nishikawa, S.; Ishikawa, Y. [Japan Agency for Marine-Earth Science and Tech., Kanagawa (Japan)

    2014-07-01

    We conducted numerical simulations on oceanic dispersion of the radioactive cesium released because of the Fukushima disaster in the North Pacific. Two independent oceanic reanalysis data were used in the simulations. Both simulations suggested that the {sup 137}Cs concentration had been reduced to the pre-Fukushima level around 2.5 years after the disaster. The intercomparison revealed that meso-scale eddies accompanied by the Kuroshio Extension may have efficiently diluted the radioactive cesium at the sea surface. The meso-scale eddies also played an important role in transporting the surface radioactive cesium into the intermediate layer. (author)

  4. Studies on the feasibility of using crystalline silicotitanates for the separation of cesium-137 from fast reactor high-level liquid waste

    International Nuclear Information System (INIS)

    Venkatesan, K.A.; Sukumaran, V.; Antony, M.P.; Srinivasan, T.G.

    2009-01-01

    The commercially available crystalline silicotitanate inorganic ion xchanger, IONSIV IE-911, and its parent precursor, TAM-5, have been valuated for the removal of 137 Cs from nitric acid medium and simulated high-level liquid waste. The distribution coefficient (K d ) of cesium ecreased with increasing nitric acid concentration and at 3.0 M nitric acid, distribution coefficient of 1150 mL/g and 2600 mL/g were obtained for ONSIV IE-911 and TAM-5, respectively. Rapid uptake of cesium followed by the establishment of equilibrium occurring within three hours. Loading of cesium n ion exchangers increased with the increase in the concentration of cesium n aqueous phase and from Langmuir adsorption model the apparent capacity of cesium was 69 mg/g and 82 mg/g for IONSIV IE-911 and TAM-5, respectively. The performance of the sorbent under dynamic conditions was assessed by following breakthrough (BT) curve up to C/C o = 1, where C and C o are the concentrations of cesium in the effluent and feed, respectively. (author)

  5. Evaluation of selected ion exchangers for the removal of cesium from MVST W-25 supernate

    International Nuclear Information System (INIS)

    Collins, J.L.; Egan, B.Z.; Anderson, K.K.; Chase, C.W.; Mrochek, J.E.; Bell, J.T.; Jernigan, G.E.

    1995-04-01

    The goal of this batch-test equilibration study was to evaluate the effectiveness of certain ion exchangers for removing cesium from supernate taken from tank W-25 of the Melton Valley Storage Tank (MVST) Facility located at the Oak Ridge National Laboratory (ORNL). These exchangers were selective for removing cesium from alkaline supernatant solutions with high salt concentrations. Since the supernates of evaporator concentrates stored in tanks at the MVST facility have compositions similar to some of those stored in tanks at Hanford, the data generated in this study should prove useful in the overall evaluation of the ion exchangers for applications to Hanford and other US Department of Energy (USDOE) sites. A goal of the waste processing effort at Hanford is to remove enough cesium to ensure that the resulting LLW will meet the Nuclear Regulatory Commission (NRC) 10 CFR 61 class A limit for 137 Cs (1 Ci/m 3 or 1 μCi/mL). The separated cesium may be concentrated and vitrified for disposal in the high-level waste repository. The decontaminated effluent would be solidified for near-surface disposal

  6. Cesium-incorporated indium-tin-oxide films for use as a cathode with low work function for a transparent organic light-emitting device

    International Nuclear Information System (INIS)

    Uchida, Takayuki; Mimura, Toshifumi; Ohtsuka, Masao; Otomo, Toshio; Ide, Mieko; Shida, Azusa; Sawada, Yutaka

    2006-01-01

    Transparent organic light-emitting devices (TOLEDs) were successfully fabricated utilizing a novel transparent conducting cathode with low work function. Cesium-incorporated indium-tin-oxide film was deposited on the organic layers with negligible damage by simultaneous operation of RF magnetron sputtering using an ITO target and vacuum evaporation of metallic cesium. Incorporation of cesium in the ITO film was confirmed by XPS analysis. The work function (4.3 eV) determined by photoelectron spectroscopy in air (PESA) was lower than that of 0.3-0.4-eV without cesium-incorporation and stable under the atmospheric environment. The electron injection efficiency of cesium-incorporated ITO cathode in the present transparent OLED fabricated was comparable to that of the previous double-layered structure comprising of ITO cathode and an organic buffer layer (BCP) doped by evaporation of cesium [T. Uchida, S. Kaneta, M. Ichihara, M. Ohtsuka, T. Otomo, D.R. Marx, Jpn. J. Appl. Phys., 44, No. 9 (2005) L282

  7. Sorption of iodine, chlorine, technetium and cesium in soil

    International Nuclear Information System (INIS)

    Soederlund, M.; Lusa, M.; Lehto, J.; Hakanen, M.; Vaaramaa, K.

    2011-01-01

    The safety assessment of final disposal of spent nuclear fuel will include an estimate for the behavior of waste nuclides in the biosphere. As a part of this estimate also the sorption of radioactive iodine, chlorine, technetium and cesium in soil is to be considered. The chemistry and the sorption of these radionuclides in soils are described in this literature survey. Behavior of I-129, Cl-36 and Tc-99 in the environment is of great interest because of their long half-lives and relatively high mobilities. The importance of Cs-135 arises from its high content in spent nuclear fuel and long physical half-life, even though it is considered relatively immobile in soil. Factors affecting the migration and sorption of radionuclides in soils can be divided into elemental and soil specific parameters. The most important elemental factor is the speciation of the element, which is influenced by the soil redox potential, pH and complex forming ligands. Soil micro-organisms can either serve as sorbents for radionuclides or affect their speciation by altering the prevailing soil redox conditions. Soil organic matter content and mineral properties have a marked influence on the retention of radionuclides. The sorption of anionic radionuclides such as I-, Cl- and TcO 4 - is pronounced in the presence of organic matter. Clay minerals are known to bound cesium effectively. The effect of speciation of radioactive iodine, chlorine, technetium and cesium in soil is considered in this study, as well as the effect of soil micro-organisms, organic matter and mineral properties. (orig.)

  8. Hyperfine structure, nuclear spins and magnetic moments of some cesium isotopes

    International Nuclear Information System (INIS)

    Ekstroem, C.; Ingelman, S.; Wannberg, G.

    1977-03-01

    Using an atomic-beam magnetic resonance apparatus connected on-line with the ISOLDE isotope separator, CERN, hyperfine structure measurements have been performed in the 2 Ssub(1/2) electronic ground state of some cesium isotopes. An on-line oven system which efficiently converts a mass separated ion-beam of alkali isotopes to an atomic beam is described in some detail. Experimentally determined nuclear spins of sup(120, 121, 121m, 122, 122m, 123, 124, 126, 128, 130m, 135m)Cs and magnetic moments of sup(122, 123, 124, 126, 128, 130)Cs are reported and discussed in terms of different nuclear models. The experimental data indicate deformed nuclear shapes of the lightest cesium isotopes. (Auth.)

  9. Preliminary Ion Exchange Modeling for Removal of Cesium from Hanford Waste Using SuperLig 644 Resin

    International Nuclear Information System (INIS)

    Hamm, L.L.

    2000-01-01

    A proposed facility is being designed for the immobilization of Hanford high-level radioactive waste. One unit process in the facility is designed to remove radioactive cesium by ion-exchange from the strongly alkaline aqueous phase. A resin specifically designed with high selectivity of cesium under alkaline conditions is being investigated. The resin also is elutable under more acidic conditions. The proposed design of the facility consists of two sets of two packed columns placed in series (i.e., a lead column followed by a lag (guard) column configuration). During operation, upon reaching a specified cesium concentration criterion at the exit of the lag column, operation is switched to the second set of lead and lag columns. The cesium-loaded lead column is processed (i.e., washed and eluted) and switched to the lag position. the previous lag column is then placed in the lead position (without eluting) and the system is ready for use in the next cycle. For a well designed process, the loading and elution processes result in significant volume reductions in aqueous high-level waste

  10. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences

    International Nuclear Information System (INIS)

    Pieri, J.; Goudard, F.; Milcent, M.C.

    1992-01-01

    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  11. Radiochemical determination of strontium-90 and cesium-137 in waters of the Pacific Ocean and its neighboring seas

    International Nuclear Information System (INIS)

    Borisenko, G.S.; Kandinskii, P.A.; Gedeonov, L.I.; Ivanova, L.M.; Petrov, A.A.

    1987-01-01

    Depending on the salinity of the water, two versions of strontium-90 and cesium-137 concentration from water samples are presented. Cesium-137 was concentrated by precipitating sparingly soluble mixed hexacyanoferrates (II), and strontium-90 by precipitating carbonates together with calcium. A scheme has been given for radiochemical analysis of the concentrates. Strontium-90 and cesium-137 contents in the waters of the Pacific Ocean and its neighboring seas have been determined by the radiochemical method described. The levels of radionuclide content in the water and atmospheric precipitations have been shown to be inter-related. Strontium-90 and cesium-137 contents in the surface water of the northwestern Pacific were found to be much lower in 1980 than in the early seventies. The area of technogenic radioactive pollution was found to persist in the region of the Columbia mouth into the Pacific Ocean

  12. Removal of cesium using coconut fiber in raw and modified forms for the treatment of radioactive liquid wastes

    International Nuclear Information System (INIS)

    Jesus, Nella N.M. de; Nobre, Vanessa B.; Potiens Junior, Ademar J.; Sakata, Solange K.; Di Vitta, Patricia B.

    2013-01-01

    Sorption is one of the most studied methods to reduce the volume of radioactive waste streams. Cesium-137 is a radioisotope formed by the fission of uranium and it can cause health problems due to its easy assimilation by cells. The aim of this study is to evaluate the potential of coconut fiber in removing cesium from radioactive liquid wastes; this process can help in disposing radioactive waste. The experiments were performed in batch and the particle size of the fiber ranged between 0.30 mm and 0.50 mm. The fiber was treated with hydrogen peroxide in alkaline medium. The following parameters were analyzed: contact time, pH and concentration of cesium ions in aqueous solution. After the experiments the samples were filtered and cesium remaining in solution was quantified by inductively coupled plasma optical emission spectrometry. (author)

  13. Removal of cesium using coconut fiber in raw and modified forms for the treatment of radioactive liquid wastes

    Energy Technology Data Exchange (ETDEWEB)

    Jesus, Nella N.M. de; Nobre, Vanessa B.; Potiens Junior, Ademar J.; Sakata, Solange K., E-mail: sksakata@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Di Vitta, Patricia B. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Quimica

    2013-07-01

    Sorption is one of the most studied methods to reduce the volume of radioactive waste streams. Cesium-137 is a radioisotope formed by the fission of uranium and it can cause health problems due to its easy assimilation by cells. The aim of this study is to evaluate the potential of coconut fiber in removing cesium from radioactive liquid wastes; this process can help in disposing radioactive waste. The experiments were performed in batch and the particle size of the fiber ranged between 0.30 mm and 0.50 mm. The fiber was treated with hydrogen peroxide in alkaline medium. The following parameters were analyzed: contact time, pH and concentration of cesium ions in aqueous solution. After the experiments the samples were filtered and cesium remaining in solution was quantified by inductively coupled plasma optical emission spectrometry. (author)

  14. Iotech cesium capsule recovery abstract

    International Nuclear Information System (INIS)

    Stevens, J.; Higgins, D.

    1996-01-01

    This report has been prepared to detail the project operations performed by OHM Remediation Services Corp. (OHM) under contract to the Westinghouse Hanford Company (WHC) for the removal and transfer of 309 cesium sources from the lotech Inc. Facility in Northglenn, Colorado, to the Department of Energy Site in Hanford, Washington. The activities covered by this report were performed between October of 1993 and August of 1995. The report includes the following major sections: (1) Project Description, (2) Project Organization, (3) Major Project Tasks, (4) Industrial and Radiological Safety, (5) Personnel Exposures, (6) Quality Assurance, (7) Scheduling/Costs, and (8) Lessons Learned

  15. Recent development on the synthesis of calixcrowns and their application for cesium removal from high-level liquid waste

    International Nuclear Information System (INIS)

    Zhu Xiaowen; Gao Jianxun; Wang Jianchen; Yu Bo; Song Chongli

    2002-01-01

    The synthesis, extraction properties and molecular modeling of calixcrowns in concern of cesium removal is reviewed briefly. In particular, calix [4] crown-6 and some of its derivatives have been shown to be highly selective extractants for cesium ions

  16. Design alternatives report for the cesium removal demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Walker, J.F. Jr.; Youngblood, E.L.

    1995-09-01

    The Cesium Removal Demonstration (CRD) project will use liquid low-level waste (LLLW) stored in the Oak Ridge National Laboratory Melton Valley Storage Tanks to demonstrate cesium removal from sodium nitrate-based supernates. This report presents the results of a conceptual design study to scope the alternatives for conducting the demonstration at ORNL. Factors considered included (1) sorbent alternatives, (2) facility alternatives, (3) process alternatives, (4) process disposal alternatives, and (5) relative cost comparisons. Recommendations included (1) that design of the CRD system move forward based on information obtained to date from tests with Savannah River Resin, (2) that the CRD system be designed so it could use crystalline silicotitanates (CST) if an engineered form of CST becomes available prior to the CRD, (3) that the system be designed without the capability for resin regeneration, (4) that the LLLW solidification facility be used for the demonstration (5) that vitrification of the loaded resins from the CRD be demonstrated at the Savannah River Site, and (6) that permanent disposal of the loaded and/or vitrified resin at the Nevada Test Site be pursued.

  17. Design alternatives report for the cesium removal demonstration

    International Nuclear Information System (INIS)

    Walker, J.F. Jr.; Youngblood, E.L.

    1995-09-01

    The Cesium Removal Demonstration (CRD) project will use liquid low-level waste (LLLW) stored in the Oak Ridge National Laboratory Melton Valley Storage Tanks to demonstrate cesium removal from sodium nitrate-based supernates. This report presents the results of a conceptual design study to scope the alternatives for conducting the demonstration at ORNL. Factors considered included (1) sorbent alternatives, (2) facility alternatives, (3) process alternatives, (4) process disposal alternatives, and (5) relative cost comparisons. Recommendations included (1) that design of the CRD system move forward based on information obtained to date from tests with Savannah River Resin, (2) that the CRD system be designed so it could use crystalline silicotitanates (CST) if an engineered form of CST becomes available prior to the CRD, (3) that the system be designed without the capability for resin regeneration, (4) that the LLLW solidification facility be used for the demonstration (5) that vitrification of the loaded resins from the CRD be demonstrated at the Savannah River Site, and (6) that permanent disposal of the loaded and/or vitrified resin at the Nevada Test Site be pursued

  18. 40 CFR 141.13 - Maximum contaminant levels for turbidity.

    Science.gov (United States)

    2010-07-01

    ... turbidity. 141.13 Section 141.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Maximum contaminant levels for turbidity. The maximum contaminant levels for turbidity are applicable to... part. The maximum contaminant levels for turbidity in drinking water, measured at a representative...

  19. The effect of fertilizer application on 137 cesium accumulation in lucerne grown on a leached chernozem

    International Nuclear Information System (INIS)

    Konstantinov, G.; Kovachev, K.; Penchev, D.; Ermolaev, I.; Mirchev, M.

    1974-01-01

    On the basis of pot experiments, carried out in a glass-house the following conclusions on the effect of fertilizer application are made: nitrogen fertilizer application increases the amount of radioactive cesium in lucerne plants. Phosphorus fertilizer introduction, similarly to potassium fertilizer application decreases cesium uptake, resulting in an increase in available phosphorus in the soil. (M.Ts.)

  20. Evaluation of physicochemical properties of radioactive cesium in municipal solid waste incineration fly ash by particle size classification and leaching tests.

    Science.gov (United States)

    Fujii, Kengo; Ochi, Kotaro; Ohbuchi, Atsushi; Koike, Yuya

    2018-07-01

    After the Fukushima Daiichi-Nuclear Power Plant accident, environmental recovery was a major issue because a considerable amount of municipal solid waste incineration (MSWI) fly ash was highly contaminated with radioactive cesium. To the best of our knowledge, only a few studies have evaluated the detailed physicochemical properties of radioactive cesium in MSWI fly ash to propose an effective method for the solidification and reuse of MSWI fly ash. In this study, MSWI fly ash was sampled in Fukushima Prefecture. The physicochemical properties of radioactive cesium in MSWI fly ash were evaluated by particle size classification (less than 25, 25-45, 45-100, 100-300, 300-500, and greater than 500 μm) and the Japanese leaching test No. 13 called "JLT-13". These results obtained from the classification of fly ash indicated that the activity concentration of radioactive cesium and the content of the coexisting matter (i.e., chloride and potassium) temporarily change in response to the particle size of fly ash. X-ray diffraction results indicated that water-soluble radioactive cesium exists as CsCl because of the cooling process and that insoluble cesium is bound to the inner sphere of amorphous matter. These results indicated that the distribution of radioactive cesium depends on the characteristics of MSWI fly ash. Copyright © 2018 Elsevier Ltd. All rights reserved.

  1. Effect of K-fertilization, liming and placement on crop uptake of cesium and strontium

    International Nuclear Information System (INIS)

    Haak, E.

    1985-01-01

    remedial measures to reduce crop uptake of cesium and strontium under Swedish field conditions have been investigated in micro plot experiments. For cesium the effect of K-fertilization was studied on three soils with oats, peas and mustard and, in combination with placement, on two other soils with wheat, barley and rape. For strontium the effect of liming was studied on three soils with oats, barley and peas and, in combination with placement, on two other soils with wheat, oats, barley and peas. In this paper results are summarized for the grain products. Deep placement of nuclides in combination with K-fertilization and liming reduced the crop uptake of cesium and strontium by a factor of 10 and 4, respectively. On the basis of the experimental results, the practical advantages of K-fertilization and liming, as well as deep ploughing of surface contaminated land are discussed

  2. Development of a solvent extraction process for cesium removal from SRS tank waste

    International Nuclear Information System (INIS)

    Leonard, R.A.; Conner, C.; Liberatore, M.W.; Sedlet, J.; Aase, S.B.; Vandegrift, G.F.; Delmau, L.H.; Bonnesen, P.V.; Moyer, B.A.

    2001-01-01

    An alkaline-side solvent extraction process was developed for cesium removal from Savannah River Site (SRS) tank waste. The process was invented at Oak Ridge National Laboratory and developed and tested at Argonne National Laboratory using singlestage and multistage tests in a laboratory-scale centrifugal contactor. The dispersion number, hydraulic performance, stage efficiency, and general operability of the process flowsheet were determined. Based on these tests, further solvent development work was done. The final solvent formulation appears to be an excellent candidate for removing cesium from SRS tank waste.

  3. Sensitivity of cesium chemistry to the O/U radio in UO2+x

    International Nuclear Information System (INIS)

    McFarlane, J.; LeBlanc, J.C.; Owen, D.G.

    1995-01-01

    The effect of O/U ratio on chemical reactivity was investigated in a cesium-iodide/uranium/tungsten system at temperatures up to 2200 K. It was found that slight changes in the oxidation of the urania had a large effect on reactivity. Crushed fresh fuel samples showed little reaction with CsI; however, slightly hyperstoichiometric fuel showed considerable reaction. The tungsten participated in the reaction by removing excess oxygen from the urania, eventually leading to a cesium tungstate species that was analyzed by Fourier Transform Infrared (FTIR) and X-ray diffraction (XRD) techniques. (author)

  4. Laboratory-Scale Column Testing Using IONSIV IE-911 for Removing Cesium from Acidic Tank Waste Simulant. 2: Determination of Cesium Exchange Capacity and Effective Mass Transfer Coefficient from a 500-cm3 Column Experiment

    International Nuclear Information System (INIS)

    T.J. Tranter; R.D. Tillotson; T.A. Todd

    2005-01-01

    A semi-scale column test was performed using a commercial form of crystalline silicotitanate (CST) for removing radio-cesium from a surrogate acidic tank solution, which represents liquid waste stored at the Idaho National Engineering and Environmental Laboratory (INEEL). The engineered form of CST ion exchanger, known as IONSIVtmIE-911 (UOP, Mt. Laurel, NJ, USA), was tested in a 500-cm3 column to obtain a cesium breakthrough curve. The cesium exchange capacity of this column matched that obtained from previous testing with a 15-mc3 column. A numerical algorithm using implicit finite difference approximations was developed to solve the governing mass transport equations for the CST columns. An effective mass transfer coefficient was derived from solving these equations for previously reported 15 cm3 tests. The effective mass transfer coefficient was then used to predict the cesium breakthrough curve for the 500-cm3 column and compared to the experimental data reported in this paper. The calculated breakthrough curve showed excellent agreement with the data from the 500-cm3 column even though the interstitial velocity was a factor of two greater. Thus, this approach should provide a reasonable method for scale up to larger columns for treating actual tank waste

  5. Radioactive cesium-134 and cesium-137 measured by ChIbaraki-Kizuna No.1 in the Paleo-Kantoh great depth submarine basin

    International Nuclear Information System (INIS)

    Kimura, Kazuya; Nirei, Hisashi; Yoshida, Takeshi

    2012-01-01

    The 2011 Earthquake off the Pacific Coast of Tohoku caused serious geological disasters, on March 11th. Especially radioactive pollution by the nuclear accident at the Fukushima No. 1 nuclear power plant has the medical environmental problem. We have been researching the actual condition of that in Higashi-Kanto area by use of RT-30 (made by GEORADIS). In the result, it becomes clear that almost radiogen which diffused at a Higashi-Kantou is cesium-134 and cesium-137, and radioactive pollution is also a kind of geo-pollution. In fact, radioactive ingredients move according to mass transfer and deposition rule. For example, we verified that radiogen move and deposit on a water catchment area at a side road of Higashi-kanto Expressway in the northern Chiba prefecture. So, we must make out a unit of geological layer and characteristic features of radioactive materials when investigate and decontamination. If we do that without knowledge of geological unit and radiogen's attribution, radioactive pollution would become diffuse. Just for the record, this was written in the Katori-Narita-Itako International Declaration (IUGS-GEM). (author)

  6. 26 CFR 1.141-6 - Allocation and accounting rules.

    Science.gov (United States)

    2010-04-01

    ... 1.141-6 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-6.... Thus, allocations generally may be made using any reasonable, consistently applied accounting method...

  7. Strontium-90 and cesium-137 in fresh water

    International Nuclear Information System (INIS)

    1978-01-01

    Japan Chemical Analysis Center has analysed the strontium-90 and Cesium-137 contents in fresh water from 7 prefectures in Japan by the commission of Science and Technology Agency of Japanese Government. The method described in ''Radioactivity Survey Data in Japan No. 43 (NIRS-RSD-43, 1977) was applied to the analysis of these two radionuclides in samples. (author)

  8. Preparation and use of polymeric materials containing hydrophobic anions and plasticizers for separation of cesium and strontium

    International Nuclear Information System (INIS)

    Abney, K.D.; Kinkead, S.A.; Mason, C.F.V.; Rais, J.

    1997-01-01

    Preparation and use is described for polymeric materials containing hydrophobic anions and plasticizers for extraction of cesium and strontium. The use of polymeric materials containing plasticizers which are solvents for hydrophobic anions such as derivatives of cobalt dicarbollide or tetraphenylborate which are capable of extracting cesium and strontium ions from aqueous solutions in contact with the polymeric materials, is described. The polymeric material may also include a synergistic agent for a given ion like polyethylene glycol or a crown ether, for removal of radioactive isotopes of cesium and strontium from solutions of diverse composition and, in particular, for solutions containing large excess of sodium nitrate

  9. Transfer of radioactive cesium from soil to rape plants, rape blossoms and rape honey

    International Nuclear Information System (INIS)

    Molzahn, D.; Klepsch, A.; Assmann-Wertmueller, U.

    1989-01-01

    Due to the test of atomic weapons and the accident in the nuclear power plant at Chernobyl, the vegetation in Germany has been exposed to cesium contamination in the soil. It was to be expected that activity would migrate from soil to plants and to food products. In this work, the transfer of radioactive cesium from soil to rape plants (Brassica napus var. oleifera), rape blossoms and further to rape honey was investigated. By measuring the gamma activity of cesium using germanium detectors with measuring capacity up to 30 h per sample (limit of detection about 0.14 Bq/kg to 0.19 Bq/kg), we determined a mean transfer factor f cs = 0,116 ± 0,080 for the system soil-rape plant, f cs = 0.065 + 0.075 for the system soil-rape blossom and F!S = 0.098 + 0.044 for the system soil-rape honey (plants and honey wet mass, soil dry mass) (Table IV). Additionally, for the transfer of cesium from rape plants to rape honey, a factor of f cs = 2.04 ± 7.23 (both wet mass) was determined. Due to some environmental circumstances, which can hardly ever be taken into account, the results obtained sometimes differ considerably. Nevertheless, the mean transfer factors are within the range of values found in literature (Table V) [de

  10. Dual cesium and rubidium atomic fountain with a 10-16 level accuracy and applications

    International Nuclear Information System (INIS)

    Chapelet, F.

    2008-05-01

    Atomic fountains are the most accomplished development of the atomic clocks based on the cesium atom whose hyperfine resonance defines the SI second since 1967. Today these systems are among those which realize the second with the best accuracy. We present the last developments of the cold cesium and rubidium atom dual fountain experiment at LNE-SYRTE. This unique dual setup would allow to obtain an outstanding resolution in fundamental physics tests based on atomic transition frequency comparisons. In order to enable operation with both atomic species simultaneously, we designed, tested and implemented on the fountain new collimators which combine the laser lights corresponding to each atom. By comparing our rubidium fountain to another cesium fountain over a decade, we performed a test of the stability of the fine structure constant at the level of 5 * 10 -16 per year. We carried on the work on the clock accuracy and we focused on the phase gradients effects in the interrogation cavity and on the microwave leakage. The fountain accuracy has been evaluated to 4 * 10 -16 for the cesium clock and to 5 * 10 -16 for the refurbished rubidium clock. As a powerful instrument of metrology, our fountain was implicated in many clock comparisons and contributed many times to calibrate the International Atomic Time. Furthermore, we used the fountain to perform a new test of Lorentz local invariance. (author)

  11. Strontium-90 and cesium-137 in soil from May to July 1983

    International Nuclear Information System (INIS)

    1983-01-01

    The measured values in soil of strontium-90 and cesium-137 at a total of 4 locations throughout Japan from May to July, 1983 are given in pCi/kg and mCi/km 2 in the tables. The method of measurement is also described: collection and pretreatment of samples, preparation of the samples for analysis, separation of strontium-90 and cesium-137, determination of stable strontium, calcium and potassium, and counting. Soil was collected from the location in the spacious and flat area without any past disturbance. Soil was taken from two layers having different depths: 0--5 cm and 5--20 cm. The sample solution was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitates were counted for activity using a low background beta counter normally for 60 min. The maximum values were 690 pCi/kg for Sr-90 and 1300 pCi/kg for Cs-137, which were obtained from the samples in the 5-to-20 cm depth, in June 1983, at Akita-ken,Japan. (Mori, K.)

  12. Physical-analytical model for cesium/oxygen coadsorption on tungsten

    International Nuclear Information System (INIS)

    Rasor, N.S.

    1992-01-01

    In this paper a physical-analytical model is formulated for computing the emission and vaporization properties of a surface immersed in a multi-species vapor. The evaporation and condensation processes are assumed to be identical to those for an equilibrium adsorbed phase in equilibrium with its vapor, permitting statistical mechanical computation of the sticking coefficient for the practical non-equilibrium condensation condition. Two classes of adsorption sites are defined corresponding to superficial and interstitial coadsorption. The work function is computed by a self-consistent summation over the dipole moments of the various coadsorbed species in their mutual electric field. The model adequately describes observed emission and evaporation from tungsten surfaces immersed in pure cesium vapor and in pure oxygen vapor. Using available and estimated properties for 17 species of cesium, oxygen, tungsten and their compounds, the computed work function for tungsten immersed in Cs/O vapor is compared with limited available experimental data, and the basic phenomenology of Cs/O coadsorption electrodes is discussed

  13. 40 CFR 141.205 - Content of the public notice.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Content of the public notice. 141.205 Section 141.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS..., especially those who may not have received this notice directly (for example, people in apartments, nursing...

  14. Cesium transfer to agricultural crops for three years after Chernobyl

    International Nuclear Information System (INIS)

    Eriksson, A.; Rosen, K.

    1989-01-01

    In 1986 about 50 farms in the fallout region were selected for sampling at fixed sites of the soil surface layer and of the grassland and grain crops to come. The aim was to cover the different soil types and the farming practices of the region during studies on the transfer levels and on the change with time in transfer of cesium to the crops. It was found that the transfer level, as expected, was much higher for the grassland than for the grain crops. However, within both groups of considerable variation in the transfer level for the same year as measured by the transfer factors has occurred. For the former crops it can be concluded that the transfer factor during year 1 depends on the interception capacity of the plant cover and on the dilution by growth i.e on soil fertility and on fertilization level. In the following years the cesium TF-value for the grass cover was reduced by a factor from 2 to about 10. The reduction rate differed above all between the organic soils and the mineral soils and should largely depend on the type of the grass cover, on the different cesium fixing capacities of the two soil groups and on the potassium fertilization level. On ploughed land the transfer by root uptake to grain crops was about one magnitude lower than the transfer to the hey crops. (orig.)

  15. Kinetic and equilibrium studies of cesium adsorption on ceiling tiles from aqueous solutions.

    Science.gov (United States)

    Miah, Muhammed Yusuf; Volchek, Konstantin; Kuang, Wenxing; Tezel, F Handan

    2010-11-15

    A series of experiments were performed to quantify the adsorption of cesium on ceiling tiles as a representative of urban construction materials. Adsorption was carried out from solutions to mimic wet environmental conditions. Non-radioactive cesium chloride was used as a surrogate of the radioactive (137)Cs. The experiments were performed in the range of initial cesium concentrations of 0.114-23.9 mg L(-1) at room temperature (21°C) around three weeks. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectrometry (ICP-MS). The quantity of adsorbed Cs was calculated by mass balance as a function of time. Two kinetic and three equilibrium models were employed to interpret the test results. Determination of kinetic parameters for adsorption was carried out using the first-order reaction model and the intra-particle diffusion model. Adsorption equilibrium was studied using Langmuir, Freundlich and three-parameter Langmuir-Freundlich adsorption isotherm models. A satisfactory correlation between the experimental and the predicted values was observed. Crown Copyright © 2010. Published by Elsevier B.V. All rights reserved.

  16. Kinetic and equilibrium studies of cesium adsorption on ceiling tiles from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Volchek, Konstantin, E-mail: Konstantin.Volchek@ec.gc.ca [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Kuang, Wenxing [SAIC Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, K1N 6N5 (Canada)

    2010-11-15

    A series of experiments were performed to quantify the adsorption of cesium on ceiling tiles as a representative of urban construction materials. Adsorption was carried out from solutions to mimic wet environmental conditions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. The experiments were performed in the range of initial cesium concentrations of 0.114-23.9 mg L{sup -1} at room temperature (21 deg. C) around three weeks. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectrometry (ICP-MS). The quantity of adsorbed Cs was calculated by mass balance as a function of time. Two kinetic and three equilibrium models were employed to interpret the test results. Determination of kinetic parameters for adsorption was carried out using the first-order reaction model and the intra-particle diffusion model. Adsorption equilibrium was studied using Langmuir, Freundlich and three-parameter Langmuir-Freundlich adsorption isotherm models. A satisfactory correlation between the experimental and the predicted values was observed.

  17. Transfer equations for cesium-137 for coniferous forest understorey plant species

    International Nuclear Information System (INIS)

    Wirth, E.; Hiersche, L.; Kammerer, L.; Krajewska, G.; Krestel, R.; Mahler, S.; Roemmelt, R.

    1994-01-01

    The transfer of cesium-137 from organic soil horizons to understorey vegetation has been studied on two coniferous tree sites. In total, 14 different plants preferably taking up their nutrients from organic soil layers were taken into account. A relatively good correlation was found to exist between the transfer factor (Bq/kg plant dry wt./Bq/kg O-horizons dry wt.) for dicotyledons (r=0.51) and berry plants (r=0.63), but there was no correlation for monocotyledons (r= 0 .15). The correlations could not be improved by additionally taking potassium in plant and soil into account. These results are discussed in respect to different parameters influencing the amount of cesium-137 uptake, including plants supported by mycorrhizal fungi

  18. Phenolic cation exchange resin material for recovery of cesium and strontium

    Science.gov (United States)

    Ebra, Martha A.; Wallace, Richard M.

    1983-01-01

    A phenolic cation exchange resin with a chelating group has been prepared by reacting resorcinol with iminodiacetic acid in the presence of formaldehyde at a molar ratio of about 1:1:6. The material is highly selective for the simultaneous recovery of both cesium and strontium from aqueous alkaline solutions, such as, aqueous alkaline nuclear waste solutions. The organic resins are condensation polymers of resorcinol and formaldehyde with attached chelating groups. The column performance of the resins compares favorably with that of commercially available resins for either cesium or strontium removal. By combining Cs.sup.+ and Sr.sup.2+ removal in the same bed, the resins allow significant reduction of the size and complexity of facilities for processing nuclear waste.

  19. Strontium-90 and cesium-137 migration in trophic chain of cattle

    International Nuclear Information System (INIS)

    Zotov, V.G.; Sirotkin, A.N.; Isamov, N.N.

    1983-01-01

    Technique for determination of factors of radionuclide migration in cattle trophic chain, which can be used for forecasting probable contamination of food and cattle breeding products Under Uzbekistan conditions is suggested. It is shown that the factor of biological absorption (FBA) of strontiUm 90 by plants from grey desert soils is 3.7 times higher, than of cesium 137. Mentioned differences in soil-plants migration link are leveled and their FBA in food-milk, food-bone, food-mUscles links remain practically the same during radionuclide migration from food to milk and meat. During radionuclide migration in trophic chain of cattle in food-bone and food-muscles chains the concentration of strontium 90 in bone tissUe and cesium 137 in muscle tissue takes place

  20. Separation of cesium-137 from uranium fission products via a NeoflonR column supporting tetraphenylboron

    International Nuclear Information System (INIS)

    Whitney, C.D.; Landsberger, S.

    2009-01-01

    Cesium is a member of the Group I alkali metals, very reactive earth metals that react vigorously with both air and water. The chemistry of cesium is much like the chemistry of neighboring elements on the periodic table, potassium and rubidium. This close relation creates many problems in plant-life exposed to cesium because it is so easily confused for potassium, an essential nutrient to plants. Radioactive 134 Cs and 137 Cs are also chemically akin to potassium and stable cesium. Uptake of these radioactive isotopes from groundwater by plant-life destroys the plant-life and can potentially expose humans to the radioactive affects of 134 Cs and 137 Cs. Much experimental work has been focused on the separation of 137 Cs from uranium fission products. In previous experimental work performed a column consisting of Kel-F supporting tetraphenylboron (TPB) was utilized to separate 137 Cs from uranium fission products. It is of interest at this time to attempt the separation of 134 Cs from 0.01M EDTA using the same method and Neoflon in the place of Kel-F as the inert support. The results of this experiment give a separation efficiency of 88% and show a linear relationship between the column bed length and the separation efficiency obtained. (author)

  1. Microbial uptake of uranium, cesium, and radium

    Energy Technology Data Exchange (ETDEWEB)

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; McWhirter, D.A.

    1980-01-01

    The ability of diverse microbial species to concentrate uranium, cesium, and radium was examined. Saccharomyces cerevisiae, Pseudomonas aeruginosa, and a mixed culture of denitrifying bacteria accumulated uranium to 10 to 15% of the dry cell weight. Only a fraction of the cells in a given population had visible uranium deposits in electron micrographs. While metabolism was not required for uranium uptake, mechanistic differences in the metal uptake process were indicated. Uranium accumulated slowly (hours) on the surface of S. cerevisiae and was subject to environmental factors (i.e., temperature, pH, interfering cations and anions). In contrast, P. aeruginosa and the mixed culture of denitrifying bacteria accumulated uranium rapidly (minutes) as dense, apparently random, intracellular deposits. This very rapid accumulation has prevented us from determining whether the uptake rate during the transient between the initial and equilibrium distribution of uranium is affected by environmental conditions. However, the final equilibrium distributions are not affected by those conditions which affect uptake by S. cerevisiae. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several microbial species tested. The potential utility of microorganisms for the removal and concentration of these metals from nuclear processing wastes and several bioreactor designs for contacting microorganisms with contaminated waste streams will be discussed.

  2. Modelling of contamination of surface atmosphere for deflation of Cesium-137 on contaminated territories

    International Nuclear Information System (INIS)

    Bogdanov, A.P.; Zhmura, G.M.

    1994-01-01

    Presence of Cesium 137 in near land air is caused at the contaminated territories by 'local' dusting and transport of the dust from the zone of strong contamination. For large distance is it caused by resuspension of radioactive dust from the surface in the given region. In accordance with the models of dusting round square sources based on Gauss statistical model of dissemination of admixtures in the atmosphere, the contaminated areas of european part of the former of USSR with the density of contamination over 1 Ci/km 2 with Cesium 137 were represented by 30 round square sources covering the main spots of contamination. The results of calculation of contamination of the atmosphere for several cities of Belarus, Russia and Ukraine, where there are the permanent points of observation for the content of radionuclides in the air, have shown that the proposed model of dusting sources describes the contamination of near land air with Cesium 137 reasonably well. 7 refs., 3 tabs

  3. Crown bridged thiacalix[4]arenes as cesium-selective ionophores in solvent polymeric membrane electrodes

    International Nuclear Information System (INIS)

    Bereczki, Robert; Csokai, Viktor; Gruen, Alajos; Bitter, Istvan; Toth, Klara

    2006-01-01

    Novel 1,3-alternate thiacalix[4]mono- and biscrown-6 ethers were studied as ionophores in poly(vinyl chloride) membrane electrodes. Their selectivity behavior was characterized with respect to large number of cations, including potential interferents in environmental samples, and the membrane composition was optimized for cesium ion response. Among the ionophores, 1,3-alternate thiacalix[4]mono(crown-6) ether showed, especially high selectivity for cesium over other alkali-metal ions. Transition and heavy metal ions did not interfere seriously with the electrode response, which indicates that the bridging sulfur atoms do not take part in the ion recognition process. The potentiometric cesium responses of all electrodes involved in this study were found close to Nernstian and the detection limits were lower than 10 -7 M. The Cs + /Na + selectivity of the different ionophore-based sensors and the solvent extraction ability of the ligands were interpreted based on the respective constants of complex formation

  4. Zirconium phosphate waste forms for low-temperature stabilization of cesium-137-containing waste streams

    International Nuclear Information System (INIS)

    Singh, D.; Wagh, A.S.; Tlustochowicz.

    1996-04-01

    Novel chemically bonded phosphate ceramics are being developed and fabricated for low-temperature stabilization and solidification of waste streams that are not amenable to conventional high-temperature stabilization processes because volatiles are present in the wastes. A composite of zirconium-magnesium phosphate has been developed and shown to stabilize ash waste contaminated with a radioactive surrogate of 137 Cs. Excellent retainment of cesium in the phosphate matrix system was observed in Toxicity Characteristic Leaching Procedure tests. This was attributed to the capture of cesium in the layered zirconium phosphate structure by intercalation ion-exchange reaction. But because zirconium phosphate has low strength, a novel zirconium/magnesium phosphate composite waste form system was developed. The performance of these final waste forms, as indicated by compression strength and durability in aqueous environments, satisfy the regulatory criteria. Test results indicate that zirconium-magnesium-phosphate-based final waste forms present a viable technology for treatment and solidification of cesium-contaminated wastes

  5. CETESB's actions in Goiania in what concerns cesium-137 accident

    International Nuclear Information System (INIS)

    Penteado Filho, Azor Camargo; Derisio, Jose Carlos; Albuquerque, Antonio Martins de

    1991-01-01

    This work presents several actions performed by CETESB, the sanitary engineering agency of Sao Paulo State - Southeast Brazil, in what concerns the accident involving cesium-137 in Goiania, Goias State - Center Brazil. The adopted procedures are described in details

  6. Cesium ion exchange using actual waste: Column size considerations

    International Nuclear Information System (INIS)

    Brooks, K.P.

    1996-04-01

    It is presently planned to remove cesium from Hanford tank waste supernates and sludge wash solutions using ion exchange. To support the development of a cesium ion exchange process, laboratory experiments produced column breakthrough curves using wastes simulants in 200 mL columns. To verify the validity of the simulant tests, column runs with actual supernatants are being planned. The purpose of these actual waste tests is two-fold. First, the tests will verify that use of the simulant accurately reflects the equilibrium and rate behavior of the resin compared to actual wastes. Batch tests and column tests will be used to compare equilibrium behaviors and rate behaviors, respectively. Second, the tests will assist in clarifying the negative interactions between the actual waste and the ion exchange resin, which cannot be effectively tested with simulant. Such interactions include organic fouling of the resin and salt precipitation in the column. These effects may affect the shape of the column breakthrough curve. The reduction in column size also may change the shape of the curve, making the individual effects even more difficult to sort out. To simplify the evaluation, the changes due to column size must be either understood or eliminated. This report describes the determination of the column size for actual waste testing that best minimizes the effect of scale-down. This evaluation will provide a theoretical basis for the dimensions of the column. Experimental testing is still required before the final decision can be made. This evaluation will be confined to the study of CS-100 and R-F resins with NCAW simulant and to a limited extent DSSF waste simulant. Only the cesium loading phase has been considered

  7. Co-extraction of Strontium and Cesium by Dicyclohexano-18 Crown-6/25, 27-Bis(2- Propyloxy)Calix[4]-26, 28-Crown-6{sup ..}Cn-Octanol

    Energy Technology Data Exchange (ETDEWEB)

    Ye, W.L.; Wang, J.CH.; He, Q.G. [Institute of Nuclear and New Energy Technology, Tsinghua University, P.O. Box 1021, Beijing 102201 (China)

    2009-06-15

    The partitioning of {sup 90}Sr and {sup 137}Cs from high-level liquid waste(HLLW) is one of the important problems for the high-level waste volume reduction and the management of HLLW. The crown ether and calix-crown have the good extracting ability and selectivity to strontium and cesium respectively. Dicyclohexano-18Crown-6 (DCH18C-6) and 25, 27-Bis(2-propyloxy) Calix[4] -26, 28- Crown-6(IPR-C[4]C-6) were selected as extractants and n-octanol was selected as the common diluent to separate strontium and cesium from high-level liquid waste respectively in INET's Tsinghua University, China. But DCH18C- 6 and IPR-C[4]C-6 were used respectively in their processes to separate strontium and cesium. The strontium and cesium processes could be simplified if DCH18C-6 and IPR-C[4]C-6 processes are combined into one process to separate strontium and cesium together. In this paper, the co-extraction performance of strontium and cesium from nitric acid medium was studied by DCH18C-6 /IPR-C[4]C-6 and n-octanol as an diluent. Effects of extractant concentration, nitric concentration and temperature etc. on the extraction performance of strontium and cesium were studied. The results show that DCH18C-6 and IRP-C[4]C-6 in n-octanol has no synergistic extraction ability each other to strontium and cesium. Strontium and cesium were extracted independently by above two extractants. 0.1 mol/L DCH18C-6 and 0.025 mol/L /IPR-C[4]C-6 as extractants and n-octanol as a diluent were selected to separate strontium and cesium from HLLW. The cascade test in which was 10 stages for extraction, 2 stages for scrubbing and 8 stages for stripping was carried out on the miniature centrifugal contactor set. The results are the following: the removing ratios for strontium and cesium in the simulated HLLW were 98.93% and 99.93%, respectively; the stripping ratios of them were 99.80% and 99.79%, respectively. So the mixing extractants could be used to co-extract strontium and cesium from HLLW and

  8. Cesium-137: A physiological disruptor?

    International Nuclear Information System (INIS)

    Souidi, Maamar; Grison, Stephane; Dublineau, Isabelle; Aigueperse, Jocelyne; Lestaevel, Philippe

    2013-01-01

    Today, radiation protection is a major issue for the nuclear industry throughout the world, particularly in France. The 2011 disaster of Fukushima Dai-ichi has brought back to public attention questions about the risks associated with nuclear power for civilian purposes. The risk of accidental release of radioactive molecules, including cesium-137 ( 137 Cs), from these facilities cannot be completely eliminated. The non-cancer-related health consequences of chronic exposure to this radionuclide remain poorly understood. After absorption, cesium is distributed throughout the body. The toxicity of 137 Cs is due mainly to its radiological properties. Studies in humans report that 137 Cs impairs the immune system and induces neurological disorders. Children appear more susceptible than adults to its toxic effects. In animals, and most particularly in rodents, low-dose internal contamination disrupts the sleep-wake cycle, but without behavioural disorders. Impairment of the cardiovascular system has also been observed. Physiologic systems such as the metabolism of vitamin D, cholesterol and steroid hormones are altered, although without leading to the emergence of diseases with clinical symptoms. Recently, a metabolomics study based on contamination levels comparable to those around Chernobyl after the accident showed that it is possible to identify individual rats chronically exposed to low doses of 137 Cs, even though the exposure was too low to affect the standard clinical markers. In conclusion, the scientific evidence currently available, particularly that from experimental animal models exposed to chronic contamination, suggests that 137 Cs is likely to affect many physiologic and metabolic functions. Thus, it could contribute, with other artificial substances in the environment, to increasing the risk of developing non-cancer diseases in some regions. (authors)

  9. Evaluation of distribution coefficients for the prediction of strontium and cesium migration in a uniform sand

    International Nuclear Information System (INIS)

    Reynolds, W.D.; Gillham, R.W.; Cherry, J.A.

    1982-01-01

    The validity of using a distribution coefficient (Ksub(d)) in the mathematical prediction of strontium and cesium transport through uniform saturated sand was investigated by comparing measured breakthrough curves with curves of simulations using the advection-dispersion and the advection equations. Values for Ksub(d) were determined by batch equilibration tests and, indirectly, by fitting the mathematical model to breakthrough data from column experiments. Although the advection-dispersion equation accurately represented the breakthrough curves for two nonreactive solutes (chloride and tritium), neither it nor the advection equation provided close representations of the strontium and cesium curves. The simulated breakthrough curves for strontium and cesium were nearly symmetrical, whereas the data curves were very asymmetrical, with long tails. Column experiments with different pore-water velocities indicated that the shape of the normalized breakthrough curves was not sensitive to velocity. This suggests that the asymmetry of the measured curves was the result of nonlinear partitioning of the cations between the solid and liquid phases, rather than nonequilibrium effects. The results indicate that the distribution coefficient, when used in advection-dispersion models for prediction of the migration of strontium and cesium in field situations, can result in significant error

  10. Bentonite-Clay Waste Form for the Immobilization of Cesium and Strontium from Fuel Processing Waste Streams

    Energy Technology Data Exchange (ETDEWEB)

    Kaminski, Michael D. [Argonne National Lab. (ANL), Argonne, IL (United States); Mertz, Carol J. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-01-01

    The physical properties of a surrogate waste form containing cesium, strontium, rubidium, and barium sintered into bentonite clay were evaluated for several simulant feed streams: chlorinated cobalt dicarbollide/polyethylene glycol (CCD-PEG) strip solution, nitrate salt, and chloride salt feeds. We sintered bentonite clay samples with a loading of 30 mass% of cesium, strontium, rubidium, and barium to a density of approximately 3 g/cm3. Sintering temperatures of up to 1000°C did not result in volatility of cesium. Instead, there was an increase in crystallinity of the waste form upon sintering to 1000ºC for chloride- and nitrate-salt loaded clays. The nitrate salt feed produced various cesium pollucite phases, while the chloride salt feed did not produce these familiar phases. In fact, many of the x-ray diffraction peaks could not be matched to known phases. Assemblages of silicates were formed that incorporated the Sr, Rb, and Ba ions. Gas evolution during sintering to 1000°C was significant (35% weight loss for the CCD-PEG waste-loaded clay), with significant water being evolved at approximately 600°C.

  11. A study of mechanisms responsible for incorporation of cesium and radiocesium into fruitbodies of king oyster mushroom (Pleurotus eryngii)

    Energy Technology Data Exchange (ETDEWEB)

    Bystrzejewska-Piotrowska, Grazyna [Isotope Laboratory, Faculty of Biology, Warsaw University, 02-096 Warsaw, Miecznikowa 1 (Poland)], E-mail: byst@biol.uw.edu.pl; Bazala, Michal A. [Isotope Laboratory, Faculty of Biology, Warsaw University, 02-096 Warsaw, Miecznikowa 1 (Poland)

    2008-07-15

    Ex vitro cultures of Pleurotus eryngii were carried out under controlled conditions using sterile medium composed of barley seeds. The influence of alkali and alkaline earth element salts (CsCl, KCl, NaCl, RbCl, and CaCl{sub 2}) and tetraethylammonium chloride on incorporation of cesium, potassium, sodium, rubidium and calcium, and their distribution within fruitbodies, was examined. The results show that incorporation of cesium into fruitbodies was not suppressed by Na{sup +} and Rb{sup +} or tetraethylammonium chloride. However, it was inhibited by Ca{sup 2+} and stimulated by high concentrations of K{sup +}. The inhibition of cesium incorporation by Ca{sup 2+}, lack of influence of tetraethylammonium chloride and stimulation by high K{sup +} concentrations suggest that there may exist two pathways of passive transport of cesium in mycelium: (i) uptake mediated by a non-specific potassium channel localised in plasmalemma (similar to voltage-insensitive cation channel, VICC) followed by diffusive transport inside hyphae and (ii) extracellular transport from the medium through inter-hyphal cavities into fruitbodies. The results highlight distinctiveness of mechanisms responsible for the uptake and incorporation of cesium in mushrooms and plants.

  12. Incorporation of cesium into phosphates of apatitic and rhabdophane lattices. Application to the conditioning of separated radionuclides

    International Nuclear Information System (INIS)

    Campayo, L.

    2003-04-01

    Two phosphate-based materials were investigated for cesium immobilization after its partitioning from spent nuclear fuel: apatites and rhabdophanes. The incorporation of cesium into the apatitic lattice creates steric stresses. These stresses induce the formation of secondary phases which are rapidly leached. The effectiveness of the cesium immobilization in this material is not therefore validated. A second phosphate CsCaNd(PO 4 ) 2 was consistently found at the end of the leach test and its properties were further characterized. The structure of CsCaNd(PO 4 ) 2 , which is rhabdophane-like, is made of large channels which enable the incorporation of the largest alkaline cations. The synthesis involves two intermediates: the monazite, NdPO 4 , and a soluble phosphate, CsCaPO 4 . The study of a rhabdophane with 10 wt.% of cesium reveals satisfactory intrinsic properties: a thermal stability up to 1100 C and a leach rate of 10 -2 g/(m 2 .d). The next step will be to improve the reaction yield. (author)

  13. Analysis of cesium-137 vertical distribution in the profile of plowed chernozems at different schemes of their assaying

    International Nuclear Information System (INIS)

    Paramonova, T.A.; Komissarova, O.L.; Belyaev, V.R.; Ivanov, M.M.

    2016-01-01

    In 2011-2015 the assessment of profile cesium-137 distribution in agrocenosis of chernozem zone on the territory of the Plavsk radioactive spot in Tula region formed after the Chernobyl accident has been carried out. It is shown that up until now non-uniformity of cesium-137 vertical distribution over the plowed chernozems profile may be occurred, it should be taken into account at radioecological survey of post-Chernobyl landscapes. For correct evaluation of radioecological state of plowed soils their systematic monitoring on the base of preliminary analysis of cesium-137 distribution and also with the account of agrotechnical peculiarities of various crops cultivation is recommended. On the Plavsk radioactive spot territory the most adequate assessments of cesium-137 stores in plowed chernozems one can obtain on the base of assaying the upper 30-cm soil depth, including not only current topsoil, but also old-arable horizon formed by deep rehabilitation plowing [ru

  14. Synthesis and crystal structure of the cesium silver permanganate Cs_3Ag[MnO_4]_4

    International Nuclear Information System (INIS)

    Bauchert, Joerg M.; Henning, Harald; Schleid, Thomas

    2012-01-01

    After successful syntheses and structural refinements of the already known permanganates of cesium (Cs[MnO_4]) and silver (Ag[MnO_4]) we started to blend aqueous solutions of both components in various molar ratios. From crystallization experiments of these mixtures only three species of crystals with different chemical compositions were obtained: tricesium monosilver tetrakispermanganate (Cs_3Ag[MnO_4]_4) and, depending upon the respective ratio, either additional silver permanganate or surplus cesium permanganate, namely. The new title compound crystallizes in the orthorhombic space group Pnnm (no. 58) with two formula units per unit cell and cell dimensions of a = 764.53(4), b = 1883.57(9) and c = 584.34(3) pm. The crystal structure of Cs_3Ag[MnO_4]_4 consists of two crystallographically distinguishable cesium cations. (Cs1)"+ is surrounded by fourteen oxygen atoms constructing a slightly distorted bicapped hexagonal prism. These polyhedra are connected through edge-sharing with two other polyhedra of this kind to form chains along [001]. The chains are linked to each other via sixfold coordinated Ag"+ cations (d(Ag-O) = 238-246 pm), arranged in such a manner that they link three oxygen atoms of two cesium polyhedra, leading to a two-dimensional layer spreading out parallel to the (001) plane. Together with the two crystallographically different tetrahedral oxomanganate(VII) anions [MnO_4]"- (d(Mn-O) = 161-162 pm) the other kind of cesium cations ((Cs2)"+ with CN = 13) finally connect these layers three-dimensionally. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  15. Recent advances of numerical simulation studies for radioactive cesium adsorption on soil materials

    International Nuclear Information System (INIS)

    Okumura, Masahiko; Nakamura, Hiroki; Machida, Masahiko

    2013-01-01

    Radiocesium (Cesium 134 and 137) emitted from destroyed Fukushima Daiichi Nuclear Power Production Station is known mostly to remain for a long time on earth's surfaces and to become sources of radiation exposure to habitants. Large scale decontamination work carried out by national and local governments inevitably produces tremendous amount of radioactive wastes of soils whose volume must be effectively and economically reduced based on a scientifically reliable technique. This paper employs the atomic and molecular simulation method applied to adsorption mechanism of soils and cesium ions and presents the examples of proposals with the results of this field. (S. Ohno)

  16. Contribution of the pectin in the cesium elimination in organism. results of analysis on Belarus children

    International Nuclear Information System (INIS)

    2007-01-01

    The results make appear that the cesium 137 would be eliminated less quick than what the ICRP considered for its models. Pectin would accelerate the cesium elimination but less quick than what is announced by its promotors. Politically speaking, the pectin is ignored by the officials of medicine and radiation protection at the pretext that its efficiency is not proved but no study is made. (N.C.)

  17. Cesium-137 as a tracer of soil turbation: example of the taiga landscapes of the Western Siberia, Russia

    Energy Technology Data Exchange (ETDEWEB)

    Usacheva, Anna A.; Semenkov, Ivan N. [The Organization of Russian Academy of Sciences Institute of geology of ore deposits, petrography, mineralogy and geochemistry Russian Academy of Sciences, 119017, Moscow (Russian Federation)

    2014-07-01

    Cesium-137 is artificial radionuclide with 30.17 years half-life. However, this element can be found anywhere due to global atmospheric fallout. Its background storage is detected in landscapes: water, bottom sediments, plants and soils. Almost no one has studied the concentration of {sup 137}Cs in the landscapes of the North, because of its negligible storage. Cesium-137 is slightly mobile in the soils of the North. The cryogenic and other material movement is a typical feature of soils of the North. However, the dating of the soil turbations less than 100 years of age, using existing methods, is possible via long-term stationary observations. To determine the age of soil turbations quicker, one can use slightly mobile artificial radionuclides with medium or long half-life. Cesium-137 satisfies all the criteria. The aim of the work is to estimate suitable of cesium-137 as geo-tracer of soil turbation. According to our evaluation, the activity of the buried layers is less than 10 Bq*kg{sup -1} at the current {sup 137}Cs contamination of surface organic horizons (60-90 Bq*kg{sup -1}). A research has been conducted to study distribution of cesium-137 in the north and middle taiga landscapes of Western Siberia (Russia). Field research was carried out in 2012 in two study areas. The first study area 'Purpe' is located in the middle part of the Pur river basin, near Gubkinsky town (Yamalo-Nenets Autonomous Okrug). The second study area 'Noyabrsk' is located in the Ob and the Pur river watersheds, near Noyabrsk-city (Yamalo-Nenets Autonomous Okrug). Moss-grass-underwood layer (n=13) contains 22±20% of {sup 137}Cs total storage in the landscapes of oligo-trophic bogs with cryohistosols and pine forests on cryopodzols. The main reservoir of cesium-137 is soils (n=24) that accumulate 78±20% of its total landscape storage. The upper 10-cm soil layer contains 90% of {sup 137}Cs soil storage. Cesium-137 activity declines from shrubs and polytric layers

  18. 40 CFR 141.72 - Disinfection.

    Science.gov (United States)

    2010-07-01

    ... PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.72 Disinfection. A public water... the direct influence of surface water and provides filtration treatment must provide disinfection...) Disinfection requirements for public water systems which provide filtration. Each public water system that...

  19. Selective cesium and strontium removal for TRU-liquid waste including fission products and concentrated nitric acids

    International Nuclear Information System (INIS)

    Mimori, T.; Miyajima, K.; Kozeki, M.; Kubota, T.; Tusa, E.; Keskinen, A.

    1996-01-01

    A nuclide removal system was designed for treatment of liquid radioactive waste at the Japan Atomic Energy Research Institute (JAERI) Tokai site. Total system will include removal of plutonium, cesium and strontium. Removal of plutonium will be carried out by a method developed by JAERI. Removal of cesium and strontium will be carried out by the methods developed in Finland. The whole project will be implemented for JAERI in cooperation between Mitsui Engineering and Shipbuilding and IVO International. This project has been carried out under the Science and Technology Agency (STA) of Japan. The liquid to be treated includes 7.4x10 9 Bq/L of cesium and 7.4x10 9 Bq/L of strontium. The amount of alpha nuclides is 3.7x10 6 Bq/L. Nitric acid concentration is 1.74 mol/L. The volume of 11,000 liters had to be treated in 200 batches of operation. Removal of cesium and strontium is based on the use of new ion exchange materials developed in Finland. These inorganic ion exchange materials have extremely good properties to separate cesium and strontium from even very difficult liquids. Ion exchange material will be used in columns, where there are materials both for cesium and strontium. According to column tests with simulated waste, one 2 liter column will effectively reach the required DF during 10 batches of operation. Purified liquid can be led to further liquid treatment at the site. After treatment of liquids, both used particle filters and used ion exchange columns will be drained and stored to wait for final treatment and disposal. The designed treatment system has a special beneficial feature as it does not produce secondary waste. Final waste is in the form of particle filters or ion exchange columns with material. Used ion exchange columns and filters will be replaced with new ones by means of remote handling. Construction of the treatment system will be scheduled to commence in FY1995 and assemblying at the site in FY1996. (J.P.N.)

  20. 19 CFR 141.1 - Liability of importer for duties.

    Science.gov (United States)

    2010-04-01

    ... Customs by the broker. (c) Claim against estate of importer. The claim of the Government for unpaid duties... 19 Customs Duties 2 2010-04-01 2010-04-01 false Liability of importer for duties. 141.1 Section 141.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...

  1. Modification Of Cesium Toxicity By Prussian Blue In Adult Male Albino Rats

    International Nuclear Information System (INIS)

    MANGOOD, S.A.; HAGGAG, A.M.

    2009-01-01

    The purposes of this study were to asses the toxicological effects of stable cesium chloride, and investigate the possible therapeutic role of Prussian blue (PB) in adult male albino rats.Thirty two adult male albino rats were used in this study and classified to 4 groups (8 rats/group) as follows:1- Group one (G1): rats were considered as controls and kept on the commercial diet without any treatments.2-Group two (G2): treated with daily oral cesium chloride (50 mg/300 g body weight).3-Group three (G3): treated with daily oral Prussian blue (250 mg/rats).4-Group four (G4): treated with cesium chloride at a daily oral dose of 50 mg/300 g body weight + Prussian blue at a daily oral dose of 250 mg/rats.All animals were administered the CsCl and/or PB via intubation tube and the duration of this study was 35 consecutive days. Hemoglobin (Hb), hematocrit (Ht%), red blood cells (RBC), white blood cells (WBC), folic acid, vitamin B12, total protein, albumin, globulin, A/G ratio, ALT, AST, total bilirubin, alkaline phosphatase, blood glucose, urea, creatinine, creatine phosphokinase (CPK), lactate dehydrogenase (LDH), sodium, potassium, calcium and inorganic phosphorous and body weight were determined in all groups.The data obtained revealed that the intake of stable cesium chloride in adult male rats caused significant decreases in the Hb, hematocrit, folic acid, vitamin B12 and potassium contents, with significant increases in WBC count, urea and creatinine levels and no effect on the other parameters. On the other hand, PB as a therapeutic agent caused significant amelioration in the changes produced by CsCl with variable degrees leading to the conclusion that the therapeutic agents might provide a protection against the toxicological effects of CsCl.

  2. Research on the treatment of liquid waste containing cesium by an adsorption-microfiltration process with potassium zinc hexacyanoferrate

    International Nuclear Information System (INIS)

    Zhang Changping; Gu Ping; Zhao Jun; Zhang Dong; Deng Yue

    2009-01-01

    The removal of cesium from an aqueous solution by an adsorption-microfiltration (AMF) process was investigated in jar tests and lab-scale tests. The adsorbent was K 2 Zn 3 [Fe(CN) 6 ] 2 . The obtained cesium data in the jar test fit a Freundlich-type isotherm well. In the lab-scale test, the mean cesium concentration of the raw water and the effluent were 106.87 μg/L and 0.59 μg/L, respectively, the mean removal of cesium was 99.44%, and the mean decontamination factors (DF) and concentration factors (CF) were 208 and 539, respectively. The removal of cesium in the lab-scale test was better than that in the jar test because the old adsorbents remaining in the reactor still had adsorption capacity with the premise of no significant desorption being observed, and the continuous renewal of the adsorbent surface improved the adsorption capacity of the adsorbent. Some of the suspended solids were deposited on the bottom of the reactor, which would affect the mixing of adsorbents with the raw water and the renewing of the adsorbent surface. Membrane fouling was the main physical fouling mechanism, and the cake layer was the main filtration resistance. Specific flux (SF) decreased step by step during the whole period of operation due to membrane fouling and concentration polarization. The quality of the effluent was good and the turbidity remained lower than 0.1 NTU, and the toxic anion, CN - , could not be detected because of its low concentration, this indicated that the effluent was safe. The AMF process was feasible for practical application in the treatment of liquid waste containing cesium.

  3. Research on the treatment of liquid waste containing cesium by an adsorption-microfiltration process with potassium zinc hexacyanoferrate.

    Science.gov (United States)

    Zhang, Chang-Ping; Gu, Ping; Zhao, Jun; Zhang, Dong; Deng, Yue

    2009-08-15

    The removal of cesium from an aqueous solution by an adsorption-microfiltration (AMF) process was investigated in jar tests and lab-scale tests. The adsorbent was K(2)Zn(3)[Fe(CN)(6)](2). The obtained cesium data in the jar test fit a Freundlich-type isotherm well. In the lab-scale test, the mean cesium concentration of the raw water and the effluent were 106.87 microg/L and 0.59 microg/L, respectively, the mean removal of cesium was 99.44%, and the mean decontamination factors (DF) and concentration factors (CF) were 208 and 539, respectively. The removal of cesium in the lab-scale test was better than that in the jar test because the old adsorbents remaining in the reactor still had adsorption capacity with the premise of no significant desorption being observed, and the continuous renewal of the adsorbent surface improved the adsorption capacity of the adsorbent. Some of the suspended solids were deposited on the bottom of the reactor, which would affect the mixing of adsorbents with the raw water and the renewing of the adsorbent surface. Membrane fouling was the main physical fouling mechanism, and the cake layer was the main filtration resistance. Specific flux (SF) decreased step by step during the whole period of operation due to membrane fouling and concentration polarization. The quality of the effluent was good and the turbidity remained lower than 0.1NTU, and the toxic anion, CN(-), could not be detected because of its low concentration, this indicated that the effluent was safe. The AMF process was feasible for practical application in the treatment of liquid waste containing cesium.

  4. Assessment of commercially available ion exchange materials for cesium removal from highly alkaline wastes

    International Nuclear Information System (INIS)

    Brooks, K.P.; Kim, A.Y.; Kurath, D.E.

    1996-04-01

    Approximately 61 million gallons of nuclear waste generated in plutonium production, radionuclide removal campaigns, and research and development activities is stored on the Department of Energy's Hanford Site, near Richland, Washington. Although the pretreatment process and disposal requirements are still being defined, most pretreatment scenarios include removal of cesium from the aqueous streams. In many cases, after cesium is removed, the dissolved salt cakes and supernates can be disposed of as LLW. Ion exchange has been a leading candidate for this separation. Ion exchange systems have the advantage of simplicity of equipment and operation and provide many theoretical stages in a small space. The organic ion exchange material Duolite trademark CS-100 has been selected as the baseline exchanger for conceptual design of the Initial Pretreatment Module (IPM). Use of CS-100 was chosen because it is considered a conservative, technologically feasible approach. During FY 96, final resin down-selection will occur for IPM Title 1 design. Alternate ion exchange materials for cesium exchange will be considered at that time. The purpose of this report is to conduct a search for commercially available ion exchange materials which could potentially replace CS-100. This report will provide where possible a comparison of these resin in their ability to remove low concentrations of cesium from highly alkaline solutions. Materials which show promise can be studied further, while less encouraging resins can be eliminated from consideration

  5. Assessment of commercially available ion exchange materials for cesium removal from highly alkaline wastes

    Energy Technology Data Exchange (ETDEWEB)

    Brooks, K.P.; Kim, A.Y.; Kurath, D.E.

    1996-04-01

    Approximately 61 million gallons of nuclear waste generated in plutonium production, radionuclide removal campaigns, and research and development activities is stored on the Department of Energy`s Hanford Site, near Richland, Washington. Although the pretreatment process and disposal requirements are still being defined, most pretreatment scenarios include removal of cesium from the aqueous streams. In many cases, after cesium is removed, the dissolved salt cakes and supernates can be disposed of as LLW. Ion exchange has been a leading candidate for this separation. Ion exchange systems have the advantage of simplicity of equipment and operation and provide many theoretical stages in a small space. The organic ion exchange material Duolite{trademark} CS-100 has been selected as the baseline exchanger for conceptual design of the Initial Pretreatment Module (IPM). Use of CS-100 was chosen because it is considered a conservative, technologically feasible approach. During FY 96, final resin down-selection will occur for IPM Title 1 design. Alternate ion exchange materials for cesium exchange will be considered at that time. The purpose of this report is to conduct a search for commercially available ion exchange materials which could potentially replace CS-100. This report will provide where possible a comparison of these resin in their ability to remove low concentrations of cesium from highly alkaline solutions. Materials which show promise can be studied further, while less encouraging resins can be eliminated from consideration.

  6. Recovery of cesium from nuclear waste using hollow fibre supported liquid membrane containing calix[4]arene-bis-(2,3-naphtho)-crown-6

    International Nuclear Information System (INIS)

    Kandwal, P.; Mohapatra, P.K.; Ansari, S.A.; Manchanda, Vijay K.

    2011-01-01

    Transport behaviour of cesium through hollow fibre supported liquid membrane (HFSLM) containing calix[4]arenebis-(2,3-naphtho)-crown-6 (CNC) as carrier extractant, has been investigated under various experimental conditions. At tracer concentration of cesium, > 99% recovery of cesium was achieved from 3M HNO 3 solution to distilled water with 1 mM of CNC in 80% NPOE + 20 % n-dodecane mixture. Effect of feed phase acidity, ligand concentration, metal ion concentration etc. has been investigated. Recovery of cesium from Pressurized Heavy Water Reactor Simulated High Level Waste (PHWR-SHLW) using 1 mM CNC dissolved proposed diluent as the extractant, was carried out and it was found that it takes 12 hours of continuous operation for 88% recovery of metal ion. Nevertheless, the complete recovery of cesium from SHLW was possible after neutralization of strip phase acidity with NaOH. (author)

  7. Modeling of a diode-pumped thin-disk cesium vapor laser

    Science.gov (United States)

    An, Guofei; Cai, He; Liu, Xiaoxu; Han, Juhong; Zhang, Wei; Wang, Hongyuan; Wang, You

    2018-03-01

    A diode pumped alkali laser (DPAL) provides a significant potential for construction of high-powered lasers. Until now, a series of models have been established to analyze the kinetic process and most of them are based on the end-pumped alkali laser system in which the vapor cell are usually cylindrical and cuboid. In this paper, a mathematic model is constructed to investigate the kinetic processes of a diode pumped thin-disk cesium vapor laser, in which the cesium vapor and the buffer gases are beforehand filled in a sealed glass cell with a thin-disk structure. We systemically study the influences of the cell temperature and cell thickness on the output features of a thin-disk DPAL. Further, we study the thin-disk DPAL with the W-shaped resonator and multiple-disk configuration. To the best of our knowledge, there have not been any similar reports so far.

  8. 40 CFR 141.801 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... aircraft that supply water for human consumption to passengers or crew. Aircraft water system operations... distribution and consumption without further treatment, except as treatment necessary to maintain water quality...). (40 CFR 141.2) Human consumption means drinking, bathing, showering, hand washing, teeth brushing...

  9. Non-natives: 141 scientists object

    NARCIS (Netherlands)

    Simberloff, D.; Van der Putten, W.H.

    2011-01-01

    Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. dsimberloff@utk.edu Jake Alexander Institute of Integrative

  10. Dual cesium and rubidium atomic fountain with a 10{sup -16} level accuracy and applications; Fontaine atomique double de cesium et de rubidium avec une exactitude de quelques 10{sup -16} et applications

    Energy Technology Data Exchange (ETDEWEB)

    Chapelet, F

    2008-05-15

    Atomic fountains are the most accomplished development of the atomic clocks based on the cesium atom whose hyperfine resonance defines the SI second since 1967. Today these systems are among those which realize the second with the best accuracy. We present the last developments of the cold cesium and rubidium atom dual fountain experiment at LNE-SYRTE. This unique dual setup would allow to obtain an outstanding resolution in fundamental physics tests based on atomic transition frequency comparisons. In order to enable operation with both atomic species simultaneously, we designed, tested and implemented on the fountain new collimators which combine the laser lights corresponding to each atom. By comparing our rubidium fountain to another cesium fountain over a decade, we performed a test of the stability of the fine structure constant at the level of 5 * 10{sup -16} per year. We carried on the work on the clock accuracy and we focused on the phase gradients effects in the interrogation cavity and on the microwave leakage. The fountain accuracy has been evaluated to 4 * 10{sup -16} for the cesium clock and to 5 * 10{sup -16} for the refurbished rubidium clock. As a powerful instrument of metrology, our fountain was implicated in many clock comparisons and contributed many times to calibrate the International Atomic Time. Furthermore, we used the fountain to perform a new test of Lorentz local invariance. (author)

  11. Research of decreasing of the cesium radionuclides discharge in the course pouring of the liquid glass from furnace EhP-500/1

    International Nuclear Information System (INIS)

    Sadovskij, B.F.; Borisov, N.B.; Dzekun, E.G.; Skobtsov, A.S.

    1996-01-01

    Cesium radionuclides discharge from the furnace liquid-glass discharge unit are studied and estimates of cesium emission from the glass melt by the stream flow-out and filling the waste storage capacity are performed. The ways for decreasing cesium discharges are indicated and new additional aerosol protection system for high-active glass discharge, providing for high protection efficiency is proposed. 10 refs., 1 fig., 1 tab

  12. Cesium legacy safety project management work plan

    International Nuclear Information System (INIS)

    Durham, J.S.

    1998-01-01

    This Management Work Plan (MWP) describes the process flow, quality assurance controls, and the Environment, Safety, and Health requirements of the Cesium Legacy Safety Project. This MWP provides an overview of the project goals and methods for repackaging the non-conforming Type W overpacks and packaging the CsCl powder and pellets. This MWP is not intended to apply to other activities associated with the CsCl Legacy Safety Program (i.e., clean out of South Cell)

  13. Washing-electrokinetic Decontamination for Concrete Contaminated with Cobalt and Cesium

    International Nuclear Information System (INIS)

    Kim, Gye Nam; Yang, Byeong Il; Choi, Wang Kyu; Lee, Kune Woo; Hyeon, Jay Hyeok

    2009-01-01

    A great volume of radioactive concrete is generated during the operation and the decommissioning of nuclear facilities. The washing-electrokinetic technology in this study, which combined an electrokinetic method and a washing method, was developed to decontaminate the concrete generated in nuclear facilities. The results of only an electrokinetic decontamination for the concrete showed that cobalt was removed to below 1% from the concrete due to its high pH. Therefore, the washing electrokinetic technology was applied to lower the pH of the concrete. Namely, when the concrete was washed with 3 M of hydrochloric acid for 4 hours (0.17 day), the CaCO 3 in the concrete was decomposed into CO 2 and the pH of the concrete was reduced to 3.7, and the cobalt and cesium in the concrete were removed by up to 85.0% and 76.3% respectively. Next, when the washed concrete was decontaminated by the electrokinetic method with 0.01M of acetic acid in the 1L electrokinetic equipment for 14.83 days, the cobalt and the cesium in the concrete were both removed by up to 99.7% and 99.6% respectively. The removal efficiencies of the cobalt and cesium by 0.01M of acetic acid were increased more than those by 0.05M of acetic acid due to the increase of the concrete zeta potential. The total effluent volume generated from the washing-electrokinetic decontamination was 11.55L (7.2ml/g).

  14. Extraction of cesium and strontium from nuclear waste

    Science.gov (United States)

    Davis, Jr., Milton W.; Bowers, Jr., Charles B.

    1988-01-01

    Cesium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5) [1-hydroxy-2-ethylhexyl]benzo 18-crown-6 compound and a cation exchanger in a matrix solution. Strontium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5') [1-hydroxyheptyl]cyclohexo 18-crown-6 compound, and a cation exchanger in a matrix solution.

  15. T1 nuclear magnetic relaxation dispersion of hyperpolarized sodium and cesium hydrogencarbonate-13 C.

    Science.gov (United States)

    Martínez-Santiesteban, Francisco M; Dang, Thien Phuoc; Lim, Heeseung; Chen, Albert P; Scholl, Timothy J

    2017-09-01

    In vivo pH mapping in tissue using hyperpolarized hydrogencarbonate- 13 C has been proposed as a method to study tumor growth and treatment and other pathological conditions related to pH changes. The finite spin-lattice relaxation times (T 1 ) of hyperpolarized media are a significant limiting factor for in vivo imaging. Relaxation times can be measured at standard magnetic fields (1.5 T, 3.0 T etc.), but no such data are available at low fields, where T 1 values can be significantly shorter. This information is required to determine the potential loss of polarization as the agent is dispensed and transported from the polarizer to the MRI scanner. The purpose of this study is to measure T 1 dispersion from low to clinical magnetic fields (0.4 mT to 3.0 T) of different hyperpolarized hydrogencarbonate formulations previously proposed in the literature for in vivo pH measurements. 13 C-enriched cesium and sodium hydrogencarbonate preparations were hyperpolarized using dynamic nuclear polarization, and the T 1 values of different samples were measured at different magnetic field strengths using a fast field-cycling relaxometer and a 3.0 T clinical MRI system. The effects of deuterium oxide as a dissolution medium for sodium hydrogencarbonate were also analyzed. This study finds that the cesium formulation has slightly shorter T 1 values compared with the sodium preparation. However, the higher solubility of cesium hydrogencarbonate- 13 C means it can be polarized at greater concentration, using less trityl radical than sodium hydrogencarbonate- 13 C. This study also establishes that the preparation and handling of sodium hydrogencarbonate formulations in relation to cesium hydrogencarbonate is more difficult, due to the higher viscosity and lower achievable concentrations, and that deuterium oxide significantly increases the T 1 of sodium hydrogencarbonate solutions. Finally, this work also investigates the influence of pH on the spin-lattice relaxation of cesium

  16. Sintered bentonite ceramics for the immobilization of cesium- and strontium-bearing radioactive waste

    Science.gov (United States)

    Ortega, Luis Humberto

    The Advanced Fuel Cycle Initiative (AFCI) is a Department of Energy (DOE) program, that has been investigating technologies to improve fuel cycle sustainability and proliferation resistance. One of the program's goals is to reduce the amount of radioactive waste requiring repository disposal. Cesium and strontium are two primary heat sources during the first 300 years of spent nuclear fuel's decay, specifically isotopes Cs-137 and Sr-90. Removal of these isotopes from spent nuclear fuel will reduce the activity of the bulk spent fuel, reducing the heat given off by the waste. Once the cesium and strontium are separated from the bulk of the spent nuclear fuel, the isotopes must be immobilized. This study is focused on a method to immobilize a cesium- and strontium-bearing radioactive liquid waste stream. While there are various schemes to remove these isotopes from spent fuel, this study has focused on a nitric acid based liquid waste. The waste liquid was mixed with the bentonite, dried then sintered. To be effective sintering temperatures from 1100 to 1200°C were required, and waste concentrations must be at least 25 wt%. The product is a leach resistant ceramic solid with the waste elements embedded within alumino-silicates and a silicon rich phase. The cesium is primarily incorporated into pollucite and the strontium into a monoclinic feldspar. The simulated waste was prepared from nitrate salts of stable ions. These ions were limited to cesium, strontium, barium and rubidium. Barium and rubidium will be co-extracted during separation due to similar chemical properties to cesium and strontium. The waste liquid was added to the bentonite clay incrementally with drying steps between each addition. The dry powder was pressed and then sintered at various temperatures. The maximum loading tested is 32 wt. percent waste, which refers to 13.9 wt. percent cesium, 12.2 wt. percent barium, 4.1 wt. percent strontium, and 2.0 wt. percent rubidium. Lower loadings of waste

  17. 40 CFR 141.401 - Sanitary surveys for ground water systems.

    Science.gov (United States)

    2010-07-01

    ... systems. 141.401 Section 141.401 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... an evaluation of the applicable components listed in paragraphs (c)(1) through (8) of this section... facilities, and controls, (6) Monitoring, reporting, and data verification, (7) System management and...

  18. 40 CFR 141.73 - Filtration.

    Science.gov (United States)

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.73 Filtration. A public water system that uses a surface water source or a ground water source under the direct influence of surface water...

  19. Strontium-90 and cesium-137 in soil (from May, 1982, to September, 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in soil measured at 29 locations across Japan from May to September, 1982, are given in pCi/kg and mCi/km 2 , respectively. The methods of the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, the determination of stable strontium, calcium and potassium, and the counting are also described. Soil was collected in the spacious and flat area without past disturbance on the surface. Soil was taken from two layers of different depths, 0 to 5 cm and 5 to 20 cm. The sample solution was prepared and was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitate was counted for activity using a low background beta counter normally for 60 min. The radioactivity ranged 6 to 1300 pCi/Kg for Sr-90 and 1 to 5000 pCi/Kg for Cs-137 in the sampling depth of 0 to 5 cm. (J.P.N.)

  20. Thermodynamics of soluble fission products cesium and iodine in the Molten Salt Reactor

    Science.gov (United States)

    Capelli, E.; Beneš, O.; Konings, R. J. M.

    2018-04-01

    The present study describes the full thermodynamic assessment of the Li,Cs,Th//F,I system. The existing database for the relevant fluoride salts considered as fuel for the Molten Salt Reactor (MSR) has been extended with two key fission products, cesium and iodine. A complete evaluation of all the common-ion binary and ternary sub-systems of the LiF-ThF4-CsF-LiI-ThI4-CsI system has been performed and the optimized parameters are presented in this work. New equilibrium data have been measured using Differential Scanning Calorimetry and were used to assess the reciprocal ternary systems and confirm the extrapolated phase diagrams. The developed database significantly contributes to the understanding of the behaviour of cesium and iodine in the MSR, which strongly depends on their concentration and chemical form. Cesium bonded with fluorine is well retained in the fuel mixture while in the form of CsI the solubility of these elements is very limited. Finally, the influence of CsI and CsF on the physico-chemical properties of the fuel mixture was calculated as function of composition.

  1. Computer simulation of liquid cesium using embedded atom model

    International Nuclear Information System (INIS)

    Belashchenko, D K; Nikitin, N Yu

    2008-01-01

    The new method is presented for the inventing an embedded atom potential (EAM potential) for liquid metals. This method uses directly the pair correlation function (PCF) of the liquid metal near the melting temperature. Because of the specific analytic form of this EAM potential, the pair term of potential can be calculated using the pair correlation function and, for example, Schommers algorithm. Other parameters of EAM potential may be found using the potential energy, module of compression and pressure at some conditions, mainly near the melting temperature, at very high temperature or in strongly compressed state. We used the simple exponential formula for effective EAM electronic density and a polynomial series for embedding energy. Molecular dynamics method was applied with L. Verlet algorithm. A series of models with 1968 atoms in the basic cube was constructed in temperature interval 323-1923 K. The thermodynamic properties of liquid cesium, structure data and self-diffusion coefficients are calculated. In general, agreement between the model data and known experimental ones is reasonable. The evaluation is given for the critical temperature of cesium models with EAM potential

  2. Heat Transfer During Evaporation of Cesium From Graphite Surface in an Argon Environment

    Directory of Open Access Journals (Sweden)

    Bespala Evgeny

    2016-01-01

    Full Text Available The article focuses on discussion of problem of graphite radioactive waste formation and accumulation. It is shown that irradiated nuclear graphite being inalienable part of uranium-graphite reactor may contain fission and activation products. Much attention is given to the process of formation of radioactive cesium on the graphite element surface. It is described a process of plasma decontamination of irradiated graphite in inert argon atmosphere. Quasi-one mathematical model is offered, it describes heat transfer process in graphite-cesium-argon system. Article shows results of calculation of temperature field inside the unit cell. Authors determined the factors which influence on temperature change.

  3. Enhanced capacity and stability for the separation of cesium in electrically switched ion exchange

    International Nuclear Information System (INIS)

    Tawfic, A.F.; Dickson, S.E.; Kim, Y.; Mekky, W.

    2015-01-01

    Electrically switched ion exchange (ESIX) can be used to separate ionic contaminants from industrial wastewater, including that generated by the nuclear industry. The ESIX method involves sequential application of reduction and oxidation potentials to an ion exchange film to induce the respective loading and unloading of cesium. This technology is superior to conventional methods (e.g electrodialysis reversal or reverse osmosis) as it requires very little energy for ionic separation. In previous studies, ESIX films have demonstrated relatively low ion exchange capacities and limited film stabilities over repeated potential applications. In this study, the methodology for the deposition of electro-active films (nickel hexacyanoferrate) on nickel electrodes was modified to improve the ion exchange capacity for cesium removal using ESIX. Cyclic voltammetry was used to investigate the ion exchange capacity and stability. Scanning electron microscopy (SEM) was used to characterize the modified film surfaces. Additionally, the films were examined for the separation of cesium ions. This modified film preparation technique enhanced the ion exchange capacity and improves the film stability compared to previous methods for the deposition of ESIX films. (authors)

  4. Enhanced capacity and stability for the separation of cesium in electrically switched ion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Tawfic, A.F.; Dickson, S.E.; Kim, Y. [McMaster University, Hamilton, ON (Canada); Mekky, W. [AMEC NSS, Power and Process America, Toronto (Canada)

    2015-03-15

    Electrically switched ion exchange (ESIX) can be used to separate ionic contaminants from industrial wastewater, including that generated by the nuclear industry. The ESIX method involves sequential application of reduction and oxidation potentials to an ion exchange film to induce the respective loading and unloading of cesium. This technology is superior to conventional methods (e.g electrodialysis reversal or reverse osmosis) as it requires very little energy for ionic separation. In previous studies, ESIX films have demonstrated relatively low ion exchange capacities and limited film stabilities over repeated potential applications. In this study, the methodology for the deposition of electro-active films (nickel hexacyanoferrate) on nickel electrodes was modified to improve the ion exchange capacity for cesium removal using ESIX. Cyclic voltammetry was used to investigate the ion exchange capacity and stability. Scanning electron microscopy (SEM) was used to characterize the modified film surfaces. Additionally, the films were examined for the separation of cesium ions. This modified film preparation technique enhanced the ion exchange capacity and improves the film stability compared to previous methods for the deposition of ESIX films. (authors)

  5. Strontium-90 and cesium-137 in sea water (from July, 1982, to September, 1982)

    International Nuclear Information System (INIS)

    1982-01-01

    Strontium-90 and cesium-137 in sea water collected at 11 locations across Japan from July to September, 1982, are given in pCi/l, respectively. The methods of the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, and the counting are also described. Sea water was collected at the fixed station where the effect of the terrestrial fresh water from rivers was negligibly small. The sampling was carried out when there was no rainfall for the last few days. The sample solution was prepared and was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitate was counted for activity using a low background beta counter normally for 60 min. The radioactivity ranged 0.09 to 0.13 pCi/l for Sr-90 and 0.05 to 0.13 pCi/l for Cs-137 in the sea water. (Mori, K.)

  6. Survey of environmental radiation in Kawamata-machi, Fukushima-ken (2). Radioactive cesium in wild mushroom

    International Nuclear Information System (INIS)

    Inagaki, Masayo; Yamanishi, Hirokuni; Wakabayashi, Genichiro; Hohara, Sin-ya; Itoh, Tetsuo; Shirasaka, Norifumi; Tanesaka, Eiji; Okumura, Hiroshi; Furukawa, Michio

    2013-01-01

    Large amount of radioactive cesium was emitted from the TEPCO Fukushima Dai-ichi nuclear power plant by the accident into atmospheric air, and a part of the radioactivity was brought to the ground by rain and snowfall. The Yamakiya district in Kawamata-machi, Fukushima is specified as the prepared evacuation zone. The authors collected wild mushrooms in this district as samples with gentle guide of local mushroom lovers in October, 2012. The kinds of mushroom were specified by the mushroom specialist. 16 kinds of mushrooms have been extracted. The extracted mushroom was brought back to the university. The concentration of radioactive cesium was measured by means of the hyperpure germanium semiconductor detector. The concentrations were ranged from 0.5 to 2600 Bq/g, and were different with points of sampling and kinds. The concentrations were compared with before washing and after washing by means of ultrasonic cleaning. The amount of radioactive cesium reduced to the range from 30% to 60% of the before washing. (author)

  7. 40 CFR 141.173 - Filtration.

    Science.gov (United States)

    2010-07-01

    ... PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.173 Filtration. A public water system subject to the requirements of this subpart that does... treatment, direct filtration, slow sand filtration, or diatomaceous earth filtration. A public water system...

  8. Membrane-based separation technologies for cesium, strontium, and technetium

    International Nuclear Information System (INIS)

    Kafka, T.

    1996-01-01

    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah

  9. The determination of the cesium distribution coefficient of the interim storage soil from Abadia de Goias, Go, Brazil

    International Nuclear Information System (INIS)

    Marumo, J.T.; Suarez, A.A.

    1989-01-01

    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficient for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis, etc) as well as clay minerals constituents were also determined. (author) [pt

  10. Sorption of cesium on montmorillonite and effect of salt concentration

    International Nuclear Information System (INIS)

    Atun, G.; Bilgin, B.; Mardinli, A.

    1996-01-01

    The sorption behavior of cesium on montmorillonite type[e clay was studied by using radioactivity measurements. Concentrations of Cs + ions ranged from 10 -6 to 10 -2 M. Cesium retention reduced with increasing salt concentration which was varied between 10 -4 and 10 -1 M. Selectivity coefficients K CsNa for the exchange between Cs and Na were calculated for different equivalent fractions of Cs on the solid phase. Using the K CsNa values, free energy change was found to be 7.8 kJ/mol. The data could be fitted to a Freundlich isotherm, and empirical Freundlich parameters enabled the generation of a site distribution function. By fitting the data to the Dubinin-Radushkevich (D-R) isotherm, a mean energy of sorption of 8.6kJ/mole was calculated which corresponds to the energy of ion exchange reactions. The values of energy changes calculated by using two different methods were in good agreement. (author)

  11. Performance evaluation of 24 ion exchange materials for removing cesium and strontium from actual and simulated N-Reactor storage basin water

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G.N.; Carson, K.J.; DesChane, J.R.; Elovich, R.J.

    1997-09-01

    This report describes the evaluation of 24 organic and inorganic ion exchange materials for removing cesium and strontium from actual and simulated waters from the 100 Area 105 N-Reactor fuel storage basin. The data described in this report can be applied for developing and evaluating ion exchange pre-treatment process flowsheets. Cesium and strontium batch distribution ratios (K{sub d}`s), decontamination factors (DF), and material loadings (mmol g{sup -1}) are compared as a function of ion exchange material and initial cesium concentration. The actual and simulated N-Basin waters contain relatively low levels of aluminum, barium, calcium, potassium, and magnesium (ranging from 8.33E-04 to 6.40E-05 M), with slightly higher levels of boron (6.63E-03 M) and sodium (1.62E-03 M). The {sup 137}Cs level is 1.74E-06 Ci L-{sup 1} which corresponds to approximately 4.87E-10 M Cs. The initial Na/Cs ratio was 3.33E+06. The concentration of total strontium is 4.45E-06 M, while the {sup 90}Sr radioactive component was measured to be 6.13E-06 Ci L{sup -1}. Simulant tests were conducted by contacting 0.067 g or each ion exchange material with approximately 100 mL of either the actual or simulated N-Basin water. The simulants contained variable initial cesium concentrations ranging from 1.00E-04 to 2.57E- 10 M Cs while all other components were held constant. For all materials, the average cesium K{sub d} was independent of cesium concentration below approximately 1.0E-06 M. Above this level, the average cesium K{sub d} values decreased significantly. Cesium K{sub d} values exceeding 1.0E+07 mL g{sup -1} were measured in the simulated N-Basin water. However, when measured in the actual N-Basin water the values were several orders of magnitude lower, with a maximum of 1.24E+05 mL g{sup -1} observed.

  12. Translocation of cesium in plants after foliar deposition - Experiments and models

    International Nuclear Information System (INIS)

    Proehl, G.; Voigt, G.; Mueller, H.

    1991-01-01

    The translocation of cesium from the foliage to the edible parts as function of the time period between deposition and harvest has been determined for cereals, potatoes, green beans and carrots. From the results the following conclusions can be drawn: 1. The maximum of the cesium translocation is 40 to 50 and 70 to 90 days before harvest for cereals and potatoes respectively. For green beans a maximum was observed after deposition 15 days before harvest; 2. The variations of the translocation factors are less if the translocation is normalized to the yield; 3. The translocation factors are in good agreement with those of other investigators. The agreement between the experimental series is better for a normalization of the translocation factor on the yield; 4. For cereals and potatoes the translocation can be described with gaussian functions which are consistent with the physiological development of cereals and potatoes. Although the approach in ECOSYS tends to over predict slightly the translocation for barley and potatoes there is a good overall agreement between the experiments and this model; 5. According to the investigations available the translocation of cesium can be predicted within a factor of 3 for cereals and a factor of 4 for potatoes. Sources of the uncertainties besides the biological variability and the inherent experimental error are differences in the development of the plants due to weather conditions, farm management and plant diseases. (9 refs., 5 figs.)

  13. WESF cesium capsule behavior at high temperature or during thermal cycling

    International Nuclear Information System (INIS)

    Tingey, G.L.; Gray, W.J.; Shippell, R.J.; Katayama, Y.B.

    1985-06-01

    Double-walled stainless steel (SS) capsules prepared for storage of radioactive 137 Cs from defense waste are now being considered for use as sources for commercial irradiation. Cesium was recovered at B-plant from the high-level radioactive waste generated during processing of defense nuclear fuel. It was then purified, converted to the chloride form, and encapsulated at the Hanford Waste Encapsulation and Storage Facility (WESF). The molten cesium chloride salt was encapsulated by pouring it into the inner of two concentric SS cylinders. Each cylinder was fitted with a SS end cap that was welded in place by inert gas-tungsten arc welding. The capsule configuration and dimensions are shown in Figure 1. In a recent review of the safety of these capsules, Tingey, Wheelwright, and Lytle (1984) indicated that experimental studies were continuing to produce long-term corrosion data, to reaffirm capsule integrity during a 90-min fire where capsule temperatures reached 800 0 C, to monitor mechanical properties as a function of time, and to assess the effects of thermal cycling due to periodic transfer of the capsules from a water storage pool to the air environment of an irradiator facility. This report covers results from tests that simulated the effects of the 90-min fire and from thermal cycling actual WESF cesium capsules for 3845 cycles over a period of six months. 11 refs., 39 figs., 9 tabs

  14. End-of-Life Indicators for NIMA's High-Performance Cesium Frequency Standards

    National Research Council Canada - National Science Library

    Brock, C; Tolman, B. W; Taylor, R. E

    2002-01-01

    .... The mean lifetime of the cesium-beam tube (CBT) is approximately 6 years; failure or end-of-life of the CBT is a significant cause in the reduction of data used to produce the NIMA GPS precise ephemeris...

  15. Determination and preconcentration of natural and radio-cesium from aqueous solution

    International Nuclear Information System (INIS)

    Gueclue, K.; Apak, R.; Tuetem, E.; Atun, G.

    2004-01-01

    A modified atomic emission spectrometric (AES) method to determine cesium(I), based on the measurement of emission intensity at 455.5 nm with a limit of quantitation (LOQ) of 5.5 mg/l and a linear range up to 100 mg/l is reported. In order to increase the sensitivity and lower the detection limits, potential sorbents were investigated for preconcentrating Cs from natural waters. Among the various ion-exchange materials synthesized, potassium hexanitrocobaltate (PHNCo) yielded the highest capacity for 137 Cs tagged Cs + solutions as measured by gamma-spectrometry with a HPGe detector, showing the potential of a cesium preconcentration sorbent. As an alternative to AES determination, the PHNCo sorbent may be used for Cs + collection from radiocesium tagged solutions and the retained activity in the dry solid exchanger be determined by gamma-spectrometry. (author)

  16. Psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

    International Nuclear Information System (INIS)

    Ferreira, Celia Marly

    1995-01-01

    The presented work had as objective the accomplishment of a comparative study of cesium-137 radioactive element effects in the psychological and motor development of children which were going submitted the intra-uterus irradiation during the chronological age of three years. The comparison of the results of study is done through a group-control composed for five children without any involvement with the cesium-137 accident - occurred in 1987 in Goiania, Brazil - of same social, economic and cultural level and with the same age of the reached

  17. 40 CFR 141.560 - Is my system subject to individual filter turbidity requirements?

    Science.gov (United States)

    2010-07-01

    ... filter turbidity requirements? 141.560 Section 141.560 Protection of Environment ENVIRONMENTAL PROTECTION... Filtration and Disinfection-Systems Serving Fewer Than 10,000 People Individual Filter Turbidity Requirements § 141.560 Is my system subject to individual filter turbidity requirements? If your system is a subpart...

  18. Release of tellurium and cesium from UO2 in LWR fuel rods during irradiation

    International Nuclear Information System (INIS)

    Malen, K.A.

    1983-01-01

    In this paper the release of tellurium (Te-132) and cesium (Cs-134 and Cs-137) from UO 2 -fuel is analyzed. The basis for the analysis is the experimental results from the S176 series of experiments performed at Studsvik. It seems that the model developed earlier for release of iodine applies also to tellurium and cesium. This model assumes sweeping up of the species in question by moving grain boundaries and subsequent release through grain boundary porosity. An interesting extra feature is deposition of tellurium at temperatures in the range 1500-2000 K believed to be due to condensation. (author)

  19. 40 CFR 141.170 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... recontamination by surface water runoff and a point downstream before or at the first customer for filtered...) Compliance with the profiling and benchmark requirements under the provisions of § 141.172. (b) A public...

  20. A tentative assessment of cesium 137 direct and indirect transfer rates in a simplified fresh water food chain

    International Nuclear Information System (INIS)

    Foulquier, Luc; Lambrechts, Alain.

    1982-08-01

    A comparison was made of the direct transfer of cesium from water to carps and the indirect transfer via the food. In a first experiment on chronic contamination of carps by water, the kinetics and distribution of cesium in the organs of the carps were studied. Equilibrium was not reached on the 56th day, 4% of the initial water activity had been retained by the carps and the concentration factor was below 10. The highest specific activities were found in the transit organs. In a second experiment, the water activity varied by alternating contamination and decontamination. A fluctuating equilibrium was reached on the 22nd day. The concentration factor was of the same order of magnitude than in the previous experiment. Indirect contamination of fish by ingestion of contaminated daphnids was studied in a third experiment. Cesium levels in carps increased with the cumulated activities in meals, and the uptake rate in fish was 4%. Both decorporation and biological half-lives (30-40 days) were independent of the contamination routes. The respective significance of the transfer pathways is discussed taking into account the biomass pyramids to be found in the nature. It is estimated that in a cesium environment, 70% of the carp activity should come from the diet and 30% from the water. The concentration factor would then be 75 instead of 22 when only direct transfer of cesium from water to fish is considered [fr

  1. Recognition and extraction of cesium hydroxide and carbonate by using a neutral multitopic ion-pair receptor

    Energy Technology Data Exchange (ETDEWEB)

    He, Qing; Peters, Gretchen Marie; Lynch, Vincent M.; Sessler, Jonathan L. [Department of Chemistry, University of Texas, Austin, TX (United States)

    2017-10-16

    Current approaches to lowering the pH of basic media rely on the addition of a proton source. An alternative approach is described herein that involves the liquid-liquid extraction-based removal of cesium salts, specifically CsOH and Cs{sub 2}CO{sub 3}, from highly basic media. A multitopic ion-pair receptor (2) is used that can recognize and extract the hydroxide and carbonate anions as their cesium salts, as confirmed by {sup 1}H NMR spectroscopic titrations, ICP-MS, single-crystal structural analyses, and theoretical calculations. A sharp increase in the pH and cesium concentrations in the receiving phase is observed when receptor 2 is employed as a carrier in U-tube experiments involving the transport of CsOH through an intervening chloroform layer. The pH of the source phase likewise decreases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. Stationary point of the radiometric control of cesium contamination of agricultural animals

    International Nuclear Information System (INIS)

    1997-01-01

    Stationary point of the radiometric control of cesium contamination of an agricultural animals. Is intended for vital measurements of the contents of radiocesium in muscular tissue of a cattle. Can be used on cattle-breeding farms, providing points, in meat factories and personal facilities. As a base means for accommodation of the control point the motor-car is used. Design of the car allows to automate operations on deployment of the control point on a place and translation of one to a transport mode. Limits of measured specific activity of cesium contamination of a cattle is up 5*10 -9 to 5*10 -6 Ci/kg. The basic error on the bottom limit of measurement at confidence coefficient 0,95 is no more than 30%. Measurement time for the bottom limit of determined specific activity is no more than 30 s. There is automatic measurement mode. Type of a power is 220 V, 50 Hz. Range of working temperatures is up -15 to +35 centigrade. Relative humidity is no more than 98% at 25 centigrade. External gamma background is till 0.035 mR/h. Time of installation and dismantle of stationary control point is no more than 1,5 hours. The direct radiometric control in divo allows to fulfil and to use biotechnological process of removing of cesium isotopes from body of animals for decrease of levels of radioactive contamination

  3. 25 CFR 141.36 - Maximum finance charges on pawn transactions.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Maximum finance charges on pawn transactions. 141.36... PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS Pawnbroker Practices § 141.36 Maximum finance charges on pawn transactions. No pawnbroker may impose an annual finance charge greater than twenty-four percent...

  4. Lasing in robust cesium lead halide perovskite nanowires

    Science.gov (United States)

    Eaton, Samuel W.; Lai, Minliang; Gibson, Natalie A.; Wong, Andrew B.; Dou, Letian; Ma, Jie; Wang, Lin-Wang; Leone, Stephen R.; Yang, Peidong

    2016-01-01

    The rapidly growing field of nanoscale lasers can be advanced through the discovery of new, tunable light sources. The emission wavelength tunability demonstrated in perovskite materials is an attractive property for nanoscale lasers. Whereas organic–inorganic lead halide perovskite materials are known for their instability, cesium lead halides offer a robust alternative without sacrificing emission tunability or ease of synthesis. Here, we report the low-temperature, solution-phase growth of cesium lead halide nanowires exhibiting low-threshold lasing and high stability. The as-grown nanowires are single crystalline with well-formed facets, and act as high-quality laser cavities. The nanowires display excellent stability while stored and handled under ambient conditions over the course of weeks. Upon optical excitation, Fabry–Pérot lasing occurs in CsPbBr3 nanowires with an onset of 5 μJ cm−2 with the nanowire cavity displaying a maximum quality factor of 1,009 ± 5. Lasing under constant, pulsed excitation can be maintained for over 1 h, the equivalent of 109 excitation cycles, and lasing persists upon exposure to ambient atmosphere. Wavelength tunability in the green and blue regions of the spectrum in conjunction with excellent stability makes these nanowire lasers attractive for device fabrication. PMID:26862172

  5. Entrapment of 137Cs vapour generated during vitrification and casting of cesium borosilicate glass by inorganic materials

    International Nuclear Information System (INIS)

    Ram, Ramu; Gandhi, Shyamala; Dash, A.; Varma, R.N.

    2003-01-01

    Efficiency of different inorganic materials like zirconium antimonate (ZrA), ammonium molybdophosphate (AMP), synthetic zeolites, activated charcoal, glass wool etc, towards the entrapment of 137 Cs vapour escaping during vitrification and casting of cesium borosilicate glass required for the preparation of 137 Cs sources for medical and industrial applications have been determined. The recovery of entrapped cesium using dilute acids for subsequent recycling has also been explored. (author)

  6. Monocrystallomimicry in the aerosols of ammonium and cesium halides

    International Nuclear Information System (INIS)

    Melikhov, I.V.; Kitova, E.N.; Kozlovskaya, EhD.; Kamenskaya, A.N.; Mikheev, N.B.; Kulyukhin, S.A.

    1997-01-01

    It is experimentally shown that initial CsI and NH 4 Hal nanocrystals combining into mixed aggregates of polyhedral form (pseudo monocrystals) are formed in the process of cocrystallization of ammonium halide and cesium iodide. The origination and growth of the pseudo monocrystals on the account of successive addition of initial crystals is described by the Fokker-Plank equation [ru

  7. 26 CFR 1.381(c)(14)-1 - Dividend carryover to personal holding company.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Dividend carryover to personal holding company. 1.381(c)(14)-1 Section 1.381(c)(14)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(14)-1...

  8. 25 CFR 141.57 - Procedures to cancel liability on bond.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Procedures to cancel liability on bond. 141.57 Section 141.57 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Procedures to cancel liability on bond. (a) Any surety who wishes to be relieved from liability arising on a...

  9. Tunable Optical Delay in Doppler-Broadened Cesium Vapor

    Science.gov (United States)

    2010-12-01

    REFERENCE: 36 % [1] J. M. Amini and H. Gould 37 % High Precision Measurement of the Static Dipole Polarizability of Cs 38 % Phys. Rev. Lett., American... polarizability of cesium. Phys. Rev. Lett. 91 (15), 153001. Andalkar, A. and R. B. Warrington (2002, Feb). High-resolution measurement of the pressure...Physics Publishing. Morgus, L., T. Morgus, T. Drake, and J. Huennekens (2008). Hyperfine state- changing collisions of Cs (6p1/2) atoms with argon

  10. Mechanism of cesium sorption on potassium titanium hexacyanoferrate

    International Nuclear Information System (INIS)

    Sun Yongxia; Xu Shiping; Song Chongli

    1998-01-01

    The mechanism of cesium sorption on potassium titanium hexacyanoferrate is described. The dependence of the sorption speed on temperature, particle granule size, and the stirring speed is studied. The results show that the sorption process is controlled by liquid film diffusion and particle diffusion. An exchange reaction occurs mainly between K + in the exchanger and Cs + in the solution, i.e. potassium titanium hexacyanoferrate, and Cs + of simulated high-level liquid waste

  11. Distribution of radioactive cesium ((134)Cs Plus(137)Cs) in a contaminated Japanese soybean cultivar during the preparation of tofu, natto, and nimame (Boiled Soybean).

    Science.gov (United States)

    Hachinohe, Mayumi; Kimura, Keitarou; Kubo, Yuji; Tanji, Katsuo; Hamamatsu, Shioka; Hagiwara, Shoji; Nei, Daisuke; Kameya, Hiromi; Nakagawa, Rikio; Matsukura, Ushio; Todoriki, Setsuko; Kawamoto, Shinichi

    2013-06-01

    We investigated the fate of radioactive cesium ((134)Cs plus (137)Cs) during the production of tofu, natto, and nimame (boiled soybean) from a contaminated Japanese soybean cultivar harvested in FY2011. Tofu, natto, and nimame were made from soybean grains containing radioactive cesium (240 to 340 Bq/kg [dry weight]), and the radioactive cesium in the processed soybean foods and in by-product fractions such as okara, broth, and waste water was measured with a germanium semiconductor detector. The processing factor is the ratio of radioactive cesium concentration of a product before and after processing. For tofu, natto, nimame, and for the by-product okara, processing factors were 0.12, 0.40, 0.20, and 0.18, respectively; this suggested that these three soybean foods and okara, used mainly as an animal feed, can be considered safe for human and animal consumption according to the standard limit for radioactive cesium of soybean grains. Furthermore, the ratio of radioactive cesium concentrations in the cotyledon, hypocotyl, and seed coat portions of the soybean grain was found to be approximately 1:1:0.4.

  12. Collisional Dynamics of the Cesium D1 and D2 Transitions

    Science.gov (United States)

    2010-09-01

    37 14. Comparison of Phase Changing Probability and Polarizability ...Phase Changing Probability and Polarizability for D2 Transition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 25...theoretically determined the values for broadening and shift rates for cesium with Argon , Krypton, and Xenon from the interatomic potentials [27]. The rates

  13. Uptake and transport of radioactive cesium and strontium into grapevines after leaf contamination

    Science.gov (United States)

    Zehnder, H. J.; Kopp, P.; Eikenberg, J.; Feller, U.; Oertli, J. J.

    1995-07-01

    From 1989 to 1993 the foliar uptake of radioactive strontium (Sr-85) and cesium (Cs-134) by selected leaves of grapevine plants and the subsequent redistribution within the plants was examined under controlled conditions in a greenhouse. The radionuclides were applied as chlorides. These plants were grown in large pots containing a mixture of local soil and peat. Plant and soil samples were analyzed throughout the growing season and also during the following vegetation period. Only traces of the applied radiostrontium were taken up by the leaves. This element was essentially not redistributed within the plants. In contrast, radiocesium was easily taken up through the leaf surface, transported to other plant parts and to some extent released from the roots into the soil. Cesium reaching the soil may interact with clay particles causing a very reduced availability for plants. Therefore the soil may act as a long-term sink for radiocesium. On the other hand, grape berries represent transient sinks. The cesium levels in the berries decreased again in a late phase of maturation, but the mechanisms causing this loss are not yet identified. During the second vegetation period, only a very minor proportion of the radiocesium taken up previously by the plants was present in the above ground parts.

  14. 40 CFR 141.86 - Monitoring requirements for lead and copper in tap water.

    Science.gov (United States)

    2010-07-01

    ... copper in tap water. 141.86 Section 141.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.86 Monitoring requirements for lead and copper in tap water. (a) Sample site location. (1) By the... the water system can collect the number of lead and copper tap samples required in paragraph (c) of...

  15. Simulation of Sediment and Cesium Transport in the Ukedo River and the Ogi Dam Reservoir during a Rainfall Event using the TODAM Code

    Energy Technology Data Exchange (ETDEWEB)

    Onishi, Yasuo; Yokuda, Satoru T.; Kurikami, Hiroshi

    2014-03-28

    The accident at the Fukushima Daiichi Nuclear Power Plant in March 2011 caused widespread environmental contamination. Although decontamination activities have been performed in residential areas of the Fukushima area, decontamination of forests, rivers, and reservoirs is still controversial because of the economical, ecological, and technical difficulties. Thus, an evaluation of contaminant transport in such an environment is important for safety assessment and for implementation of possible countermeasures to reduce radiation exposure to the public. The investigation revealed that heavy rainfall events play a significant role in transporting radioactive cesium deposited on the land surface, via soil erosion and sediment transport in rivers. Therefore, we simulated the sediment and cesium transport in the Ukedo River and its tributaries in Fukushima Prefecture, including the Ogaki Dam Reservoir, and the Ogi Dam Reservoir of the Oginosawa River in Fukushima Prefecture during and after a heavy rainfall event by using the TODAM (Time-dependent, One-dimensional Degradation And Migration) code. The main outcomes are the following: • Suspended sand is mostly deposited on the river bottom. Suspended silt and clay, on the other hand, are hardly deposited in the Ukedo River and its tributaries except in the Ogaki Dam Reservoir in the Ukedo River even in low river discharge conditions. • Cesium migrates mainly during high river discharge periods during heavy rainfall events. Silt and clay play more important roles in cesium transport to the sea than sand does. • The simulation results explain variations in the field data on cesium distributions in the river. Additional field data currently being collected and further modeling with these data may shed more light on the cesium distribution variations. • Effects of 40-hour heavy rainfall events on clay and cesium transport continue for more than a month. This is because these reservoirs slow down the storm-induced high

  16. Detection of quadrupole relaxation in an optically pumped cesium vapour

    Energy Technology Data Exchange (ETDEWEB)

    Bernabeu, E; Tornos, J

    1985-10-01

    The relaxation of quadrupole orientation induced by means of optical pumping in a cesium vapour is experimentally studied, and the results are compared to the theoretical predictions. The optical detection process of this type of orientation is also discussed as a function of the polarization and spectral profile of the detection light.

  17. Removal of cesium and separation of strontium the analysis of the leachate of spent fuel

    International Nuclear Information System (INIS)

    Kim, Seung Soo; Chun, Kwan Sik; Kang, Chul Hyung

    2002-01-01

    The selective removal of cesium by ammonium molybdophosphate (AMP) was studied in order to reduce an interference by high radioactivity of cesium on the determination of low radioactive elements in leachate of spent fuel. The removal of Cs, U, Ce, La, Co, Na Sr and K was investigated for the leachate and the bentonite in contact with a spent fuel. More than 90% of cesium was removed by AMP and Ca, Na, Co and Sr was remained in 0.1M HNO 3 . However, three valence elements such as La and Ce were also removed by AMP. Though a little of potassium of the bentonite components was adsorbed on AMP, the potassium in the bentonite solution diluted to its concentration in a real sample would not affect the capacity of AMP greatly. From another experiment for the separation of strontium as a leaching indicator of spent fuel, the recovery of strontium in 8.0 M HNO 3 solution by using Sr-resin (Eichrom, P/N SR-B50-A) was more than 95% by eluting with 0.05 M HNO 3

  18. Fallout cesium-137 and mineral-element distribution in food chains of granitic-outcrop ecosystems

    International Nuclear Information System (INIS)

    Crossley, D.A. Jr.; Duke, K.M.; Waide, J.B.

    1975-01-01

    Fallout 137 Cs movement is described for arthropod food chains on Panola and Arabia mountains, granite monadnocks in the Georgia Piedmont region. Food chains on mountain slopes had significant 137 Cs in herbivore and predator trophic levels. Food bases were identified from observation and from cesium to potassium ratios in vegetation and arthropods. Lichens are major accumulators of fallout 137 Cs but do not appear to be important food sources for arthropods. Cesium-137 concentrations decrease in the food chains; these decreases resemble those reported for other terrestrial arthropod chains. Aspects of 137 Cs movement and nutrient-element dynamics in granitic-outcrop ecosystems are discussed

  19. The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes

    International Nuclear Information System (INIS)

    Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.

    1981-01-01

    The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)

  20. Molecular cloning and expression analysis of a zebrafish novel zinc finger protein gene rnf141

    Directory of Open Access Journals (Sweden)

    Wenqian Deng

    2009-01-01

    Full Text Available ZNF230 is a novel zinc finger gene cloned by our laboratory. In order to understand the potential functions of this gene in vertebrate development, we cloned the zebrafish orthologue of human ZNF230, named rnf141. The cDNA fragment of rnf141 was obtained by rapid amplification of cDNA ends (RACE. The open reading frame (ORF encodes a polypeptide of 222 amino acids which shares 75.65% identity with the human ZNF230. RT-PCR analysis in zebrafish embryo and adult tissues revealed that rnf141 transcripts are maternally derived and that rnf141 mRNA has a broad distribution. Zygotic rnf141 message is strongly localized in the central nervous system, as shown by whole-mount in situ hybridization. Knockdown and over expression of rnf141 can induce abnormal phenotypes, including abnormal development of brain, as well as yolk sac and axis extendsion. Marker gene analysis showed that rnf141 may play a role in normal dorsoventral patterning of zebrafish embryos, suggesting that rnf141 may have a broad function during early development of vertebrates.