
Sample records for cesium 138

  1. Process for recovering cesium from cesium alum

    Mein, P.G.


    Cesium is recovered from cesium alum, CsAl(SO 4 ) 2 , by a two-reaction sequence in which the cesium alum is first dissolved in an aqueous hydroxide solution to form cesium alum hydroxide, CsAl(OH) 3 , and potassium sulfate, K 2 SO 4 . Part of the K 2 SO 4 precipitates and is separated from the supernatant solution. In the second reaction, a water-soluble permanganate, such as potassium permanganate, KMnO 4 , is added to the supernatant. This reaction forms a precipitate of cesium permanganate, CsMnO 4 . This precipitate may be separated from the residual solution to obtain cesium permanganate of high purity, which can be sold as a product or converted into other cesium compounds

  2. Cesium-137

    Ammerich, Marc; Frot, Patricia; Gambini, Denis-Jean; Gauron, Christine; Moureaux, Patrick; Herbelet, Gilbert; Lahaye, Thierry; Pihet, Pascal; Rannou, Alain


    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  3. Process for recovering cesium from cesium alum

    Mein, P.G.


    Cesium is recovered from cesium alum, CsAl(SO 4 ) 2 , by an aqueous conversion and precipitation reaction using a critical stoichiometric excess of a water-soluble permanganate to form solid cesium permanganate (CsMnO 4 ) free from cesium alum. The other metal salts remain in solution, providing the final pH does not cause hydroxides of aluminium or iron to form. The precipitate is separated from the residual solution to obtain CsMnO 4 of high purity

  4. Decorporation of cesium-137

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C.


    Cesium radio-isotopes, especially cesium-137 ( 137 Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137 Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137 Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137 Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  5. Methods of producing cesium-131

    Meikrantz, David H; Snyder, John R


    Methods of producing cesium-131. The method comprises dissolving at least one non-irradiated barium source in water or a nitric acid solution to produce a barium target solution. The barium target solution is irradiated with neutron radiation to produce cesium-131, which is removed from the barium target solution. The cesium-131 is complexed with a calixarene compound to separate the cesium-131 from the barium target solution. A liquid:liquid extraction device or extraction column is used to separate the cesium-131 from the barium target solution.

  6. Cesium glass irradiation sources

    Plodinec, M.J.


    The precipitation process for the decontamination of soluble SRP wastes produces a material whose radioactivity is dominated by 137 Cs. Potentially, this material could be vitrified to produce irradiation sources similar to the Hanford CsCl sources. In this report, process steps necessary for the production of cesium glass irradiation sources (CGS), and the nature of the sources produced, are examined. Three options are considered in detail: direct vitrification of precipitation process waste; direct vitrification of this waste after organic destruction; and vitrification of cesium separated from the precipitation process waste. Direct vitrification is compatible with DWPF equipment, but process rates may be limited by high levels of combustible materials in the off-gas. Organic destruction would allow more rapid processing. In both cases, the source produced has a dose rate of 2 x 10 4 rads/hr at the surface. Cesium separation produces a source with a dose rate of 4 x 10 5 at the surface, which is nearer that of the Hanford sources (2 x 10 6 rads/hr). Additional processing steps would be required, as well as R and D to demonstrate that DWPF equipment is compatible with this intensely radioactive material

  7. Recovery of cesium

    Izatt, Reed M.; Christensen, James J.; Hawkins, Richard T.


    A process of recovering cesium ions from mixtures of ions containing them and other ions, e.g., a solution of nuclear waste materials, which comprises establishing a separate source phase containing such a mixture of ions, establishing a separate recipient phase, establishing a liquid membrane phase in interfacial contact with said source and recipient phases, said membrane phase containing a ligand, preferably a selected calixarene as depicted in the drawing, maintaining said interfacial contact for a period of time long enough to transport by said ligand a substantial portion of the cesium ion from the source phase to the recipient phase, and recovering the cesium ion from the recipient phase. The separation of the source and recipient phases may be by the membrane phase only, e.g., where these aqueous phases are emulsified as dispersed phases in a continuous membrane phase, or may include a physical barrier as well, e.g., an open-top outer container with an inner open-ended container of smaller cross-section mounted in the outer container with its open bottom end spaced from and above the closed bottom of the outer container so that the membrane phase may fill the outer container to a level above the bottom of the inner container and have floating on its upper surface a source phase and a recipient phase separated by the wall of the inner container as a physical barrier. A preferred solvent for the ligand is a mixture of methylene chloride and carbon tetrachloride.

  8. 33 CFR 138.40 - Forms.


    ...) § 138.40 Forms. All forms referred to in this subpart may be obtained from NPFC by requesting them in writing at the address given in § 138.45(a) or by clicking on the Forms link at the NPFC E-COFR Web site... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Forms. 138.40 Section 138.40...

  9. Cesium reservoir and interconnective components


    The program objective is to demonstrate the technology readiness of a TFE (thermionic fuel element) suitable for use as the basic element in a thermionic reactor with electric power output in the 0.5 to 5.0 MW range. A thermionic converter must be supplied with cesium vapor for two reasons. Cesium atoms adsorbed on the surface of the emitter cause a reduction of the emitter work function to permit high current densities without excessive heating of the emitter. The second purpose of the cesium vapor is to provide space-charge neutralization in the emitter-collector gap so that the high current densities may flow across the gap unattenuated. The function of the cesium reservoir is to provide a source of cesium atoms, and to provide a reserve in the event that cesium is lost from the plasma by any mechanism. This can be done with a liquid cesium metal reservoir in which case it is heated to the desired temperature with auxiliary heaters. In a TFE, however, it is desirable to have the reservoir passively heated by the nuclear fuel. In this case, the reservoir must operate at a temperature intermediate between the emitter and the collector, ruling out the use of liquid reservoirs. Integral reservoirs contained within the TFE will produce cesium vapor pressures in the desired range at typical electrode temperatures. The reservoir material that appears to be the best able to meet requirements is graphite. Cesium intercalates easily into graphite, and the cesium pressure is insensitive to loading for a given intercalation stage. The goals of the cesium reservoir test program were to verify the performance of Cs-graphite reservoirs in the temperature-pressure range of interest to TFE operation, and to test the operation of these reservoirs after exposure to a fast neutron fluence corresponding to seven year mission lifetime. In addition, other materials were evaluated for possible use in the integral reservoir

  10. Cesium-137. Environment. Man

    Moiseev, A.A.


    Analysis of all main sourses of cerium-137 formation and intake into the external medium is given. Special attention is paid to the estimation of possible influence of rapidly developing nuclear power industry on contamination of the external medium by the radionuclide. Levels of contamination of the external medium by cerium-137, main regularities of its migration through food chains, levels of its intake and accumulation in population's organisms in USSR and its separate regions, are considered. Great attention is paid to the control methods of external environmental contamination by cesium-137 and to its measurements in human body

  11. Mineral resource of the month: cesium

    Angulo, Marc A.


    The article offers information on cesium, a golden alkali metal derived from the Latin word caesium which means bluish gray. It mentions that cesium is the first element discovered with the use of spectroscopy. It adds that the leading producer and supplier of cesium is Canada and there are 50,000 kilograms of cesium consumed of the world in a year. Moreover, it states that only 85% of the cesium formate can be retrieved and recycled.

  12. ''Crown molecules'' for separating cesium

    Dozol, J.F.; Lamare, V.


    After the minor actinides, the second category of radionuclides that must be isolated to optimize nuclear waste management concerns fission products, especially two cesium isotopes. If the cesium-135 isotope could be extracted, it could subsequently be transmuted or conditioned using a tailor-made process. Eliminating the 137 isotope from reprocessing and nuclear facility-dismantling waste would allow to dispose of most of this waste in near-surface facilities, and simply process the small remaining quantity containing long-lived elements. CEA research teams and their international partners have thought up crown molecules that could be used to pick out the cesium and meet these objectives. (authors)

  13. Cesium diffusion in graphite

    Evans, R.B. III; Davis, W. Jr.; Sutton, A.L. Jr.


    Experiments on diffusion of 137 Cs in five types of graphite were performed. The document provides a completion of the report that was started and includes a presentation of all of the diffusion data, previously unpublished. Except for data on mass transfer of 137 Cs in the Hawker-Siddeley graphite, analyses of experimental results were initiated but not completed. The mass transfer process of cesium in HS-1-1 graphite at 600 to 1000 0 C in a helium atmosphere is essentially pure diffusion wherein values of (E/epsilon) and ΔE of the equation D/epsilon = (D/epsilon) 0 exp [-ΔE/RT] are about 4 x 10 -2 cm 2 /s and 30 kcal/mole, respectively

  14. Process for recovering cesium from pollucite

    Mein, P.G.


    Cesium is recovered from a cesium-bearing mineral such as pollucite by extraction with hydrochloric acid to obtain an extract of cesium chloride and other alkali metal and polyvalent metal chlorides. The iron and aluminum chlorides can be precipitated as the hydroxides and separated from the solution of the alkali metal chlorides to which is added potassium permanganate or other water-soluble permanganate to selectively precipitate cesium permanganate. The cesium precipitate is then separated from the residual solution containing the metal chlorides. The cesium permanganate, which is in a very pure form, can be converted to other cesium compounds by reaction with a reducing agent to obtain cesium carbonate and cesium delta manganese dioxide

  15. Cesium Concentration in MCU Solvent

    Walker, D


    During Modular Caustic-Side Solvent Extraction (CSSX) Unit (MCU) operations, Cs-137 concentrations in product streams will vary depending on the location in the process and on the recent process conditions. Calculations of cesium concentrations under a variety of operating conditions reveal the following: (1) Under nominal operations with salt solution feed containing 1.1 Ci Cs-137 per gallon, the maximum Cs-137 concentration in the process will occur in the strip effluent (SE) and equal 15-16.5 Ci/gal. (2) Under these conditions, the majority of the solvent will contain 0.005 to 0.01 Ci/gal, with a limited portion of the solvent in the contactor stages containing ∼4 Ci/gal. (3) When operating conditions yield product near 0.1 Ci Cs-137/gal in the decontaminated salt solution (DSS), the SE cesium concentration will be the same or lower than in nominal operations, but majority of the stripped solvent will increase to ∼2-3 Ci/gal. (4) Deviations in strip and waste stream flow rates cause the largest variations in cesium content: (a) If strip flow rates deviate by -30% of nominal, the SE will contain ∼23 Ci/gal, although the cesium content of the solvent will increase to only 0.03 Ci/gal; (b) If strip flow rate deviates by -77% (i.e., 23% of nominal), the SE will contain 54 Ci/gal and solvent will contain 1.65 Ci/gal. At this point, the product DSS will just reach the limit of 0.1 Ci/gal, causing the DSS gamma monitors to alarm; and (c) Moderate (+10 to +30%) deviations in waste flow rate cause approximately proportional increases in the SE and solvent cesium concentrations. Recovery from a process failure due to poor cesium stripping can achieve any low cesium concentration required. Passing the solvent back through the contactors while recycling DSS product will produce a ∼70% reduction during one pass through the contactors (assuming the stripping D value is no worse than 0.36). If the solvent is returned to the solvent hold tank (containing additional

  16. Cesium removal and kinetics equilibrium: Precipitation kinetics

    Barnes, M.J.


    This task consisted of both non-radioactive and radioactive (tracer) tests examining the influence of potentially significant variables on cesium tetraphenylborate precipitation kinetics. The work investigated the time required to reach cesium decontamination and the conditions that affect the cesium precipitation kinetics

  17. Process for cesium decontamination and immobilization

    Komarneni, Sridhar; Roy, Rustum


    Cesium can be selectively recovered from a nuclear waste solution containing cesium together with other metal ions by contact with a modified phlogopite which is a hydrated, sodium phlogopite mica. Once the cesium has entered the modified phlogopite it is fixed and can be safely stored for long periods of time.

  18. Process for cesium decontamination and immobilization

    Komarneni, S.; Roy, R.


    Cesium can be selectively recovered from a nuclear waste solution containing cesium together with other metal ions by contact with a modified phlogopite which is a hydrated, sodium phlogopite mica. Once the cesium has entered the modified phlogopite it is fixed and can be safely stored for long periods of time. 6 figs., 2 tabs.

  19. Cesium in the nutrient cycle

    Rantavaara, A.


    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland

  20. Cesium transport data for HTGR systems

    Myers, B.F.; Bell, W.E.


    Cesium transport data on the release of cesium from HTGR fuel elements are reviewed and discussed. The data available through 1976 are treated. Equations, parameters, and associated variances describing the data are presented. The equations and parameters are in forms suitable for use in computer codes used to calculate the release of metallic fission products from HTGR fuel elements into the primary circuit. The data cover the following processes: (1) diffusion of cesium in fuel kernels and pyrocarbon, (2) sorption of cesium on fuel rod matrix material and on graphite, and (3) migration of cesium in graphite. The data are being confirmed and extended through work in progress

  1. Cesium in the nutrient cycle. Cesium metsaen ravinnekierrossa marjojen ja sienten cesium ei vaehene

    Rantavaara, A


    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland.

  2. Particle-hole states in 138Ba

    Bondarenko, V.A.; Khitrov, V.A.; Popov, Yu.P.; Brant, S.; Paar, V.; Simicic, L.


    The thermal-neutron-capture gamma rays and γγ-coincidences were measured by means of Ge detectors. Using primary and secondary (n, γ) data, the level scheme of 138 Ba was established with 63 levels up to an excitation energy of 5 MeV. The level energies and (d, p) transfer data were compared with model predictions of the interacting boson-fermion-fermion model. As shown, this model provides a basic understanding of the neutron particle-hole states of 138 Ba in the energy range of 3.5-5.0 MeV. ((orig.))

  3. 33 CFR 138.20 - Definitions.


    ... financial responsibility referred to in § 138.10(a): claim, claimant, damages, discharge, exclusive economic... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water...

  4. 7 CFR 1956.138 - Processing.


    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) DEBT SETTLEMENT Debt Settlement-Community and Business Programs § 1956.138 Processing... this subpart. (d) Appeal rights. In accordance with Subpart B of Part 1900 of this chapter, the debtor...

  5. RNF138 joins the HR team

    Bekker-Jensen, Simon; Mailand, Niels


    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  6. Decorporation of cesium-137; Decorporation du cesium-137

    Le Fleche, Ph; Destombe, C; Grasseau, A; Mathieu, J; Chancerelle, Y; Mestries, J C [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)


    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  7. Decorporation of cesium-137; Decorporation du cesium-137

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)


    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  8. Method for primary containment of cesium wastes

    Angelini, P.; Arnold, W.D.; Blanco, R.E.; Bond, W.D.; Lackey, W.J.; Stinton, D.P.


    A method for producing a cesium-retentive waste form, characterized by a high degree of compositional stability and mechanical integrity, is provided by subjecting a cesium-loaded zeolite to heat under conditions suitable for stabilizing the zeolite and immobilizing the cesium, and coating said zeolite for sufficient duration within a suitable environment with at least one dense layer of pyrolytic carbon to seal therein said cesium to produce a final, cesium-bearing waste form. Typically, the zeolite is stabilized and the cesium immobilized in less than four hours by confinement within an air environment maintained at about 600 0 C. Coatings are thereafter applied by confining the calcined zeolite within a coating environment comprising inert fluidizing and carbon donor gases maintained at 1,000* C. For a suitable duration

  9. Cesium-137, a drama recounted

    Vieira, Suzane de Alencar


    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  10. Myocardial imaging with cesium-130

    Harper, P.V.; Resnekov, L.; Stark, V.; Odeh, N.


    Recently comparative studies using nitrogen-13 ammonia and cesium-130 have shown strikingly different myocardial localization patterns in the same subjects with ischemic heart disease. Initial localization of ammonia, an avidly extracted agent, reflects the perfusion pattern in viable myocardial tissue. The myocardial localization of cesium ion, taking place more slowly over 15 to 20 minutes, is apparently much less flow dependent, causing uptake defects shown with ammonia to be largely filled in. Cesium thus appears to provide information on the extent of the viable myocardial mass, apart from perfusion. Cesium-130 (t1/2 30 m) decays by positron emission and electron capture. The whole body radiation absorbed dose, assuming uniform distribution, is 24 mrad/mCi. While abundant production of Cs-130 results from proton bombardment of natural xenon [Xe-130(rho,n)Cs-130] at 15 MeV, small amounts of Cs-129, -131, and -132 are also produced, and enriched Xe-130 is not available. Alternatively almost completely uncontaminated Cs-130 is available by alpha bombardment of natural I-127. Anhydrous sodium iodide is dissolved in acetone and a thin layer (≅20 mg per centimeter squared) is evaporated onto the gold plated tip of the internal target backing which is oscillated vertically to spread out the area upon which the beam is incident. The target surface is inclined 2.5 degrees to the beam giving a power density of about 400 watts per centimeter squared at 100μA which is adequately handled by water cooling. A 30-minute bombardment yields 4 to 5 mCi of Cs-130 which is dissolved directly from the target. This approach appears to offer a new and helpful method for evaluating ischemic heart disease by permitting evaluation of viable myocardial mass

  11. Cesium migration in LMFBR fuel pins

    Karnesky, R.A.; Jost, J.W.; Stone, I.Z.


    The factors affecting the axial migration of cesium in mixed oxide fuel pins and the effects of cesium migration on fuel pin performance are examined. The development and application of a correlated model which will predict the occurrence of cesium migration in a mixed oxide (75 w/o UO 2 + 25 w/o PuO 2 ) fuel pins over a wide range of fabrication and irradiation conditions are described

  12. Electrically switched cesium ion exchange

    Lilga, M.A.; Orth, R.J.; Sukamto, J.P.H.; Schwartz, D.T.; Haight, S.M.; Genders, J.D.


    Electrically Switched Ion Exchange (ESIX) is a separation technology being developed as an alternative to conventional ion exchange for removing radionuclides from high-level waste. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution are controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. A case study for the KE Basin on the Hanford Site was conducted based on the results of the development testing. Engineering design baseline parameters for film deposition, film regeneration, cesium loading, and cesium elution were used for developing a conceptual system. Order of magnitude cost estimates were developed to compare with conventional ion exchange. This case study demonstrated that KE Basin wastewater could be processed continuously with minimal secondary waste and reduced associated disposal costs, as well as lower capital and labor expenditures

  13. Cesium heat-pipe thermostat

    Wu, F.; Song, D.; Sheng, K.; Wu, J. [Changcheng Institute of Metrology and Measurement, 100095, Beijing (China); Yi, X. [China National South Aviation industry CO., LTD., 412002, Hunan (China); Yu, Z. [Dalian Jinzhou Institute of Measurement and Testing, 116100, Liaoning (China)


    In this paper the authors report a newly developed Cesium Heat-Pipe Thermostat (Cs HPT) with the operation range of 400 °C to 800 °C. The working medium is cesium (Cs) of 99.98% purity and contains no radioisotope. A Cs filing device is developed which can prevent Cs being in contact with air. The structural material is stainless steel. A 5000 h test has been made to confirm the compatibility between cesium and stainless steel. The Cs HPT has several thermometer wells of 220mm depth with different diameters for different sizes of thermometers. The temperature uniformity of the Cs HPT is 0.06 °C to 0.20 °C. A precise temperature controller is used to ensure the temperature fluctuation within ±0.03 °C. The size of Cs HPT is 380mm×320mm×280mm with foot wheels for easy moving. The thermostat has been successfully used for the calibration of industrial platinum resistance thermometers and thermocouples.

  14. Dicty_cDB: VHE138 [Dicty_cDB

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  15. Extraction of radioactive cesium from tea leaves

    Yano, Yukiko; Kubo, M. Kenya; Higaki, Shogo; Hirota, Masahiro; Nomura, Kiyoshi


    Radioactive contamination of foodstuffs attributed to the Fukushima Daiichi nuclear disaster has become a social problem. This study investigated the extraction of radioactive cesium from the contaminated leaves to the tea. The green tea was brewed twice reusing the same leaves to study the difference in extraction of cesium between the first and second brew. Moreover, the extraction of cesium was studied in correlation to brewing time. The concentration of radioactive cesium was determined with gamma spectrometry, and the concentration of caffeine was determined with absorption spectrometry. About 40% of cesium was extracted from leaves in the first brew, and about 80% was extracted in the second brew. The extraction of cesium increased over time, and it reached about 80% after 10 minutes brew. The ratio of radioactive cesium to caffeine decreased linearly over time. This study revealed that the extraction of cesium was higher for the second brew, and a rapid increase in extraction was seen as the tea was brewed for 6 minutes and more. Therefore, the first brew of green tea, which was brewed within 5 minutes, contained the least extraction of radioactive cesium from the contaminated leaves. (author)

  16. Separation of cesium and strontium with zeolites

    Kanno, T; Hashimoto, H [Tohoku Univ., Sendai (Japan). Research Inst. of Mineral Dressing and Metallurgy


    The basic studies of separation of cesium and strontium were made with specimens of zeolite, which are synthetic zeolites A, X and Y; synthetic mordenite; natural mordenite; and clinoptilolite. Ammonium chloride was used as eluent, because it was considered to be a most appropriate eluent in alkaline chlorides. Cesium was easily eluted from the zeolites A and X by ammonium chloride solution, but it was difficult to elute from the synthetic mordenite, natural mordenite and clinoptilolite by ammonium chloride solution, but it was difficult to elute from the zeolites A and X. The zeolite Y is the only one zeolite among these zeolites from which both of cesium and strontium were easily eluted by ammonium chloride solution. Strontium could be separated from cesium with zeolites by formation of Sr-EDTA chelate at pH above 11. In this process, cesium was only exchanged in zeolite column, but strontium flow out from it.

  17. Separation of cesium and strontium with zeolites

    Kanno, Takuji; Hashimoto, Hiroyuki


    The basic studies of separation of cesium and strontium were made with specimens of zeolite, which are synthetic zeolites A, X and Y; synthetic mordenite; natural mordenite; and clinoptilolite. Ammonium chloride was used as eluent, because it was considered to be a most appropriate eluent in alkaline chlorides. Cesium was easily eluted from the zeolites A and X by ammonium chloride solution, but it was difficult to elute from the synthetic mordenite, natural mordenite and clinoptilolite by ammonium chloride solution, but it was difficult to elute from the zeolites A and X. The zeolite Y is the only one zeolite among these zeolites from which both of cesium and strontium were easily eluted by ammonium chloride solution. Strontium could be separated from cesium with zeolites by formation of Sr-EDTA chelate at pH above 11. In this process, cesium was only exchanged in zeolite column, but strontium flow out from it. (auth.)

  18. Radiochemical determination of cesium-137 in seawater

    Cunha, I.I.L.; Munita, C.S.; Paiva, R.P.


    Seawater samples were collected from the Atlantic Ocean, in the vicinity of Ubatuba (Sao Paulo State - Brazil), acidified to pH 1 and stored in polyethylene containers. Cesium was precipitated with ammonium phospho molybdate (AMP), synthesized in our laboratory. The elements potassium and rubidium present in the seawater are also coprecipitated by AMP and adequate decontamination of the cesium is made by preparing a column by mixing Cs-137 AMP precipitate and asbestos. The interfering elements were eluted with 1.0 M ammonium nitrate solution whereas cesium was eluted with 1.0 M sodium hydroxide solution. Cesium was reprecipitated by acidifying the solution with concentrated hydrochloric acid. The overall chemical yield of cesium was of 75%. (author)

  19. Iotech cesium capsule recovery abstract

    Stevens, J.; Higgins, D.


    This report has been prepared to detail the project operations performed by OHM Remediation Services Corp. (OHM) under contract to the Westinghouse Hanford Company (WHC) for the removal and transfer of 309 cesium sources from the lotech Inc. Facility in Northglenn, Colorado, to the Department of Energy Site in Hanford, Washington. The activities covered by this report were performed between October of 1993 and August of 1995. The report includes the following major sections: (1) Project Description, (2) Project Organization, (3) Major Project Tasks, (4) Industrial and Radiological Safety, (5) Personnel Exposures, (6) Quality Assurance, (7) Scheduling/Costs, and (8) Lessons Learned

  20. Multiphoton ionization of atomic cesium

    Compton, R.N.; Klots, C.E.; Stockdale, J.A.D.; Cooper, C.D.


    We describe experimental studies of resonantly enhanced multi-photon ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photo-electron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photo-ionization signal. For both ns and np states the ''field induced'' MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength

  1. Multiphoton ionization of atomic cesium

    Compton, R.N.; Klots, C.E.; Stockdale, J.A.D.; Cooper, C.D.


    We describe experimental studies of resonantly enhanced multiphoton ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photoelectron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photoionization signal. For both ns and np states the field induced MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength. Finally, we note that the classical two-photon field-ionization threshold is lower for the case in which the laser polarization and the electric field are parallel than it is when they are perpendicular. 22 references, 11 figures

  2. Thermal properties of cesium molybdate

    Minato, Kazuo; Fukuda, Kousaku; Takano, Masahide; Sato, Seichi; Ohashi, Hiroshi


    Cesium is one of the most important fission products to aid in the understanding and prediction of the behavior of oxide nuclear fuels because of its high mobility, chemical reactivity, and large yield. In postirradiation examinations of the Phoenix reactor fuel pins, the accumulation of cesium and molybdenum between the fuel pellet and cladding was observed, though the chemical form was not determined. In the thermodynamic analyses of chemical states of fission products, Cs 2 MoO 4 was often predicted to exist as a stable compound in oxide fuels. The Cs 2 MoO 4 compound is thermodynamically stable under the conditions of light water reactors, fast breeder reactors, and high-temperature gas-cooled reactors. In the Cs-Mo-O system several phases have been found, and the structural and thermodynamic properties were studied. At room temperature, Cs 2 MoO 4 has an orthorhombic structure and a phase transition occurs at 841 K to a hexagonal structure. Both structures are expected to exist in the fuel, depending on the fuel temperature. However, no data has been available on the thermal properties of CS 2 MoO 4 . In the current work, the thermal expansion and thermal conductivity of Cs 2 MoO 4 were determined, which are the basic data needed to understand and predict the fuel/clad mechanical interaction and fuel temperature

  3. 7 CFR 800.138 - Conflict of interest.


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Conflict of interest. 800.138 Section 800.138 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Inspection Services § 800.138 Conflict of interest. Official personnel cannot perform or participate in...

  4. 29 CFR 102.138 - Definition of meeting.


    ... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...

  5. 6 CFR 13.8 - Service of Complaint.


    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Service of Complaint. 13.8 Section 13.8 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.8 Service of Complaint. (a) Service of a Complaint must be Made by certified or registered mail or by...

  6. 32 CFR 935.138 - Motor bus operation.


    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

  7. Application of Cesium isotopes in daily life

    Jordao, B.O.; Quaresma, D.S.; Carvalho, R.J.; Peixoto, J.G.P.


    In the world of science, the desire of the scientific community to discover new chemical elements is crucial for the development of new technologies in various fields of knowledge. And the main chemical element addressed by this article is Cesium, but specifically 133 Cesium isotope and radioisotope 137 Cesium, exemplifying their physical and chemical characteristics, and their applications. This article will also show how these isotopes have provided researchers a breakthrough in the field of radiological medicine and in time and frequency metrology. (author)

  8. Cesium Eluate Analytical Data Evaluation

    Pierce, R.A.


    Bechtel National Inc. (BNI) is using IBC Company's SuperLigand ion exchange resins to separate Cs and Tc from low-activity waste (LAW) solutions (IBC-1996). Cesium is removed using the SuperLig(R) 644 resin. The resin is then eluted after each use cycle with 0.5M nitric acid solution. BNI is planning to evaporate the Cs eluate solution to reduce the storage volume and recover eluate for re-use. The primary issue associated with evaporation is end point, or salt matrix solubility. To preclude formation of solids during the storage of evaporator products, an additional criteria has been set that limits the concentration of the evaporator bottoms to 80 percent of saturation at 25 degrees C. As a result, an understanding of the effects of constituent species on the bulk solubility must be developed prior to effective evaporator operations

  9. Cesium-137: A physiological disruptor?

    Souidi, Maamar; Grison, Stephane; Dublineau, Isabelle; Aigueperse, Jocelyne; Lestaevel, Philippe


    Today, radiation protection is a major issue for the nuclear industry throughout the world, particularly in France. The 2011 disaster of Fukushima Dai-ichi has brought back to public attention questions about the risks associated with nuclear power for civilian purposes. The risk of accidental release of radioactive molecules, including cesium-137 ( 137 Cs), from these facilities cannot be completely eliminated. The non-cancer-related health consequences of chronic exposure to this radionuclide remain poorly understood. After absorption, cesium is distributed throughout the body. The toxicity of 137 Cs is due mainly to its radiological properties. Studies in humans report that 137 Cs impairs the immune system and induces neurological disorders. Children appear more susceptible than adults to its toxic effects. In animals, and most particularly in rodents, low-dose internal contamination disrupts the sleep-wake cycle, but without behavioural disorders. Impairment of the cardiovascular system has also been observed. Physiologic systems such as the metabolism of vitamin D, cholesterol and steroid hormones are altered, although without leading to the emergence of diseases with clinical symptoms. Recently, a metabolomics study based on contamination levels comparable to those around Chernobyl after the accident showed that it is possible to identify individual rats chronically exposed to low doses of 137 Cs, even though the exposure was too low to affect the standard clinical markers. In conclusion, the scientific evidence currently available, particularly that from experimental animal models exposed to chronic contamination, suggests that 137 Cs is likely to affect many physiologic and metabolic functions. Thus, it could contribute, with other artificial substances in the environment, to increasing the risk of developing non-cancer diseases in some regions. (authors)

  10. Cement materials for cesium and iodine confinement

    Nicolas, G.; Lequeux, N.; Boch, P.; Prene, S.


    The following topics were dealt with: radioactive waste storage, cement materials reacting with radioactive cesium and iodine, chemical barrier formation against radioactive pollution, ceramization, long term stability, XRD, PIXE analysis

  11. Cesium levels in foodstuffs fall slowly

    Rantavaara, A.


    Since spring 1986, radioactive decay has reduced the total amount of radioactive cesium 137 in the Finnish environment, originating in Chernobyl, by 17 per cent. The cesium content in fish keeps falling at a diminishing rate, depending on the species of fish and environmental factors. The use of fish from lakes need not be restricted anymore. The cesium contents of game, mushrooms and wild berries have remained steady for some years now. The same is true for agricultural produce. The contents in milk and meat still keep falling slowly. Most of the cesium ingested by finns comes from fish, then from game, reindeer and gathered foods; the lowest amounts are received from agricultural products. (orig.)

  12. Method of processing radioactive cesium liquid wastes

    Nishijima, Hiroaki; Asaoka, Sachio; Kondo, Tadami; Suzuki, Isao.


    Purpose: To convert and settle cesium, mainly, Cs-137 in liquid wastes in the form of pollucites, that is, cesium-containing ores. Constitution: Water, silica, alumina and alkali metal source are mixed with radioactive liquid wastes containing cesium as the main metal element ingredient, to which an onium compound is further added and they are brought into reaction till pollucite ores (Cs 16 (Al 16 Si 32 O 96 )) are formed. Since most portion of cesium is thus settled in the form of pollucites, storage safety can be attained. Further, the addition of the onium compound can moderate the condition and shorten the time till the pollucite ores are formed. The onium compound usable herein includes tetramethyl ammonium. (Kamimura, M.)

  13. Extraction of cesium from acid solutions

    Katykhin, G.S.; Simonov, A.S.


    The extraction of cesium from acidic solutions is studied. Halogen-substituted carboxylic acids were chosen for the aqueous phase and nitrobenzene the diluent. The distribution coefficients are determined by the use of radioactive tracers 134 Cs and 137 Cs. It is believed that large singly charged anions of strong acids are necessary for the extraction of cesium. Metal halide acids are selected for supplying the anions

  14. Cesium ion bombardment of metal surfaces

    Tompa, G.S.


    The steady state cesium coverage due to cesium ion bombardment of molybdenum and tungsten was studied for the incident energy range below 500 eV. When a sample is exposed to a positive ion beam, the work function decreases until steady state is reached with a total dose of less than ≅10 16 ions/cm 2 , for both tungsten and molybdenum. A steady state minimum work function surface is produced at an incident energy of ≅100 eV for molybdenum and at an incident energy of ≅45 eV for tungsten. Increasing the incident energy results in an increase in the work function corresponding to a decrease in the surface coverage of cesium. At incident energies less than that giving the minimum work function, the work function approaches that of cesium metal. At a given bombarding energy the cesium coverage of tungsten is uniformly less than that of molybdenum. Effects of hydrogen gas coadsorption were also examined. Hydrogen coadsorption does not have a large effect on the steady state work functions. The largest shifts in the work function due to the coadsorption of hydrogen occur on the samples when there is no cesium present. A theory describing the steady-state coverage was developed is used to make predictions for other materials. A simple sticking and sputtering relationship, not including implantation, cannot account for the steady state coverage. At low concentrations, cesium coverage of a target is proportional to the ratio of (1 - β)/γ where β is the reflection coefficient and γ is the sputter yield. High coverages are produced on molybdenum due to implantation and low backscattering, because molybdenum is lighter than cesium. For tungsten the high backscattering and low implantation result in low coverages

  15. Band structures in near spherical 138Ce

    Bhattacharjee, T.; Chanda, S.; Bhattacharyya, S.; Basu, S. K.; Bhowmik, R. K.; Das, J. J.; Pramanik, U. Datta; Ghugre, S. S.; Madhavan, N.; Mukherjee, A.; Mukherjee, G.; Muralithar, S.; Singh, R. P.


    The high spin states of N=80138Ce have been populated in the fusion evaporation reaction 130Te( 12C, 4n) 138Ce at E=65 MeV. The γ transitions belonging to various band structures were detected and characterized using an array of five Clover Germanium detectors. The level scheme has been established up to a maximum spin and excitation energy of 23 ℏ and 9511.3 keV, respectively, by including 53 new transitions. The negative parity ΔI=1 band, developed on the 6536.3 keV 15 level, has been conjectured to be a magnetic rotation band following a semiclassical analysis and comparing the systematics of similar bands in the neighboring nuclei. The said band is proposed to have a four quasiparticle configuration of [πgh]⊗[. Other band structures are interpreted in terms of multi-quasiparticle configurations, based on Total Routhian Surface (TRS) calculations. For the low and medium spin states, a shell model calculation using a realistic two body interaction has been performed using the code OXBASH.

  16. [Management of spontaneous pneumothorax: about 138 cases].

    Habibi, Bouchra; Achachi, Leila; Hayoun, Sohaib; Raoufi, Mohammed; Herrak, Laila; Ftouh, Mustapha El


    Pneumothorax is a collection of air in the pleural cavity. We conducted a retrospective study of patients with spontaneous pneumothorax in the Department of Pneumology at the Ibn Sina Hospital in Rabat (2009-2011) with the aim to determine the epidemiological, clinical, radiological, therapeutic and evolutionary manifestation of spontaneous pneumothorax. The study involved 138 patients: 128 men and 10 women (17-83 years), with an average age of 44.5 +/- 17.4 years and sex ratio of 12/8. 81.2% of patients were smokers. Clinical symptomatology was chest pain (92%), dyspnea (60%). Chest radiograph showed total unilateral (110 cases); partial (10 cases); localized (6 cases); bilateral (4 cases); right (51.4%) or left (45.7%) PNO (pneumothorax). During our study period we found that 70% of patients had spontaneous primitive pneumothorax and 30% had PNO secondary to Chronic obstructive pulmonary disease (COPD) (44%) and pulmonary tuberculosis (TB) (39%). Initial management included patients hospitalization, chest drainage (95%), needle exsufflation (1%), rest and O 2 (4%). It enables the lung to stick to the chest wall within 10 days in 63% of patients. Evolution was favorable in 89% of patients. Immediate complications included: subcutaneous emphysema (5 cases); infection (6 cases) and 3 deaths (cardiorespiratory arrest). Late complications included: recurrences in 11.6%; the first recurrence occurred in 13 cases (chest drainage in 11 cases and oxygen therapy in 2 cases) while the second recurrence occurred in 3 cases (surgery). This study shows the role of chest drainage and monitoring in the management of pneumothorax to avoid complications and especially to prevent recurrences, with a possible need to resort to surgery.

  17. Statistical nuclear properties and synthesis of 138La

    Kheswa B. V.


    Full Text Available The synthesis of the neutron deficient 138La nucleus has been a puzzle for a long time. It has not been clear whether it is produced through photodisintegration processes or neutrino induced reactions due to unavailability of experimental data for nuclear level densities and γ strength functions of 138,139La nuclei. In the present work these nuclear properties have been measured and are used to investigate the synthesis of 138La. The results support the neutrino interactions as a dominant production process for 138La.

  18. Separation of cesium from aqueous solutions using alkylated tetraaryl borates

    Feldmaier, F.


    The water solubility of cesium tetraaryl borates was lowered by introducing hydrophobic aliphatic side chains into corresponding acid-resistant fluorosubstituted tetraaryl borates. This improved cesium spearability both in precipitation and in extraction from aqueous solutions. (orig.) [de

  19. Cesium vapor cycle for an advanced LMFBR

    Fraas, A.P.


    A review indicates that a cesium vapor topping cycle appears attractive for use in the intermediate fluid circuit of an advanced LMFBR designed for a reactor outlet temperature of 1250 0 F or more and would have the following advantages: (1) it would increase the thermal efficiency by about 5 to 10 points (from approximately 40 percent to approximately 45 to 50 percent) thus reducing the amount of waste heat rejected to the environment by 15 to 30 percent. (2) the higher thermal efficiency should reduce the overall capital cost of the reactor plant in dollars per kilowatt. (3) the cesium can be distilled out of the intermediate fluid circuit to leave it bone-dry, thus greatly reducing the time and cost of maintenance work (particularly for the steam generator). (4) the large volume and low pressure of the cesium vapor region in the cesium condenser-steam generator greatly reduces the magnitude of pressure fluctuations that might occur in the event of a leak in a steam generator tube, and the characteristics inherent in a condenser make it easy to design for rapid concentration of any noncondensibles that may form as a consequence of a steam leak into the cesium region so that a steam leak can be detected easily in the very early stages of its development

  20. 22 CFR 138.205 - Professional and technical services.


    ..., drafting of a legal document accompanying a bid or proposal by a lawyer is allowable. Similarly, technical... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.205... Activities by Own Employees § 138.205 Professional and technical services. (a) The prohibition on the use of...

  1. 22 CFR 138.300 - Professional and technical services.


    ... and analysis directly applying any professional or technical discipline. For example, drafting or a... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.300... Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on...

  2. 33 CFR 138.150 - Service of process.


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Service of process. 138.150... Pollution (Vessels) § 138.150 Service of process. (a) When executing the forms required by this subpart... as its agent for service of process for purposes of this subpart and for receipt of notices of...

  3. 29 CFR 780.138 - Application of the general principles.


    ... 29 Labor 3 2010-07-01 2010-07-01 false Application of the general principles. 780.138 Section 780.138 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR... principles. Some examples will serve to illustrate the above principles. Employees of a fruit grower who dry...

  4. Radioactive cesium in Finnish mushrooms

    Kostiainen, E.; Ylipieti, J.


    Surveillance of radioactive cesium in Finnish mushrooms was started in 1986 at STUK. Results of the surveillance programs carried out in Lapland and other parts of Finland are given in this report. More than 2000 samples of edible mushrooms have been analysed during 1986-2008. The 137 Cs detected in the mushrooms mainly originates from the 137 Cs deposition due to the accident at the Chernobyl nuclear power plant in 1986. The 137 Cs concentrations of mushrooms in the end of 1970s and in the beginning of 1980s varied from some ten to two hundred becquerels per kilogram originating from the nuclear weapon test period. The uneven division of the Chernobyl fallout is seen in the areal variation of 137 Cs concentrations of mushrooms, the 137 Cs concentrations being about tenfold in the areas with the highest deposition compared to those where the deposition was lowest. After the Chernobyl accident the maximum values in the 137 Cs concentrations were reached during 1987-88 among most species of mushrooms. The 137 Cs concentrations have decreased slowly, being in 2008 about 40 per cent of the maximum values. The 137 Cs concentrations may be tenfold in the mushroom species with high uptake of cesium (Rozites caperatus, Hygrophorus camarophyllus, Lactarius trivialis) compared to the species with low uptake (Albatrellus ovinus, Leccinum sp.) picked in the same area. The 137 Cs contents in certain species of commercial mushrooms in Finland still exceed the maximum permitted level, 600 Bq/kg, recommended to be respected when placing wild game, wild berries, wild mushrooms and lake fish on the market (Commission recommendation 2003/274/Euratom). Therefore, the 137 Cs concentrations of mushrooms should be measured before placing them on the market in the areas of the highest 137 Cs deposition, except for Albatrellus ovinus, Boletus sp. and Cantharellus cibarius. The 137 Cs concentrations of common commercial mushroom species, Cantharellus tubaeformis and Craterellus

  5. Cesium Salts of Phosphotungstic Acid: Comparison of Surface ...


    acidity and lowest solubility in reaction media in comparison with the other cesium content salts. KEYWORDS. Polyoxometalates, cesium ... insoluble salt of HPA is cesium salt of tungstophosphoric acid,. CsxH3-xPW12O40 (CsxPW), a ... of Cs2CO3, very fine particles (precipitates) were formed to make the solution milky.

  6. Cesium removal flow studies using ion exchange

    Lee, D.D.; Walker, J.F. Jr.; Taylor, P.A.


    Cesium and strontium radionuclides are a small fraction of the mainly sodium and potassium salts in underground storage tank supernatant at US Department of Energy (DOE) sites at Hanford, Oak Ridge, Savannah River, and Idaho that DOE must remediate. Cesium-137 ( 137 Cs) is the primary gamma radiation source in the dissolved tank waste at these sites, and its removal from the supernatant can reduce the hazard and waste classification of the treated waste reducing the further treatment and disposal costs. Several cesium removal sorbents have been developed by private industry and the US DOE's Office of Science and Technology. Several of these removal technologies have been previously tested in small batch and column tests using simulated and a few actual supernatant under DOE's Environmental Management (EM) programs including the Tanks Focus Area (TFA) and the Efficient Separations and Processing (ESP) Cross-Cutting Program

  7. Hanford waste encapsulation: strontium and cesium

    Jackson, R.R.


    The strontium and cesium fractions separated from high radiation level wastes at Hanford are converted to the solid strontium fluoride and cesium chloride salts, doubly encapsulated, and stored underwater in the Waste Encapsulation and Storage Facility (WESF). A capsule contains approximately 70,000 Ci of 137 Cs or 70,000 to 140,000 Ci of 90 Sr. Materials for fabrication of process equipment and capsules must withstand a combination of corrosive chemicals, high radiation dosages and frequently, elevated temperatures. The two metals selected for capsules, Hastelloy C-276 for strontium fluoride and 316-L stainless steel for cesium chloride, are adequate for prolonged containment. Additional materials studies are being done both for licensing strontium fluoride as source material and for second generation process equipment


    Rimshaw, S.J.


    A method is given for recovering Cs/sup 137/ from radioactive waste solutions together with extraneous impurities. Ammonium alum is precipitated in the waste solution. The alum, which carries the cesium, is separated from the supernatant liquid and then dissolved in water. The resulting aqueous solution is then provided with a source of hydroxyl ions, which precipitates aluminum as the hydroxide, and the aluminum hydroxide is separated from the resulting liquid. This liquid, which contains anionic impurities together with ammonium and cesium, is passed through an anion exchange resin bed which removes the anionic impurities. The ammonium in the effluent is removed by destructive distiilation, leaving a substantiaily pure cesium salt in the effluent.

  9. Microbial accumulation of uranium, radium, and cesium

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; North, S.E.


    Diverse microbial species varied considerably in their ability to accumulate uranium, cesium, and radium. Mechanistic differences in uranium uptake by Saccharomyces cerevisiae and Pseudomonas aeruginosa were indicated. S. serevisiae exhibited a slow (hours) surface accumulation of uranium which was subject to environmental factors, while P. aeruginosa accumulated uranium rapidly (minutes) as dense intracellular deposits and did not appear to be affected by environmental parameters. Metabolism was not required for uranium uptake by either organism. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several species tested

  10. Cesium injection system for negative ion duoplasmatrons

    Kobayashi, M.; Prelec, K.; Sluyters, T.J.


    A design for admitting cesium vapor into a hollow hydrogen plasma discharge in a duoplasmatron ion source for the purpose of increasing the negative hydrogen ion output current is described. 60 mA beam currents for negative hydrogen ions are reported

  11. Cesium and Strontium Separation Technologies Literature Review

    T. A. Todd; T. A. Todd; J. D. Law; R. S. Herbst


    Integral to the Advanced Fuel Cycle Initiative (AFCI) Program’s proposed closed nuclear fuel cycle, the fission products cesium and strontium in the dissolved spent nuclear fuel stream are to be separated and managed separately. A comprehensive literature survey is presented to identify cesium and strontium separation technologies that have the highest potential and to focus research and development efforts on these technologies. Removal of these high-heat-emitting fission products reduces the radiation fields in subsequent fuel cycle reprocessing streams and provides a significant short-term (100 yr) heat source reduction in the repository. This, along with separation of actinides, may provide a substantial future improvement in the amount of fuel that could be stored in a geologic repository. The survey and review of the candidate cesium and strontium separation technologies are presented herein. Because the AFCI program intends to manage cesium and strontium together, technologies that simultaneously separate both elements are of the greatest interest, relative to technologies that separate only one of the two elements.

  12. Absolute densities in exoplanetary systems. Photodynamical modelling of Kepler-138.

    Almenara, J. M.; Díaz, R. F.; Dorn, C.; Bonfils, X.; Udry, S.


    In favourable conditions, the density of transiting planets in multiple systems can be determined from photometry data alone. Dynamical information can be extracted from light curves, providing modelling is done self-consistently, i.e. using a photodynamical model, which simulates the individual photometric observations instead of the more generally used transit times. We apply this methodology to the Kepler-138 planetary system. The derived planetary bulk densities are a factor of two more precise than previous determinations, and we find a discrepancy in the stellar bulk density with respect to a previous study. This leads, in turn, to a discrepancy in the determination of masses and radii of the star and the planets. In particular, we find that interior planet, Kepler-138 b, has a size in between Mars and the Earth. Given our mass and density estimates, we characterize the planetary interiors using a generalized Bayesian inference model. This model allows us to quantify for interior degeneracy and calculate confidence regions of interior parameters such as thicknesses of the core, the mantle, and ocean and gas layers. We find that Kepler-138 b and Kepler-138 d have significantly thick volatile layers, and that the gas layer of Kepler-138 b is likely enriched. On the other hand, Kepler-138 c can be purely rocky.

  13. Conceptual design of cesium removal device for ITER NBI maintenance

    Oka, Kiyoshi; Shibanuma, Kiyoshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment


    Cesium is required in order to generate a stable negative ion of hydrogen in an ion source of the neutral beam injector (NBI), which is one of the plasma-heating devices for International Thermonuclear Experimental Reactor (ITER). After long time operation of the NBI, the cesium deposits to the insulators supporting the electrode. Due to the deterioration of the insulation resistance, the continuous operation of the NBI will be difficult. In addition, the NBI device is activated by neutrons from D-T plasma, so that periodic removal and cleaning of the cesium on the insulators by remove handling is required. A study of the cesium removal scenario and the device is therefore required considering remote handling. In this report, a cesium removal procedure and conceptual design of the cesium removal device using laser ablation technique are studied, and the feasibility of the laser ablation method is shown. (author)

  14. Photon interactions in a cesium beam

    Nygaard, K.J.; Jones, J.D.; Hebner, R.E. Jr


    Photoionization of excited cesium atoms in the 6 2 P3/2 - state has been studied in a triple crossed-beam experiment. A thermal beam of cesium atoms was intersected by one photon beam of wavelength 8521A that served to excite the atoms and another photon beam with wavelengths below 5060A that served to ionize the excited atoms. The resulting ions were detected with a channel electron multiplier. All background effects were discriminated against by chopping the beam of exciting radiation and by analyzing the net count rate with digital synchronous techniques. The relative cross section for photoionization fo Cs(6 2 P3/2) has been measured from threshold (5060A) to 2500A. The results fall off faster than the theoretical calculations of Weisheit and Norcross

  15. Protection of cesium-antimony photocathodes

    Buzulutskov, A.; Breskin, A.; Chechik, R.; Prager, M.; Shefer, E.


    In order to operate gaseous photomultipliers in the visible range it was suggested to protect sensitive photocathodes against contact to air and counting gases by their coating with a thin solid dielectric film. We present data on coating of cesium- antimony photocathodes with alkali-halide (NaI, CsI, CsF, NaF), oxide (SiO) and organic (hexatriacontane, calcium stearate) films. The photoelectron transmission through these films and their protection capability have been studied in detail. Cesium-antimony photocathodes are shown to withstand exposure to considerable doses of oxygen and dry air when coated with Nal films. This opens ways to their operation in gas media. (authors), 11 refs., 6 figs

  16. Cesium titanium silicate and method of making

    Balmer, Mari L.


    The invention is the new material, a ternary compound of cesium, silica, and titania, together with a method of making the ternary compound, cesium titanium silicate pollucite. More specifically, the invention is Cs.sub.2 Ti.sub.2 Si.sub.4 O.sub.13 pollucite which is a new crystalline phase representing a novel class of Ti-containing zeolites. Compositions contain relatively high Cs.sub.2 O and TiO.sub.2 loadings and are durable glass and ceramic materials. The amount of TiO.sub.2 and Cs.sub.2 that can be incorporated into these glasses and crystalline ceramics far exceeds the limits set for the borosilicate high level waste glass.

  17. Progress toward Brazilian cesium fountain second generation

    Bueno, Caio; Rodriguez Salas, Andrés; Torres Müller, Stella; Bagnato, Vanderlei Salvador; Varela Magalhães, Daniel


    The operation of a Cesium fountain primary frequency standard is strongly influenced by the characteristics of two important subsystems. The first is a stable frequency reference and the second is the frequency-transfer system. A stable standard frequency reference is key factor for experiments that require high accuracy and precision. The frequency stability of this reference has a significant impact on the procedures for evaluating certain systematic biases in frequency standards. This paper presents the second generation of the Brazilian Cesium Fountain (Br-CsF) through the opto-mechanical assembly and vacuum chamber to trap atoms. We used a squared section glass profile to build the region where the atoms are trapped and colled by magneto-optical technique. The opto-mechanical system was reduced to increase stability and robustness. This newest Atomic Fountain is essential to contribute with time and frequency development in metrology systems.

  18. Thermochemical evaluation and preparation of cesium uranates

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku; Sato, Seichi; Ohashi, Hiroshi.


    Two kinds of cesium uranates, Cs 2 UO 4 and Cs 2 U 2 O 7 , which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U 3 O 8 and Cs 2 CO 3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs 2 UO 4 and Cs 2 U 2 O 7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs 2 UO 4 and Cs 2 U 2 O 7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  19. Pilot unit for cesium-137 separation

    Raggenbass, A.; Quesney, M.; Fradin, J.; Dufrene, J.


    Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of 137 Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain 137 Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author) [fr

  20. Cesium legacy safety project management work plan

    Durham, J.S.


    This Management Work Plan (MWP) describes the process flow, quality assurance controls, and the Environment, Safety, and Health requirements of the Cesium Legacy Safety Project. This MWP provides an overview of the project goals and methods for repackaging the non-conforming Type W overpacks and packaging the CsCl powder and pellets. This MWP is not intended to apply to other activities associated with the CsCl Legacy Safety Program (i.e., clean out of South Cell)

  1. Cesium migration experiments in different media

    Tello, C.C.O. de


    The environmental impact caused by the radioactive waste disposal depends on many factors, mainly on the release pathways of the radionuclides from the waste product to the environment. The migration of the radioelements through the different barriers, which compose the disposal system, is considered the main via for this release. This paper describes the experiments carried out to improve the cemented waste quality, as well to assess the cesium migration in different media. (author)

  2. Investigations on cesium uranates. Pt. 7

    Cordfunke, E.H.P.


    The thermochemical properties of Cs 2 U 4 O 12 have been evaluated using new experimental data, including the low-temperature heat capacities, the enthalpy of formation at room temperature, and the high-temperature enthaply increments by drop calorimetry. From the results a section of the Cs-U-O phase diagram at 1000 K has been constructed showing the stability of the compound as a function of cesium and oxygen pressure. (orig.) [de

  3. Axial migratin of cesium in LMFBR fuel pins

    Karnesky, R.A.; Bridges, A.E.; Jost, J.W.


    A correlated model for quantitatively predicting the behavior of cesium in LMFBR fuel pins has been developed. This correlation was shown to be in good agreement with experimental data. It has been used to predict the behavior of cesium in the FFTF driver fuel and as the result of this analysis it has been shown that the accumulation of cesium in the insulator pellets at the ends of the fuel column will not be life limiting

  4. Cesium-137 retention in irops obtained from various soils

    Gulyakin, I.V.; Yudintseva, E.V.; Gorina, L.I.


    A non-station experiment has shown that the accumulation of cesium-137 in a plant yield depends on the type of soil. The highest contents of cesium-137 were found in the yield of plants from soddy-podzolic sandy loam soils, and the lowest- in those from leached chernozem. The accumulation of radiocesium in the yield of the basic produce strongly depended on the plant species. The amount of cesium-137 differed 5- to 7-fold in different crops


    de Steese, J. G.; Zollweg, R. J.


    The plasma-anode technique was used to observe anomalously high thermionic emission from a rhenium surface with small cesium coverage, where the work function of the composite surface is greater than the ionization potential of cesium. Data suggest that emission enhancement is caused by increased cesium coverage because of cesiumion trapping near the emitter surface under the influence of an ion-rich sheath. (auth)

  6. Sorption of cesium on titanium and zirconium phosphates

    Lebedev, V.N.; Mel'nik, N.A.; Rudenko, A.V.


    Titanium and zirconium phosphates were prepared from mineral raw materials of the Kola Peninsula. Their capability to recover cesium cations from the model solutions and liquid radioactive waste (LRW) was studied. Titanium phosphate prepared from solutions formed by titanite breakdown demonstrates greater distribution coefficients of cesium as compared to zirconium phosphate. Titanium phosphate as a cheaper agent featuring greater sorption capacity was recommended for treatment of LRW to remove cesium [ru

  7. Removal of cesium from red deer meat

    Jandl, J.; Novosad, J.; Francova, J.; Prochazka, H.


    The effect was studied of marinading on the reduction of cesium radionuclide activity in red deer meat contaminated by ingestion of feed containing 134 Cs+ 137 Cs from radioactive fallout following the Chernobyl accident. Two types of marinade were studied, viz., a vinegar infusion and a vinegar infusion with an addition of vegetables and spices. The meat was chopped to cubes of about 1.5 cm in size and the marinading process took place at temperatures of 5 and 11 degC. The drop of cesium content in the meat was determined by gamma spectrometry at given time intervals. The replacement of the marinade and the duration of the process were found to maximally affect efficiency. If the solution was not replaced, about 80% of cesium radionuclides were removed after seven hours of marinading. With one replacement of the infusion the drop in 134 Cs+ 137 Cs radioactivity amounted to up to 90% after seven hours of marinading. No effects were shown of vegetable additions to the vinegar infusion and of the change in temperature from 5 to 11 degC on the efficiency of the process. (author). 3 tabs., 6 refs

  8. Cesium-137 as a radiation source

    McMullen, W.H.; Sloan, D.P.


    The U.S. Department of Energy (DOE) Byproducts Utilization Program (BUP) seeks to develop and encourage widespread commercial use of defense byproducts that are produced by DOE. Cesium-l37 is one such byproduct that is radioactive and decays with emission of gamma rays. The beneficial use of this radiation to disinfect sewage sludge or disinfest food commodities is actively being pursued by the program. The radiation produced by cesium-l37(Cs-l37) is identical in form to that produced by cobalt-60(Co-60), an isotope that is widely used in commercial applications such as medical product sterilization. The choice of isotope to use depends on several factors ranging from inherent properties of the isotopes to availability and cost. The BUP, although centrally concerned with the beneficial use of Cs-l37, by investigating and assessing the feasibility of various uses hopes to define appropriate circumstances where cesium or cobalt might best be used to accomplish specific objectives. This paper discusses some of the factors that should be considered when evaluating potential uses for isotopic sources

  9. Cesium immobilization into potassium magnesium phosphate matrix

    Sayenko, S.Y.; Shkuropatenko, V.A.; Bereznyak, O.P.; Hodyreva, Y.S.; Tarasov, R.V.; Virych, V.D.; Ulybkina, E.A.; Pylypenko, O.V.; Kholomeev, G.O.; Zykova, A.V.; Wagh, Arun S.


    The possibility of isomorphous substitution of potassium ions by cesium ions in the structure of potassium magnesium phosphate KMgPO 4 centred dot 6H 2 O (PMP) was shown. It was established, that the Cs included into the PMP matrix does not transfer to the environment during high temperatures heating process (1176 deg C, 3 hours). Analysis of the IR absorption spectrum of the PMP sample has demonstrated that an increase in the amount of additive of the cesium chloride resulted in the shift of the main bands in the spectrum to the low-frequency region with average shift value 10 cm -1 , which indicates the strengthening of bonds in the crystal lattice of matter. The calculated degree of substitution of potassium by cesium during energy release process in the PMP matrix at the level of vitrified high level wastes is about 4%, i. e. the PMP matrix should correspond to the formula K 0.96 Cs 0.04 MgPO 4 centred dot 6H 2 O.

  10. Surface interactions of cesium and boric acid with stainless steel

    Grossman-Canfield, N.


    In this report, the effects of cesium hydroxide and boric acid on oxidized stainless steel surfaces at high temperatures and near one atmosphere of pressure are investigated. This is the first experimental investigation of this chemical system. The experimental investigations were performed using a mass spectrometer and a mass electrobalance. Surfaces from the different experiments were examined using a scanning electron microscope to identify the presence of deposited species, and electron spectroscopy for chemical analysis to identify the species deposited on the surface. A better understanding of the equilibrium thermodynamics, the kinetics of the steam-accelerated volatilizations, and the release kinetics are gained by these experiments. The release rate is characterized by bulk vaporization/gas-phase mass transfer data. The analysis couples vaporization, deposition, and desorption of the compounds formed by cesium hydroxide and boric acid under conditions similar to what is expected during certain nuclear reactor accidents. This study shows that cesium deposits on an oxidized stainless steel surface at temperatures between 1000 and 1200 Kelvin. Cesium also deposits on stainless steel surfaces coated with boric oxide in the same temperature ranges. The mechanism for cesium deposition onto the oxide layer was found to involve the chemical reaction between cesium and chromate. Some revaporization in the cesium hydroxide-boric acid system was observed. It has been found that under the conditions given, boric acid will react with cesium hydroxide to form cesium metaborate. A model is proposed for this chemical reaction

  11. Behavior of ion-implanted cesium in silicon dioxide films

    Fishbein, B.J.


    Charged impurities in silicon dioxide can be used to controllably shift the flatband voltage of metal-oxide-semiconductor devices independently of the substrate doping, the gate oxide thickness and the gate-electrode work function. Cesium is particularly well suited for this purpose because it is immobile in SiO 2 at normal device operating temperatures, and because it can be controllably introduced into oxide films by ion implantation. Cesium is positively charged in silicon dioxide, resulting in a negative flatband voltage shift. Possible applications for cesium technology include solar cells, devices operated at liquid nitrogen temperature, and power devices. The goal of this work has been to characterize as many aspects of cesium behavior in silicon dioxide as are required for practical applications. Accordingly, cesium-ion implantation, cesium diffusion, and cesium electrical activation in SiO 2 were studied over a broad range of processing conditions. The electrical properties of cesium-containing oxides, including current-voltage characteristics, interface trap density, and inversion-layer carrier mobility were examined, and several potential applications for cesium technology have been experimentally demonstrated

  12. Removal of cesium radioisotopes from solutions using granulated zeolites

    Bronic, J.; Subotic, B.


    The influence of type of zeolite and the flow rate of solution through the column on the removal efficiency of radioactive cesium ions from solution has been investigated. The analysis of the change in the concentration of cesium ions in the solutions and distribution of cesium ions in the column fillings (granulated zeolites), after passing the solutions through the columns filled with various granulated zeolites (zeolite 4A, zeolite 13X, synthetic mordenite) was performed. On the basis of the results of this study, the conditions for the most efficient removal of cesium ions from solutions have been discussed. (author) 35 refs.; 9 figs.; 1 tab

  13. Lanthanide doped strontium-barium cesium halide scintillators

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew


    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  14. Sorption of cesium in intact rock

    Puukko, E.


    The mass distribution coefficient K d is used in performance assessment (PA) to describe sorption of a radionuclide on rock. The R d is determined using crushed rock which causes uncertainty in converting the R d values to K d values for intact rock. This work describes a method to determine the equilibrium of sorption on intact rock. The rock types of the planned Olkiluoto waste disposal site were T-series mica gneiss (T-MGN), T-series tonalite granodiorite granite gneiss (T-TGG), P-series tonalite granodiorite granite gneiss (P-TGG) and pegmatitic granite (PGR). These rocks contain different amount of biotite which is the main sorbing mineral. The sorption of cesium on intact rock slices was studied by applying an electrical field to speed up migration of cesium into the rock. Cesium is in the solution as a noncomplex cation Cs + and it is sorbed by ion exchange. The tracer used in the experiments was 134 Cs. The experimental sorption on the intact rock is compared with values calculated using the in house cation exchange sorption model (HYRL model) in PHREEQC program. The observed sorption on T-MGN and T-TGG rocks was close to the calculated values. Two PGR samples were from a depth of 70 m and three samples were from a depth of 150 m. Cesium sorbed more than predicted on the two 70 m PGR samples. The sorption of Cs on the three 150 m PGR samples was small which was consistent with the calculations. The pegmatitic granite PGR has the smallest content of biotite of the four rock types. In the case of P-TGG rock the observed values of sorption were only half of the calculated values. Two kind of slices were cut from P-TGG drill core. The slices were against and to the direction of the foliation of the biotite rims. The sorption of cesium on P-TGG rock was same in both cases. The results indicated that there was no effect of the directions of the electric field and the foliation of biotite in the P-TGG rock. (orig.)

  15. 40 CFR 86.138-96 - Hot soak test.


    ....138-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... preparation for the hot soak test. (2) Gaseous-fueled vehicles. Since gaseous-fueled vehicles are not required.... (iii) Fresh impingers shall be installed in the methanol sample collection system immediately prior to...

  16. 42 CFR 480.138 - Disclosure for other specified purposes.


    ...) General requirements for disclosure. Except as specified in paragraph (b) of this section, the following... information is necessary to protect against a substantial risk to the public health. (3) Disclosure to the... 42 Public Health 4 2010-10-01 2010-10-01 false Disclosure for other specified purposes. 480.138...

  17. 7 CFR 457.138 - Grape crop insurance provisions.


    ... types, in the county for which a premium rate is provided by the actuarial documents: (a) In which you... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.138 Grape crop insurance... avoirdupois. Type. A category of grapes (one or more varieties) identified as a type in the Special Provisions...

  18. Strontium-90 and cesium-137 in powdered milk


    Japan Chemical Analysis Center has analysed the strontium-90 and cesium-137 content in powdered milk. The samples were purchased on the open market in Tokyo from the powdered milk producers. The analysis of Strontium-90 and Cesium-137 content was carried out using the method recommended by Science and Technology Agency. (author)

  19. Uptake behavior of titanium molybdophosphate for cesium and strontium

    Yavari, R.; Ahmadi, S.J.; Huang, Y.D.


    This study investigates uptake of cesium and strontium from aqueous solution similar to nuclear waste on three samples of titanium molybdophosphate (TMP) synthesized under various conditions. Effects of concentration of sodium nitrate, pH and contact time on the uptake of cesium and strontium have been studied by bath method. The results showed that TMP has high affinity toward cesium and strontium at pH > 2 and relatively low concentration of sodium nitrate. Kinetic data indicated that cesium uptake process to achieve equilibrium was faster than strontium. Cesium and strontium breakthrough curves were examined at 25 deg C using column packed with H 3 O + form of TMP and breakthrough curves showed symmetrical S-shaped profiles. At the same time, the calculated breakthrough capacity for cesium was higher than strontium. The results of desorption studies showed that over 99% of cesium and strontium was washed out of column by using 4 M NH 4 Cl solution. This study suggests that TMP can have great potential applications for the removal of strontium and specially cesium from nuclear waste solution. (author)

  20. Hydrological Methods can Separate Cesium from Nuclear Waste Saltcake

    Brooke, J.N.; Peters, J.F.; Staheli, K.


    Interstitial Fluid Displacement (IFD) is a new and novel method for separating cesium from saltcake waste. Hydrologic modeling of liquid flow through porous saltcake suggests that the cesium, potassium and sodium hydroxide can be separated at high recovery and low volume using IFD.'

  1. Magnetic circular Dichroism and Faraday rotation of cesium-argon excimers and cesium dimers

    Islam, M.A.


    Magnetic Circular Dichroism (MCD) and Faraday Rotation (FR) of excimer absorption bands in gases are measured to obtain the first direct information about the angular momentum quantum numbers and the angular momentum coupling schemes of excimer molecules. So far, there has been no experimental method to obtain information about the axial angular momentum and the angular momentum coupling schemes of excimer molecules. In this experiment, the MCD and the FR of cesium-argon excimer and cesium dimer absorption bands between 5000 A and 10,000 A are measured for the range of temperature from 116 0 to 355 0 C. Of particular interest is the blue wing of D 2 line in cesium which has been the subject of vigorous investigation. The measured MCD data at the blue wing of D 2 line clearly shows that the assignment of 2 μ/sub 1/2/ to this excited state assuming Hund's case (b) is a poor approximation. By a simple inspection of the MCD data, it is found that the coupling scheme is more nearly Hund's case (c) than Hynd's case (b). Several other new and interesting results are obtained. The blue wing associated with 5D transition in atomic cesium is devoid of MCD and exhibits strong MCD in the red wings. Thus, the assignment of 2 μ/sub 1/2/ and 2 π to the blue and red wings, respectively, assuming Hund's case (a) and (b), is a very good approximation. Again the yellow-green band associated with 7s-6s transition in atomic cesium shows no MCD. It is therefore also a good approximation to assign 2 μ/sub 1/2/ to the upper state assuming Hund's case (b). Much more information can be obtained by a detailed analysis of the MCD data

  2. Radiation safety for incineration of radioactive waste contaminated by cesium

    Veryuzhs'kij, Yu.V.; Gryin'ko, O.M.; Tokarevs'kij, V.V.


    Problems in the treatment of radioactive waste contaminated by cesium nuclides are considered in the paper. Chornobyl experience in the management of contaminated soil and contaminated forests is analyzed in relation to the accident at Fukushima-1. The minimization of release of cesium aerosols into atmosphere is very important. Radiation influence of inhaling atmosphere aerosols polluted by cesium has damage effect for humans. The research focuses on the treatment of forests contaminated by big volumes of cesium. One of the most important technologies is a pyro-gasification incineration with chemical reactions of cesium paying attention to gas purification problems. Requirements for process, physical and chemical properties of treatment of radioactive waste based on the dry pyro-gasification incineration facilities are considered in the paper together with the discussion of details related to incineration facilities. General similarities and discrepancies in the environmental pollution caused by the accidents at Chornobyl NPP and Fukushima-1 NPP in Japan are analyzed

  3. A combined cesium-strontium extraction/recovery process

    Horwitz, E.P.; Dietz, M.L.; Jensen, M.P.


    A new solvent extraction process for the simultaneous extraction of cesium and strontium from acidic nitrate media is described. This process uses a solvent formulation comprised of 0.05 M di-t-butylcyclohexano-18-crown-6 (DtBuCH18C6), 0.1 M Crown 100' (a proprietary, cesium-selective derivative of dibenzo-18-crown-6), 1.2 M tributyl phosphate (TBP), and 5% (v/v) lauryl nitrile in an isoparaffinic hydrocarbon diluent. Distribution ratios for cesium and strontium from 4 M nitric acid are 4.13 and 3.46, respectively. A benchtop batch countercurrent extraction experiment indicates that >98% of the cesium and strontium initially present in the feed solution can be removed in only four extraction stages. Through proper choice of extraction and strip conditions, extracted cesium and strontium can be recovered either together or individually

  4. Evaluation of electrochemical ion exchange for cesium elution

    Bontha, J.D.; Kurath, D.E.; Surma, J.E.; Buehler, M.F.


    Electrochemical elution was investigated as an alternative method to acid elution for the desorption of cesium from loaded ion exchange resins. The approach was found to have several potential advantages over existing technologies, in particular, electrochemical elution eliminates the need for addition of chemicals to elute cesium from the ion exchange resin. Also, since, in the electrochemical elution process the eluting solution is not in direct contact with the ion exchange material, very small volumes of the eluting solution can be used in a complete recycle mode in order to minimize the total volume of the cesium elute. In addition, the cesium is eluted as an alkaline solution that does not require neutralization with caustic to meet the tank farm specifications. Other advantages include easy incorporation of the electrochemical elution process into the present cesium recovery schemes

  5. Method for synthesizing pollucite from chabazite and cesium chloride

    Pereira, C.


    A method is described for immobilizing waste chlorides salts containing radionuclides and hazardous nuclear material for permanent disposal, and in particular, a method is described for immobilizing waste chloride salts containing cesium, in a synthetic form of pollucite. The method for synthesizing pollucite from chabazite and cesium chloride includes mixing dry, non-aqueous cesium chloride with chabazite and heating the mixture to a temperature greater than the melting temperature of the cesium chloride, or above about 700 C. The method further comprises significantly improving the rate of retention of cesium in ceramic products comprised of a salt-loaded zeolite by adding about 10% chabazite by weight to the salt-loaded zeolite prior to conversion at elevated temperatures and pressures to the ceramic composite. 3 figs

  6. Biochemical changes in rats under the influence of cesium chloride

    N. M. Melnikova


    Full Text Available Cesium is lately accumulated actively in the environment, but its influence on human and ani­mal organism is the least studied among heavy metals. It is shown that the action of cesium chloride in rats caused significant changes in blood chemistry, which are characterized by a decrease of total protein content, pH, an increase in the level of urea, creatinine, glucose and total hemoglobin. The results showed that potassium content in all the studied organs and tissues of poisoned rats decreases under the action of cesium chloride. Histological examination of the heart tissue in rats poisoned with cesium chloride indicates the onset of pathology of cardiovascular system. It was found out that use of the drug “Asparkam” reduces the negative effect of cesium chloride on the body of rats.

  7. Adsorption of cesium on cement mortar from aqueous solutions

    Volchek, Konstantin, E-mail: [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Kuang, Wenxing; DeMaleki, Zack [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, Canada K1N 6N5 (Canada)


    Highlights: {yields} The adsorption of cesium on cement mortar was investigated in a range of temperatures and cesium concentrations. {yields} The pseudo-second order kinetic model produced a good fit with the experimental kinetic data. {yields} Equilibrium test results correlated well with the Freundlich isotherm adsorption model. {yields} The interaction between cesium ions and cement mortar was dominated by chemical adsorption. - Abstract: The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L{sup -1} and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L{sup -1} while the respective surface concentration on coupons varied from 0.0395 to 22.34 {mu}g cm{sup -2}. Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol{sup -1} suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  8. Studies on release and deposition behaviour of cesium from contaminated sodium pools and cesium trap development for FBTR

    Sahoo, P.; Kannan, S.E.; Muralidharan, P.; Chandran, K.


    Investigations were carried out on the release and deposition behaviour of cesium from sodium pools in air-filled chamber in the temperature range of 673 to 873 K, using Cs-134 to simulate Cs-137. About 0.12 kg of sodium was loaded in a burn-pot together with 92.5 kBq of cesium. Experiments were carried out with 21% oxygen. Natural burning period of sodium and specific activity ratio between cesium and sodium showed a tendency to decrease and release fractions of both the species tended to increase with temperature. From the surface deposited aerosols it was observed that cesium has propensity to settle down closer to the point of release. A cesium trap has been developed for FBTR with RVC as getter material. Absorption kinetics and particle release behaviour studies pointed to its intended satisfactory performance in the plant. (author)

  9. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms

    Haas, M.


    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m f =2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m f =1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m f =4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The last chapter

  10. Feasibility Assessment of Cesium Removal using Microaglae

    Kim, Ilgook; Ryu, Byung-Gon; Seo, Bum-Kyoung; Moon, Jei Kwon; Choi, Jong-Won [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    The aim of this work is to assess the feasibility of selected one of microalgae in the uptake of Cs+. The obtained results showed the maximum Cs+ removal by D. armatus SCK was 280μM indicating 70% removal efficiency. Also, D. armatus SCK could uptake Cs+ in the presence of K+, is particularly known to be transported into cells as an analog of Cs+ in freshwater condition. Recently, increased attention has been directed on the use of biological technologies for the removal of radionuclides as the cheap and eco-friendly alternative to the non-biological methods. Metal including radioactive compounds uptake by microorganisms can be occurred by metabolism –independent and/or -dependent processes. One involves biosorption based on the ability of microbial cells to bind dissolved metals; on the other involves bioaccumulation, which depends on the metabolic ability of cells to transport metals into the cytoplasm. The purpose of this work is to investigate the feasibility of microalgae in bioaccumulation system to remove cesium from solution. The effect of different environmental parameters on cesium removal was also examined.

  11. Thermochemical evaluation and preparation of cesium uranates

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Seichi; Ohashi, Hiroshi


    Two kinds of cesium uranates, Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7}, which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U{sub 3}O{sub 8} and Cs{sub 2}CO{sub 3} for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  12. Intense non-relativistic cesium ion beam

    Lampel, M.C.


    The Heavy Ion Fusion group at Lawrence Berkeley Laboratory has constructed the One Ampere Cesium Injector as a proof of principle source to supply an induction linac with a high charge density and high brightness ion beam. This is studied here. An electron beam probe was developed as the major diagnostic tool for characterizing ion beam space charge. Electron beam probe data inversion is accomplished with the EBEAM code and a parametrically adjusted model radial charge distribution. The longitudinal charge distribution was not derived, although it is possible to do so. The radial charge distribution that is derived reveals an unexpected halo of trapped electrons surrounding the ion beam. A charge fluid theory of the effect of finite electron temperature on the focusing of neutralized ion beams (Nucl. Fus. 21, 529 (1981)) is applied to the problem of the Cesium beam final focus at the end of the injector. It is shown that the theory's predictions and assumptions are consistent with the experimental data, and that it accounts for the observed ion beam radius of approx. 5 cm, and the electron halo, including the determination of an electron Debye length of approx. 10 cm

  13. Microbial uptake of uranium, cesium, and radium

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; McWhirter, D.A.


    The ability of diverse microbial species to concentrate uranium, cesium, and radium was examined. Saccharomyces cerevisiae, Pseudomonas aeruginosa, and a mixed culture of denitrifying bacteria accumulated uranium to 10 to 15% of the dry cell weight. Only a fraction of the cells in a given population had visible uranium deposits in electron micrographs. While metabolism was not required for uranium uptake, mechanistic differences in the metal uptake process were indicated. Uranium accumulated slowly (hours) on the surface of S. cerevisiae and was subject to environmental factors (i.e., temperature, pH, interfering cations and anions). In contrast, P. aeruginosa and the mixed culture of denitrifying bacteria accumulated uranium rapidly (minutes) as dense, apparently random, intracellular deposits. This very rapid accumulation has prevented us from determining whether the uptake rate during the transient between the initial and equilibrium distribution of uranium is affected by environmental conditions. However, the final equilibrium distributions are not affected by those conditions which affect uptake by S. cerevisiae. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several microbial species tested. The potential utility of microorganisms for the removal and concentration of these metals from nuclear processing wastes and several bioreactor designs for contacting microorganisms with contaminated waste streams will be discussed.

  14. Structural and decay properties of Z = 132, 138 superheavy nuclei

    Rather, Asloob A.; Ikram, M.; Usmani, A.A. [Aligarh Muslim University, Department of Physics, Aligarh (India); Kumar, Bharat; Patra, S.K. [Institute of Physics, Bhubaneswar (India); Homi Bhabha National Institute, Mumbai, Anushakti Nagar (India)


    In this paper, we analyze the structural properties of Z = 132 and Z = 138 superheavy nuclei within the ambit of axially deformed relativistic mean-field framework with NL3* parametrization and calculate the total binding energies, radii, quadrupole deformation parameter, separation energies, density distributions. We also investigate the phenomenon of shape coexistence by performing the calculations for prolate, oblate and spherical configurations. For clear presentation of nucleon distributions, the two-dimensional contour representation of individual nucleon density and total matter density has been made. Further, a competition between possible decay modes such as α-decay, β-decay and spontaneous fission of the isotopic chain of superheavy nuclei with Z = 132 within the range 312 ≤ A ≤ 392 and 318 ≤ A ≤ 398 for Z = 138 is systematically analyzed within self-consistent relativistic mean-field model. From our analysis, we inferred that the α-decay and spontaneous fission are the principal modes of decay in majority of the isotopes of superheavy nuclei under investigation apart from β-decay as dominant mode of decay in {sup 318-322}138 isotopes. (orig.)

  15. Effect of cesium seeding on hydrogen negative ion volume production

    Bacal, M.; Balghiti-Sube, F. El; Elizarov, L. I.; Tontegode, A. J.


    The effect of cesium vapor partial pressure on the plasma parameters has been studied in the dc hybrid negative ion source ''CAMEMBERT III.'' The cesium vapor pressure was varied up to 10 -5 Torr and was determined by a surface ionization gauge in the absence of the discharge. The negative ion relative density measured by laser photodetachment in the center of the plasma extraction region increases by a factor of four when the plasma is seeded with cesium. However the plasma density and the electron temperature (determined using a cylindrical electrostatic probe) are reduced by the cesium seeding. As a result, the negative ion density goes up by a factor of two at the lowest hydrogen pressure studied. The velocity of the directed negative ion flow to the plasma electrode, determined from two-laser beam photodetachment experiments, appears to be affected by the cesium seeding. The variation of the extracted negative ion and electron currents versus the plasma electrode bias will also be reported for pure hydrogen and cesium seeded plasmas. The cesium seeding leads to a dramatic reduction of the electron component, which is consistent with the reduced electron density and temperature. The negative ion current is enhanced and a goes through a maximum at plasma electrode bias lower than 1 V. These observations lead to the conclusion that the enhancement of pure volume production occurs in this type of plasma. Possible mechanisms for this type of volume process will be discussed

  16. Spatial variability and Cesium-137 inventories in native forest

    Andrello, A.C.; Appoloni, C.R.


    With the nuclear fission discovery and development of nuclear weapons in 1940s, artificial radioisotopes were introduced in the environment. This contamination is due to worldwide fallout by superficial nuclear tests realized from early 1950s to late 1970s by USA, former URSS, UK, France and China. One of theses radioisotopes that have been very studied is cesium-137. Cesium-137 has a half-life of 30.2 years and its biological behavior is similar to the potassium. The behavior in soil matrix, depth distribution, spatial variability and inventories values of cesium-137 has been determinate for several regions of the world. In Brazil, some research groups have worked on this subject, but there are few works published about theses properties of cesium-137. The aim of this paper was study the depth distribution, spatial variability, and inventory of cesium-137 in native forest. Two native forests (Mata 1 and Mata UEL) were sampling in region of Londrina, PR. The results shows that there is a spatial variability of 40% for Mata 1 and 42% for Mata UEL. The depth distribution of cesium-137 for two forests presented a exponential form, characteristic to undisturbed soil. Cesium-137 inventory determinate for Mata 1 was 358 Bq m -2 and for Mata UEL was 320 Bq m -2 . (author)

  17. The burden of cesium 137 in forest clerks

    Piechotowski, I.; Jaroni, J.; Link, B.; Groezinger, O.


    In 47 forest clerks from the regions Ortenau and Oberschwaben in south-west Germany the incorporation of cesium 137 and potassium 40 was measured in autumn 1994. Soil burden as well as burden of nutrition with cesium 137 are different in these regions for geological reasons and as a result of the nuclear accident of Chernobyl. Caused by low content of clay in Oberschwaben, the transfer of cesium to plants is assisted. Heavy rainfall after the nuclear accident led to an additional increase of burden. The median of the concentration of cesium 137 was 1.4 Bq/kg body weight. The median for potassium 40 was 58 Bq/kg body weight. For cesium 137 regional differences were observed. For persons from Oberschwaben the median for cesium 137 was with 2.8 Bq/kg body weight clearly higher than for persons from Ortenau with 0,6 Bq/kg body weight. Concerning nutrition habits, the clearest difference was found comparing persons who had ate a minimum of four portions of deer from the surroundings within the last four weeks with persons who had ate less than four portions of deer from the surroundings within the last four weeks. The difference was greater in Oberschwaben than in Ortenau. The effective dose of cesium 137 calculated on the basis of the incorporation is very low compared to natural radiation. This is also valid for persons from Oberschwaben. (orig.) [de

  18. Management of cesium loaded AMP- Part I preparation of 137Cesium concentrate and cementation of secondary wastes

    Singh, I.J.; Sathi Sasidharan, N.; Yalmali, Vrunda S.; Deshingkar, D.S.; Wattal, P.K.


    Separation of 137 cesium from High Level Waste can be achieved by use of composite-AMP, an engineered form of Ammonium Molybdo-Phosphate(AMP). Direct vitrification of cesium loaded composite AMP in borosilicate glass matrix leads to separation of water soluble molybdate phase. A proposed process describes two different routes of selective separation of molybdates and phosphate to obtain solutions of cesium concentrates. Elution of 137 Cesium from composite-AMP by decomposing it under flow conditions using saturated barium hydroxide was investigated. This method leaves molybdate and phosphate embedded in the column but only 70% of total cesium loaded on column could be eluted. Alternatively composite-AMP was dissolved in sodium hydroxide and precipitation of barium molybdate-phosphate from the resultant solution, using barium nitrate was investigated by batch methods. The precipitation technique gave over 99.9% of 137 Cesium activity in solutions, free of molybdates and phosphates, which is ideally suited for immobilization in borosilicate glass matrix. Detailed studies were carried out to immobilize secondary waste of 137 Cesium contaminated barium molybdate-phosphate precipitates in the slag cement matrix using vermiculite and bentonite as admixtures. The cumulative fraction of 137 Cs leached from the cement matrix blocks was 0.05 in 140 days while the 137 Cs leach rate was 0.001 gm/cm 2 /d. (author)

  19. Investigations on cesium uranates and related compounds

    Egmond, A.B. van


    Crystal structures of cesium uranate are determined mainly by X-ray diffraction techniques. From phase studies it is concluded that of the Cs-U-O system, Cs 2 U 4 O 12 will play a prominent role in fuel elements of fast reactors due to fission product-fuel reactions causing swelling of the fuel and fuel-element failure. Crystal structures and lattice parameters are determined from Cs 2 U 4 O 12 , Cs 2 U 4 O 13 , Cs 2 U 5 O 16 , Cs 4 U 5 O 17 , Cs 2 U 7 O 22 , Cs 2 U 15 O 46 , Cs 2 UO 4 and Cs 2 U 2 O 7 . Finally some crystal structures of potassium and rubidium uranates are measured and a comparison of all available data on alkali uranates is made

  20. Cesium return program lessons learned FY 1994

    Clements, E.P.


    The U.S. Department of Energy (DOE) is returning leased cesium capsules from IOTECH, Incorporated (IOTECH), Northglenn, Colorado, and the Applied Radiant Energy Company (ARECO), Lynchburg, Virginia, to the Waste Encapsulation and Storage Facility (WESF) on the Hanford Site, to ensure safe management and storage, pending final capsule disposition. Preparations included testing and modifying the Beneficial Uses Shipping System (BUSS) cask, preparing an Environmental Assessment (EA), development of a comprehensive Transportation Plan, coordination with the Western Governors' Association (WGA) and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR), and interface with the public and media. Additional activities include contracting for a General Electric (GE) 2000 cask to expedite IOTECH capsule returns, and coordination with Eastern and Midwestern States to revise the transportation plan in support of ARECO capsule returns

  1. Biosorption of uranium, radium, and cesium

    Strandberg, G.W.


    Some fundamental aspects of the biosorption of metals by microbial cells were investigated. These studies were carried out in conjunction with efforts to develop a process to utilize microbial cells as biosorbents for the removal of radionuclides from waste streams generated by the nuclear fuel cycle. It was felt that an understanding of the mechanism(s) of metal uptake would potentially enable the enhancement of the metal uptake phenomenon through environmental or genetic manipulation of the microorganisms. Also presented are the results of a preliminary investigation of the applicability of microorganisms for the removal of 137 cesium and 226 radium from existing waste solutions. The studies were directed primarily at a characterization of uranium uptake by the yeast, Saccharomyces cerevisiae, and the bacterium, Pseudomonas aeruginosa

  2. Social aspects concerning the cesium-137 accident

    Chaves, Elza Guedes


    The present work aims to understand how social representations constructed upon nuclear energy have influenced on molding and orienting public's behavior in the presence of the accident that occurred in Goiania with the capsule of Cesium-137. As a starting point, it is accepted here that panic caused by that accident could be properly understood only if dimension of subjectivity is taken into consideration. This perspective is required whenever events that put human life and environment in risk happen. Facing the accident, people internalized radioactivity, an unknown element, as certainty of cancer and death despite the fact that cancer and death could only outcome in case there had been excessive exposure to radioactivity. (author)

  3. Electron-stimulated desorption of cesium atoms from cesium layers adsorbed on gold-covered tungsten

    Ageev, V N; Kuznetsov, Yu A; Potekhina, N D, E-mail: kuznets@ms.ioffe.r [A F Ioffe Physico-Technical Institute, Russian Academy of Sciences, 194021, St Petersburg (Russian Federation)


    The electron-stimulated desorption (ESD) yields and energy distributions (ED) for neutral cesium atoms have been measured from cesium layers adsorbed on a gold-covered tungsten surface as a function of electron energy, gold film thickness, cesium coverage and substrate temperature. The measurements have been carried out using a time-of-flight method and surface ionization detector in the temperature range 160-300 K. A measurable ESD yield for Cs atoms is observed only after deposition of more than one monolayer of gold and cesium on a tungsten surface at a temperature T = 300 K, which is accompanied by the formation of a CsAu semiconductor film covered with a cesium atom monolayer. The Cs atom ESD yield as a function of incident electron energy has a resonant character and consists of two peaks, the appearance of which depends on both electron energy and substrate temperature. The first peak has an appearance threshold at an electron energy of 57 eV and a substrate temperature of 300 K that is due to Au 5p{sub 3/2} core level excitation in the substrate. The second peak appears at an electron energy of 24 eV and a substrate temperature of 160 K. It is associated with a Cs 5s core level excitation in the Cs adsorbed layer. The Au 5p{sub 3/2} level excitation corresponds to a single broad peak in the ED with a maximum at a kinetic energy of 0.45 eV at a substrate temperature T = 300 K, which is split into two peaks with maxima at kinetic energies of 0.36 and 0.45 eV at a substrate temperature of 160 K, associated with different Cs atom ESD channels. The Cs 5s level excitation leads to an ED for Cs atoms with a maximum at a kinetic energy of approx 0.57 eV which exists only at T < 240 K and low Cs concentrations. The mechanisms for all the Cs atom ESD channels are proposed and compared with the Na atom ESD channels in the Na-Au-W system.

  4. On mobility of cesium-137, sodium, potassium in various types of soils and prediction of cesium-137 cumulation in agricultural plants

    Ashkinazi, Eh.I.


    Mobility of cesium-137, sodium and potassium in the natural environment in podzolic gray and chernozem medium-loamy, sward podzolic sandy soils and chernozem has been studied. Durability of fixation of cesium-137 increases in a number of soils and increase of the level of metabolic potassium. Coefficient of transition of level of metabolic cesium-137 by potassium and sodium, and of sodium by potassium. The mentioned above coefficients can be used for the prediction of cesium-137 cumulation in plants

  5. Strontium-90 and cesium-137 in tea (Japanese tea)


    Strontium-90 and cesium-137 in tea (Japanese tea) were determined. Five hundred grams of manufactured green tea was collected from six sampling locations in Japan. The results are shown in a table. (Namekawa, K.)

  6. CETESB's actions in Goiania in what concerns cesium-137 accident

    Penteado Filho, Azor Camargo; Derisio, Jose Carlos; Albuquerque, Antonio Martins de


    This work presents several actions performed by CETESB, the sanitary engineering agency of Sao Paulo State - Southeast Brazil, in what concerns the accident involving cesium-137 in Goiania, Goias State - Center Brazil. The adopted procedures are described in details

  7. A model for radial cesium transport in a fuel pellet

    Imoto, Shosuke


    In order to explain the radial redistribution of cesium in an irradiated pellet, a two-step release model is proposed. The first step involves the migration of cesium by atomic diffusion to some channels, such as grain boundaries and cracks, and the second step assumes a thermomigration down along the temperature gradient. Distribution profiles of cesium are obtained by numerical calculation with the present model assuming a constant and spatially uniform birth rate of cesium in the pellet. The result agrees well with the profile observed by micro-gamma scanning for the LWR fuel in the outer region of the pellet but diverges from it at the inner region. Discussion is made on the steady-state model hitherto generally utilized. (orig.)

  8. Functions and requirements for a cesium demonstration unit

    Howden, G.F.


    Westinghouse Hanford Company is investigating alternative means to pretreat the wastes in the Hanford radioactive waste storage tanks. Alternatives include (but are not limited to) in-tank pretreatment, use of above ground transportable compact processing units (CPU) located adjacent to a tank farm, and fixed processing facilities. This document provides the functions and requirements for a CPU to remove cesium from tank waste as a demonstration of the CPU concept. It is therefore identified as the Cesium Demonstration Unit CDU

  9. Cesium powder and pellets inner container decontamination method determination

    Ferrell, P.C.


    The cesium powder and pellets inner container is to be performance tested per the criteria specified in Section 4.0 of HNF-2399, ''Design, Fabrication, and Assembly Criteria for Cesium Powder and Pellet Inner Container.'' The test criteria specifies that the inner container be water tight during decontamination of the exterior surface. Three prototypes will be immersed into a pool of water to simulate a water decontamination process

  10. Design of portable electrocardiogram device using DSO138

    Abuzairi, Tomy; Matondang, Josef Stevanus; Purnamaningsih, Retno Wigajatri; Basari, Ratnasari, Anita


    Cardiovascular disease has been one of the leading causes of sudden cardiac deaths in many countries, covering Indonesia. Electrocardiogram (ECG) is a medical test to detect cardiac abnormalities by measuring the electrical activity generated by the heart, as the heart contracts. By using ECG, we can observe anomaly at the time of heart abnormalities. In this paper, design of portable ECG device is presented. The portable ECG device was designed to easily use in the village clinic or houses, due to the small size device and other benefits. The device was designed by using four units: (1) ECG electrode; (2) ECG analog front-end; (3) DSO138; and (4) battery. To create a simple electrode system in the portable ECG, 1-lead ECG with two electrodes were applied. The analog front-end circuitry consists of three integrated circuits, an instrumentation amplifier AD820AN, a low noise operational amplifier OPA134, and a low offset operational amplifier TL082. Digital ECG data were transformed to graphical data on DSO138. The results show that the portable ECG is successfully read the signal from 1-lead ECG system.

  11. Study of strontium and cesium migration in fractured crystalline rock

    Gustafsson, E.; Klockars, C.E.


    The purpose of this investigation has been to study the retardation and dilution of non-active strontium and cesium relative to a non-absorbing substance (iodide) in a well-defined fracture zone in the Finnsjoen field research area. The investigation was carried out in a previously tracer-tested fracture zone. The study has encompassed two separate test runs with prolonged injection of strontium and iodide and of cesium and iodide. The test have shown that: - Strontium is not retarded, but rather absorbed to about 40% at equilibrium. - At injection stop, 36.3% of the injected mass of strontium has been absorbed and there is no deabsorption. -Cesium is retarded a factor of 2-3 and absorbed to about 30% at equilibrium. - At injection stop, 39.4% of the injected mass of cesium has been absorbed. Cesium is deabsorbed after injection stop (400h) and after 1300 hours, only 22% of the injected mass of cesium is absorbed. (author)

  12. Ecological and physiological parameters of mercury and cesium-137 accumulation in the raccoon

    Davis, A.H.


    Raccoons from 4 regions in the southeastern Coastal Plain were evaluated for mercury content. Mercury content of hair when used as an indicator of total body mercury content was significantly different among 3 of the 4 areas: Okefenokee Swamp, Eglin Air Force Base, and Sapelo Island on the Georgia Coast. Raccoons from Echols County Georgia were not significantly different from those of the Okefenokee. Mercury in the liver and kidney was significantly different between Okefenokee and Sapelo. There was a strong correlation between the age of the raccoon and the mercury in hair, with older animals having higher concentrations. This relationship was also valid for most other tissues. There was evidence that mercury content in some tissues was correlated with the season and the body condition of the raccoon. Mercury was not transferred through the placenta to the fetal raccoons. There was a strong relationship of mercury content to raccoon behavioral characteristics. Raccoon body weight was slightly different between the areas studied. Cesium-137 values in raccoons were significantly different between the Okefenokee and Sapelo Island. Cesium-137 content was correlated with raccoon age, body weight, and mercury content. Generally non-detectable levels of chlorinated hydrocarbons and PCB were found in Okefenokee raccoons. Mercury concentrations in crayfish were generally low but probably of importance in the raccoon food chain. The biological half life of mercury in brain, gonad, pancreas, spleen, heart, and lung was approximately 52 days. The half-life of mercury in muscle was 35 days. Mercury content of hair, liver, and kidney decreased at very slow rates, with biological half lives of 229, 108, and 138 days. This was probably due to the role of these tissues in clearance of mercury from the body, and to the molting pattern of raccoon hair

  13. The composition of the saturated vapor and enthalpies of dimerization of rubidium and cesium pivalates

    Khoretonenko, N.M.; Rykov, A.N.; Korenev, Yu.M.


    The rubidium and cesium pivalates sublimation processes are studied through the Knudsen effusion method with the mass-spectral analysis of the gaseous phase composition. It is established that MPiv and M 2 Piv 2 and in small amounts M 3 Piv 3 and M 4 Piv 4 constitute the basic components in the saturated vapour of the rubidium and cesium pivalates. Sublimation enthalpies (kJ/mole) of monomers Δ S H T 0 =163.5±7.2 and dimers Δ S H T 0 (Cs 2 Piv 2 )-192.1±9.6 are determined. Dissociation enthalpies (kJ/mole) of the M 2 Piv 2 dimers by the second(2) and the third (3) laws of thermodynamics: Δ D H T 0 (Cs 2 Piv 2 )=137.1±5.4(2), Δ D H T 0 (Rb 2 Piv 2 )=138.2±10.2 (3); Δ D H T 0 (Cs 2 Piv 2 )-134.9±9.3 (2), Δ D H T 0 (Cs 2 Piv 2 )=136.8±10.8 (3) are calculated. Temperature dependence equations (210-300 deg C of partial pressures (Pa) of the MPiv, M 2 Piv 2 molecules: InP(RbPiv)=-(20099±674)/T+34.6±1.2; InP(Rb 2 Piv 2 )=-(23707±734)/T+40.4±1.4; InP(CsPiv)=-(19666±866)/T+34.1±1.6; InP(Cs 2 Piv 2 )=-(23106±1155)/T+39.5±2.1 are obtained

  14. Cesium-134 and cesium-137 in honey bees and cheese samples collected in the U. S. after the Chernobyl accident

    Ford, B C; Jester, W A; Griffith, S M; Morse, R A; Zall, R R; Lisk, D J; Burgett, D M; Bodyfelt, F W


    As a result of the Chernobyl accident on April 25, 1986, possible radioactive contamination of honey bees and cheese sampled in several areas of the United States were measured. Of bees collected in May and June of 1986 in both Oregon and New York, only those from Oregon showed detectable levels of cesium-134 (T1/2 = 2.05 years), a radionuclide which would have originated from the Chernobyl incident. Cheese produced in Oregon and New York before the accident showed only cesium-137 (T1/2 = 30.23 years) but cheese produced afterwards (May and September, 1986) in Oregon contained cesium-134. Cheese produced in Ohio and California at the time of the accident and thereafter contained only cesium-137. In general, the levels of radioactivity were higher in the West coast samples as compared to those taken in the East. The levels of radioactivity detected were considered to be toxicologically of no consequence.

  15. Seasonal variation of cesium 134 and cesium 137 in semidomestic reindeer in Norway after the Chernobyl accident

    Eikelmann, I.M.H.; Bye, K.; Sletten, H.D.


    The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively

  16. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    Fujishiro, F.; Ishii, K.; Matsuyama, S.; Arai, H.; Ishizaki, A.; Osada, N.; Sugai, H.; Kusano, K.; Nozawa, Y.; Yamauchi, S.; Karahashi, M.; Oshikawa, S.; Kikuchi, K.; Koshio, S.; Watanabe, K.; Suzuki, Y.


    Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ˜0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds.

  17. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

  18. 7 CFR 400.138 - Procedures for salary offset; methods of collection.


    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Procedures for salary offset; methods of collection. 400.138 Section 400.138 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL... Management-Regulations for the 1986 and Succeeding Crop Years § 400.138 Procedures for salary offset; methods...

  19. Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

    Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

  20. Improvement of cesium retention in uranium dioxide by additional phases

    Gamaury Dubois, S.


    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs 2 O-Al 2 O 3 -SiO 2 et Cs 2 O-ZrO 2 -SO 2 . The compounds CsAISi 2 O 6 and Cs 2 ZrSi 6 O 15 were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al 2 O 3 + SiO 2 ) or (ZrO 2 + SiO 2 ) and the intergranular phase was characterized. In the presence of (Al 2 O 3 + SiO 2 ), the sintering is realized at 1610 deg C in H 2 . It is a liquid phase sintering. On the other end, with (ZrO 2 + SiO 2 ), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO 2+x . We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs

  1. Dosimetry of a Cesium 137 source

    Torres R, J.G.; Manzanares A, E.; Vega C, H.R.


    It was carried out a dosimetric study of a source of Cesium 137 used in investigations of Radiobiology. This radionuclide has a half life of 30.07 years and it emits photons of 661.657 keV with a probability of 85.2%. The source has been used in a series of experiments trending to observe the cellular response before the gamma rays, as well as for the calibration of equipment of radiological protection. For such reason it is important to determine the dosimetric properties. In this work it was determined the absorbed dose that this source takes when being placed in the center from a methylmethacrylate badge to three distances, 5, 10 and 15 cm. The dose was measured with thermoluminescent dosemeters and it was calculated by means of Monte Carlo method, also was derived an expression that allows to determine the dose starting from the information of the activity of the source and of the distance regarding the same one. (Author)

  2. Crystalline silicotitanates -- novel commercial cesium ion exchangers

    Braun, R.; Dangieri, T.J.; Fennelly, D.J.


    A new class of inorganic ion exchangers called crystalline silicotitanates (CST), invented by researchers at Sandia National Laboratories and Texas A ampersand M University, has been commercialized in a joint Sandia-UOP effort. The original developmental materials exhibited high selectivity for the ion exchange of cesium, strontium, and several other radionuclides from highly alkaline solutions containing molar concentrations of Na + . The materials also showed excellent chemical and radiation stability. These CST properties made them excellent candidates for treatment of solutions such as the Hanford tank supernates and other DOE radwastes. Sandia and UOP, under a Cooperative Research and Development Agreement (CRADA), developed CSTs in the powdered form and in an engineered form suitable for column ion exchange use. A continuous-flow, column ion exchange process is expected to be used to remove Cs and other radionuclides from the Hanford supernatant. The powder material invented by Sandia and Texas A ampersand M consists of submicron-size particles. It is not designed for column ion exchange but may be used in other applications such as batch waste processing. Data are also presented confirming the excellent stability of the commercial CSTs over a broad pH range and the high radiation stability of the exchangers. In addition, data are provided that demonstrate the high physical strength and attrition resistance of IONSIV reg-sign IE-911, critical properties for column ion exchange applications

  3. Pilot unit for cesium-137 separation; Unite pilote de separation du cesium-137

    Raggenbass, A; Quesney, M; Fradin, J; Dufrene, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of {sup 137}Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain {sup 137}Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author)Fren. [French] L'interet des utilisateurs de rayonnement se porte de plus en plus vers le caesium-137. Parallelement, la mise en oeuvre de l'ensemble industriel de Marcoule nous permettra de disposer dans un avenir proche de stocks importants de produits de fission qu'il sera interessant de valoriser au plus vite. L'installation que nous decrivons est un pilote de production de caesium-137 qui doit nous permettre: - de verifier la methode chimique sur des solutions de produits de fission reelles en traitant environ 100 curies de {sup 137}Cs par operation; - d'obtenir des renseignements techniques sur l'appareillage chimique (telecommandes, corrosion, entretien, etc...); - d'obtenir du {sup 137}Cs en quantite suffisante pour mettre au point la technique de fabrication des sources scellees. (auteur)

  4. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    Fujishiro, F.; Ishii, K.; Matsuyama, S.; Arai, H.; Ishizaki, A.; Osada, N.; Sugai, H.; Kusano, K.; Nozawa, Y.; Yamauchi, S.; Karahashi, M.; Oshikawa, S.; Kikuchi, K.; Koshio, S.; Watanabe, K.; Suzuki, Y.


    Highlights: • There are radioactively contaminated soils having a radioactive cesium transfer of 0.01. • Micro-PIXE analysis has revealed an existence of phosphorus in a contaminated soil. • Radioactive cesium captured by phosphorus compound would be due to radioactive transfer. -- Abstract: Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ∼0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds

  5. Measurements of cesium and strontium diffusion in biotite gneiss

    Skagius, K.; Neretnieks, I.


    A significant retardation of radionuclides transported by flowing water from an underground repository can be expected if the nuclides are able to diffuse into the water filled micropores in the rock. This diffusion into the pores will also increase the surface available to interactions between the nuclides in the ground water and the rock material, such as sorption. To calculate the retardation, it is necessary to know the sorption properties and the diffusivities in the rock matrix for the radionuclides. Diffusion experiments with cesium and strontium in biotite gneiss samples have been performed. Both the transport of strontium and cesium through rock samples and the concentration profiles of cesium and strontium inside rock samples have been determined. The result shows that diffusion of cesium and strontium occurs in the rock material. A diffusion model has been used to evaluate the diffusivity. Both pore diffusion and surface diffusion had to be included in the model to give good agreement with the experimental data. If surface diffusion is not included in the model, the effective pore diffusivity that gives the best fit to the experimental data is found to be higher than expected from earlier measurement of iodide diffusion in the same type of rock material. This indicates that the diffusion of cesium and strontium (sorbing components) in rock material is caused by both pore diffusion and surface diffusion acting in parallel

  6. Accumulation of strontium 90 and cesium 137 in some hydrobionts

    Boyadzhiev, A.; Keslev, D.; Kerteva, A.; Novakova, E.


    Factors responsible for the accumulation of strontium 90 and cesium 137 in some plant organisms, characteristic for fishes in Bulgarian fresh-water reservoirs and in Black Seawater, were examined. The investigated samples were taken during spring, summer and autumn-winter seasons 1967/1968. Each sample burnt to ashes at 450 0 C was examined for strontium 90 and cesium 137 content as well as stable isotopes of calcuim and potassium. Accumulation factors for strontium 90 and cesium 137 were significantly higher in freshwater hydrobionts than in seawater hydrobionts. This could be explained by variations in the concentration of stable isotopes of calcium and potassium from freshwater reservoirs and from seawater. Potassium and calcium concentrations were relatively constant in seawater while in freshwater they were significantly variable. Accumulation factors for these radionuclides increased according to the amount of rain and the altitude above sea level. Strontium 90 was deposited mostly in fins, less in scales and least in the meat of fishes; cesium 137 was mainly deposited in the meat and less in the other parts of fishes. The highest accumulation factors for strontium 90 were determined in fishes and for cesium 137 in plant organisms. The most convenient plant and fish species for tracing radioactive contamination of freshwater reservoirs and in the Black Sea were indicated. (A.B.)

  7. Diffusion measurements of cesium and strontium in biotite gneiss

    Skagius, K.; Neretnieks, I.


    A significant retardation of radionuclides transported by flowing water from an underground repository can be expected if the nuclides are able to diffuse into the water filled micropores in the rock. This diffusion into the pores will also increase the surface available to interaction between the nuclides in the groundwater and the rock material, such as sorption. To calculate the retardation it is necessary to know the sorption properties and the diffusivities in the rock matrix for the radionuclides. Diffusion experiments with cesium and strontium in biotite gneiss samples have been performed. Both the transport of strontium and cesium through rock samples and the concentration profiles of cesium and strontium inside rock samples have been determined. The result show that diffusion of cesium and strontium occurs in the rock material. A diffusion model has been used to evaluate the diffusivity. Both pore diffusion and surface diffusion had to be included in the model to give good agreement with the experimental data. If surface diffusion is not included in the model, the effective pore diffusivity that gives the best fit to the experimental data is found to be higher than expected from earlier measurements of iodide diffusion in the same type of rock material. This indicates that the diffusion of cesium and strontium (sorbing components) in rock material is caused by both pore diffusion and surface diffusion acting in parallel. (author)

  8. Adsorption of Radioactive Cesium to Illite-Sericite Mixed Clays

    Hwang, J. H.; Choung, S.; Park, C. S.; Jeon, S.; Han, J. H.; Han, W. S.


    Once radioactive cesium is released into aquatic environments through nuclear accidents such as Chernobyl and Fukushima, it is harmful to human and ecological system for a long time (t1/2 = 30.2 years) because of its chemical toxicity and γ-radiation. Sorption mechanism is mainly applied to remove the cesium from aquatic environments. Illite is one of effective sorbent, considering economical cost for remediation. Although natural illite is typically produced as a mixture with sericite formed by phyllic alteration in hydrothermal ore deposits, the effects of illite-sericite mixed clays on cesium sorption was rarely studied. This study evaluated the sorption properties of cesium to natural illite collected at Yeongdong in Korea as the world-largest illite producing areas (termed "Yeongdong illite"). The illite samples were analyzed by XRF, XRD, FT-IR and SEM-EDX to determine mineralogy, chemical composition, and morphological characteristics, and used for batch sorption experiments. Most of "Yeongdong illite" samples predominantly consist of sericite, quartz, albite, plagioclase feldspar and with minor illite. Cesium sorption distribution coefficients (Kd,Cs) of various "Yeongdong illite" samples ranged from 500 to 4000 L/kg at low aqueous concentration (Cw 10-7 M). Considering Kd,Cs values were 400 and 6000 using reference sericite and illite materials, respectively, in this study, these results suggested that high contents of sericite significantly affect the decrease of sorption capabilities for radiocesium by natural illite (i.e., illite-sericite mixed clay).

  9. Cesium removal using crystalline silicotitanate. Innovative technology summary report


    Approximately 100 million gallons of radioactive waste is stored in underground storage tanks at the Hanford Site, Idaho National Engineering and Environmental Laboratory (INEEL), Oak Ridge Reservation, and Savannah River Site (SRS). Most of the radioactivity comes from 137 Cs, which emits high-activity gamma radiation. The Cesium Removal System is a modular, transportable, ion-exchange system configured as a compact processing unit. Liquid tank waste flows through columns packed with solid material, called a sorbent, that selectively adsorbs cesium and allows the other materials to pass through. The sorbent is crystalline silicotitanate (CST), an engineered material with a high capacity for sorbing cesium from alkaline wastes. The Cesium Removal System was demonstrated at Oak Ridge using Melton Valley Storage Tank (MVST) waste for feed. Demonstration operations began in September 1996 and were completed during June 1997. Prior to the demonstration, a number of ion-exchange materials were evaluated at Oak Ridge with MVST waste. Also, three ion-exchange materials and three waste types were tested at Hanford. These bench-scale tests were conducted in a hot cell. Hanford's results showed that 300 times less sorbent was used by selecting Ionsiv IE-911 over organic ion-exchange resins for cesium removal. This paper gives a description of the technology and discusses its performance, applications, cost, regulatory and policy issues and lessons learned

  10. Cesium diffusion in Bure mud-rock: effect of cesium sorption and of the surface structure of the clay

    Melkior, T.; Motellier, S.; Yahiaoui, S.


    Full text of publication follows: This work is devoted to cesium diffusion through mud-rock samples from Bure (Meuse/Haute- Marne, France). This rock is mainly composed of interstratified illite/smectite, quartz and calcite. According to published data, positively charged solutes exhibit high diffusion coefficients in argillaceous media compared to neutral species. This effect was actually observed for cesium in Bure mud-rock samples: the effective diffusion coefficients (De) of tritiated water and cesium were found to be ca. 2 x 10 -11 m 2 s -1 and 2.5 x 10 -10 m 2 s -1 , respectively. Some authors assign this 'enhanced diffusion' of cations to the particular migration of ions within the electrical double layer, next to mineral surfaces (surface diffusion mechanism). To assess the role of sorbed ions in the diffusive transfer, cesium diffusion coefficients in Bure mud-rock were measured at different cesium concentrations. The distribution coefficient of cesium onto Bure mud-rock was measured in batch: it significantly varies over the concentration range investigated in the diffusion tests (between 2 x 10 -6 M and 2 x 10 -2 M). If sorbed ions contribute to the transfer, the effective diffusion coefficients deduced from these different tests should depend on cesium concentration. Nevertheless, the measured effective diffusion coefficients are found to be relatively unaffected by cesium concentration. It is thus concluded that ions at the sorbed state play a minor role in the diffusion. Following the assumption of an 'accelerated' transfer due to ions located in the diffuse double layer, the charge of the clay particles should affect the 'enhanced diffusion' of cesium. Therefore, a mud-rock sample was first crushed and contacted with a cationic surfactant at different solid/liquid ratios. The conditions were adjusted to obtain suspensions having positive, neutral and negative zeta potentials respectively. Three compact samples were then made with these different

  11. A novel role for methyl cysteinate, a cysteine derivative, in cesium accumulation in Arabidopsis thaliana

    Adams, Eri; Miyazaki, Takae; Hayaishi-Satoh, Aya


    Phytoaccumulation is a technique to extract metals from soil utilising ability of plants. Cesium is a valuable metal while radioactive isotopes of cesium can be hazardous. In order to establish a more efficient phytoaccumulation system, small molecules which promote plants to accumulate cesium we...

  12. An Overview of NCRP Report No. 138 on Terrorist Activities

    Poston, John, Sr.


    In late 1998, the National Council on Radiation Protection and Measurements (NCRP) convened Scientific Committee 46-14 to prepare a report on the radiological safety aspects of terrorist activities involving radioactivity. The work of this committee was funded through a contract with the Planning and Preparedness Division of the Office of Emergency Management of the Department of Energy. The committee was composed of a diverse group of individuals with expertise in many areas in addition to radiation safety and emergency response. These areas included law (both federal and state), public communications, and psychosocial aspects of such incidents. The statement of work focused the work of the committee, and the resulting report did not necessarily address all issues of such activities. One of the charges of the committee was to provide guidance as to necessary research and make recommendations regarding the present infrastructure with the responsibility for responding to such incidents. This presentation will provide an overview of NCRP Report No. 138 and focus on some of the critical issues raised in the report. These issues include recognition of the event, the interface between federal, state, and local authorities, exposure limits for the first-responders, clean-up criteria, training and resources, the psychosocial aspects of such events, and communications with the media and the public. This report represented the ``beginning'' of such considerations. It pointed the way for additional studies and research in this very important area.

  13. Cesium in the Savannah River Site environment

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of 137 Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of 137 Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope 137 Cs releases have resulted in a negligible risk to the environment and the population it supports

  14. Sorption of cesium and uranium to Feldspar

    Wijland, G.C.; Pennders, R.M.J.


    Within safety assessment studies, for nuclear waste disposal in deep geologic formations, calculation for the migration of radionuclides through the geosphere are often carried out with models taking sorption into account. In the past 8 years the insight grew that other physico-chemical processes, besides sorption, could affect migration behaviour. While the currently used transport models were being improved taking either linear or non-linear sorption into account, the coupling of geochemical and transport models came into scope. In spite of these developments models which are still based on the sorption theory are frequently applied in studying migration behaviour of radionuclides. This is caused by the necessity of making preliminary pronouncements, while coupled models are still in stage of development and thermodynamic data are very limited available. Therefore one has to obtain insight in the reliability of the models based on the sorption theory. within the sorption database there is a lack of knowledge about mineralogy, composition of the fluid and the experimental conditions underlying the data. Therefore the Expert Group on geochemical Modelling supported by the Finnish proposal in order to obtain insight in the possible deviation of the sorption coefficients that can be estimated from experiments performed with standard samples, fluid composition and experimental conditions. Nine laboratories from OECD membership countries took part in this intercalibration study. In the framework of the Dutch safety assessment studies the Dutch National Institute of Public health and Environmental protection (RIVM) has decided to participate in this exercise. In this report the results are presented of sorption experiments for cesium and natural Uranium to Feldspar. (H.W.). 4 refs.; 1 fig.; 7 tabs

  15. Cesium in the Savannah River Site environment

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of [sup 137]Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of [sup 137]Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope [sup 137]Cs releases have resulted in a negligible risk to the environment and the population it supports.

  16. Cesium in the Savannah River Site environment

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of {sup 137}Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of {sup 137}Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope {sup 137}Cs releases have resulted in a negligible risk to the environment and the population it supports.

  17. Cesium 137 in oils and plants from Guatemala

    Ayala, R.E.; Perez, J.F.


    Since 1990 the project of radioactive and environmental contamination started in Guatemala. Studies about the radioactive contamination levels are made within the framework of this project. Cesium-137 has been an interest radionuclide, because it is a fission product released to the environment by the use of nuclear weapons and nuclear power plants accidents. The sampling consisted in collection of soil and grass in 20 provinces of Guatemala, one point by province, and it was made in 1990. The cesium-137 concentration in the samples, was determined by gamma spectrometry, using an hyper pure germanium detector. The results show the presence of radioactive contamination in soil and grass due to cesium-137, at levels that might be considered as normal. The levels found are not harmful for human health, and its importance is the fact that can be used as reference levels for the environmental radioactivity monitoring in Guatemala

  18. Environmental application of cesium-137 irradiation technology: sludges and foods

    Sivinski, J.S.


    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation. (author)

  19. Catalytic oxidation of silicon by cesium ion bombardment

    Souzis, A.E.; Huang, H.; Carr, W.E.; Seidl, M.


    Results for room-temperature oxidation of silicon using cesium ion bombardment and low oxygen exposure are presented. Bombardment with cesium ions is shown to allow oxidation at O 2 pressures orders of magnitude smaller than with noble gas ion bombardment. Oxide layers of up to 30 A in thickness are grown with beam energies ranging from 20--2000 eV, O 2 pressures from 10 -9 to 10 -6 Torr, and total O 2 exposures of 10 0 to 10 4 L. Results are shown to be consistent with models indicating that initial oxidation of silicon is via dissociative chemisorption of O 2 , and that the low work function of the cesium- and oxygen-coated silicon plays the primary role in promoting the oxidation process

  20. Environmental application of cesium-137 irradiation technology: Sludges and foods

    Sivinski, Jacek S.

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation.

  1. Measurement of low levels of cesium-137 in water

    Milham, R.C.; Kantelo, M.V.


    Large volume water sampling systems were developed to measure very low levels of cesium-137 in river water and in finished water from water treatment plants. Three hundred to six hundred liters of filtered water are passed through the inorganic ion exchanger potassium cobalti-ferrocyanide to remove greater than 90% of the cesium. Measurement of cesium-137 by gamma ray spectrometry results in a sensitivity of 0.001 pCi/L. Portable as well as stationary samplers were developed to encompass a variety of applications. Results of a one year study of water from the Savannah River and from water treatment plants processing Savannah River water are presented. 3 references, 7 figures

  2. Sorption kinetics of cesium on hydrous titanium dioxide

    Altas, Y.; Tel, H.; Yaprak, G.


    Two types of hydrous titanium dioxide possessing different surface properties were prepared and characterized to study the sorption kinetics of cesium. The effect of pH on the adsorption capacity were determined in both type sorbents and the maximum adsorption percentage of cesium were observed at pH 12. To elucidate the kinetics of ion-exchange reaction on hydrous titanium dioxide, the isotopic exchange rates of cesium ions between hydrous titanium dioxides and aqueous solutions were measured radiochemically and compared with each other. The diffusion coefficients of Cs + ion for Type1 and Type2 titanium dioxides at pH 12 were calculated as 2.79 x 10 -11 m 2 s -1 and 1.52 x 10 -11 m 2 s -1 , respectively, under particle diffusion controlled conditions. (orig.)

  3. Sericitization of illite decreases sorption capabilities for cesium

    Choung, S.; Hwang, J.; Han, W.; Shin, W.


    Release of radioactive cesium (137Cs) to environment occurs through nuclear accidents such as Chernobyl and Fukushima. The concern is that 137Cs has long half-life (t1/2 = 30.2 years) with chemical toxicity and γ-radiation. Sorption techniques are mainly applied to remove 137Cs from aquatic environment. In particular, it has been known well that clay minerals (e.g, illite) are effective and economical sorbents for 137Cs. Illite that was formed by hydrothermal alteration exist with sericite through "sericitization" processes. Although sericite has analogous composition and lattice structure with illite, the sorptive characteristics of illite and sericite for radiocesium could be different. This study evaluated the effects of hydrothermal alteration and weathering process on illite cesium sorption properties. Natural illite samples were collected at Yeongdong area in Korea as the world-largest hydrothermal deposits for illite. The samples were analyzed by XRF, XRD and SEM-EDX to determine mineralogy, chemical compositions and morphological characteristics, and used for batch sorption experiments. The Yeongdong illites predominantly consist of illite, sericite, quartz, and albite. The measured cesium sorption distribution coefficients (Kd,Cs) of reference illite and sericite were approximately 6000 and 400 L kg-1 at low aqueous concentration (Cw 10-7 M), respectively. In contrast, Kd,Cs values for the Yeongdong illite samples ranged from 500 to 4000 L kg-1 at identical concentration. The observed narrow and sharp XRD peak of sericite indicated that the sericite has better crystallinity compared to illite. These experimental results suggested that sericitization processes of illite can decline the sorption capabilities of illite for cesium under various hydrothermal conditions. In particular, weathering experiments raised the cesium sorption to illite, which seems to be related to the increase of preferential sorption sites for cesium through crystallinity destruction

  4. Selective removal of cesium by ammonium molybdophosphate – polyacrylonitrile bead and membrane

    Ding, Dahu, E-mail: [College of Resources and Environmental Sciences, Nanjing Agricultural University, Nanjing 210095 (China); Graduate School of Life and Environmental Science, University of Tsukuba, Tsukuba, Ibaraki 305-8572 (Japan); Zhang, Zhenya [Graduate School of Life and Environmental Science, University of Tsukuba, Tsukuba, Ibaraki 305-8572 (Japan); Chen, Rongzhi [College of Resources and Environment, University of Chinese Academy of Sciences, Beijing 100044 (China); Cai, Tianming, E-mail: [College of Resources and Environmental Sciences, Nanjing Agricultural University, Nanjing 210095 (China)


    Highlights: • AMP-PAN membrane was prepared for the first time through a simple way. • AMP-PAN bead performed high adsorption capacity and selectivity towards Cs{sup +}. • Liquid film diffusion was the rate-limiting step during the batch adsorption process. • AMP-PAN membrane could eliminate Cs{sup +} effectively from water through rapid filtration. - Abstract: The selective removal of radionuclides with extremely low concentrations from environmental medium remains a big challenge. Ammonium molybdophosphate possess considerable selectivity towards cesium ion (Cs{sup +}) due to the specific ion exchange between Cs{sup +} and NH{sub 4}{sup +}. Ammonium molybdophosphate – polyacrylonitrile (AMP-PAN) membrane was successfully prepared for the first time in this study. Efficient removal of Cs{sup +} (95.7%, 94.1% and 91.3% of 1 mg L{sup −1}) from solutions with high ionic strength (400 mg L{sup −1} of Na{sup +}, Ca{sup 2+} or K{sup +}) was achieved by AMP-PAN composite. Multilayer chemical adsorption process was testified through kinetic and isotherm studies. The estimated maximum adsorption capacities even reached 138.9 ± 21.3 mg g{sup −1}. Specifically, the liquid film diffusion was identified as the rate-limiting step throughout the removal process. Finally, AMP-PAN membrane could eliminate Cs{sup +} from water effectively through the filtration adsorption process.

  5. Strontium-90 and cesium-137 in freshwater from May 1984


    Strontium-90 and cesium-137 in freshwater measured in May 1984 are given in pCi/l. The sampling point is 1, Kasumigaura-Lake (Ibaraki). Collection and pretreatment of samples, preparation of samples for analysis, separation of strontium-90 and cesium-137, determination of stable strontium, calcium and potassium, and counting are described. The sample was passed through a cation exchange column. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 minutes. (Mori, K.)

  6. Cesium-137: psychological and social consequences of the Goiania's accident

    Helou, Suzana; Costa Neto, Sebastiao Benicio da


    The book care for radioactive accident occurred in 1987 in Goiania - brazilian city. The accident had origin by the hospitable equipment incorrect handling which contained a stainless steel capsule, in which interior there was cesium-137 chloride. The main boarded aspects are: psychological and social aspects verified after the accident; psychological and social analysis of population of Goiania three years after the accident; essay on the pertinence of Luscher's abbreviate test in psychological evaluation of the radioactive accident victims of Goiania; and psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

  7. Thallous and cesium halide materials for use in cryogenic applications

    Lawless, W.N.


    Certain thallous and cesium halides, either used alone or in combination with other ceramic materials, are provided in cryogenic applications such as heat exchange material for the regenerator section of a closed-cycle cryogenic refrigeration section, as stabilizing coatings for superconducting wires, and as dielectric insulating materials. The thallous and cesium halides possess unusually large specific heats at low temperatures, have large thermal conductivities, are nonmagnetic, and are nonconductors of electricity. They can be formed into a variety of shapes such as spheres, bars, rods, or the like and can be coated or extruded onto substrates or wires. (author)

  8. Using Cesium for 3D Thematic Visualisations on the Web

    Gede, Mátyás


    Cesium ( is an open source, WebGL-based JavaScript library for virtual globes and 3D maps. It is an excellent tool for 3D thematic visualisations, but to use its full functionality it has to be feed with its own file format, CZML. Unfortunately, this format is not yet supported by any major GIS software. This paper intro- duces a plugin for QGIS, developed by the author, which facilitates the creation of CZML file for various types of visualisations. The usability of Cesium is also examined in various hardware/software environments.

  9. Adsorption of iodine and cesium onto some cement materials

    Mine, Tatsuya [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan); Mihara, Morihiro; Ito, Masaru [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Kato, Hiroshige [IDC, Tokai, Ibaraki (Japan)


    Cement materials, being expected to be used in structural materials in underground disposals of radioactive wastes, may adsorb nuclides resulting in retardation of their migration in environment. In this report adsorption behaviors of cement pastes toward iodine (as anion) and cesium (as cation) were studied. Adsorption of iodine was remarkable for OPC and MHP pastes that are known to have high molar ratio CaO/SiO{sub 2}, partition coefficient being 100 ml/g for initial tracer concentration of 10{sup -5} mol/l. Partition coefficient for cesium for PFA paste was found to be 5 ml/g on average. (S. Ohno)

  10. Adsorption of iodine and cesium onto some cement materials

    Mine, Tatsuya; Mihara, Morihiro; Ito, Masaru


    Cement materials, being expected to be used in structural materials in underground disposals of radioactive wastes, may adsorb nuclides resulting in retardation of their migration in environment. In this report adsorption behaviors of cement pastes toward iodine (as anion) and cesium (as cation) were studied. Adsorption of iodine was remarkable for OPC and MHP pastes that are known to have high molar ratio CaO/SiO 2 , partition coefficient being 100 ml/g for initial tracer concentration of 10 -5 mol/l. Partition coefficient for cesium for PFA paste was found to be 5 ml/g on average. (S. Ohno)

  11. Cesium accumulation in native trees from the Brazilian Cerrado

    Franca, E.J.D.; Miranda, M.V.F.E.S.; Santos, T.O.; Cantinha, R.S.; Fernandes, E.A.D.N.


    Even considered not essential for plants, cesium may cycle within forest ecosystems. Taking into account the lack of knowledge on the distribution of this chemical element in Brazilian ecosystems, this work encompasses the unexpected cesium accumulation in native plant leaves from Cerradao, a Brazilian hotspot of world biodiversity. Some trees were Cs accumulators, achieving mass fractions in leaves 700 times higher (up to 12.7 mg kg -1 ) when compared to other Brazilian native tree leaves from the Atlantic Forest. In fact, such trace element accumulation in leaves was not previously noticed for Brazilian ecosystems despite the intra- and inter-species variability observed in Cerrado tree leaves. (author)

  12. Selective chemical binding enhances cesium tolerance in plants through inhibition of cesium uptake.

    Adams, Eri; Chaban, Vitaly; Khandelia, Himanshu; Shin, Ryoung


    High concentrations of cesium (Cs(+)) inhibit plant growth but the detailed mechanisms of Cs(+) uptake, transport and response in plants are not well known. In order to identify small molecules with a capacity to enhance plant tolerance to Cs(+), chemical library screening was performed using Arabidopsis. Of 10,000 chemicals tested, five compounds were confirmed as Cs(+) tolerance enhancers. Further investigation and quantum mechanical modelling revealed that one of these compounds reduced Cs(+) concentrations in plants and that the imidazole moiety of this compound bound specifically to Cs(+). Analysis of the analogous compounds indicated that the structure of the identified compound is important for the effect to be conferred. Taken together, Cs(+) tolerance enhancer isolated here renders plants tolerant to Cs(+) by inhibiting Cs(+) entry into roots via specific binding to the ion thus, for instance, providing a basis for phytostabilisation of radiocesium-contaminated farmland.

  13. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan; Abdallah, Basem M.; Ditzel, Nicholas; Nossent, Anne Yael; Bak, Mads; Kauppinen, Sakari; Kassem, Moustapha


    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators of diverse biological processes by mediating translational repression or mRNA degradation of their target genes. Here, we show that miRNA-138 (miR-138) modulates osteogenic differentiation of hMSCs. miRNA array profiling and further validation by quantitative RT-PCR (qRT-PCR) revealed that miR-138 was down-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore, overexpression of miR-138 reduced ectopic bone formation in vivo by 85%, and conversely, in vivo bone formation was enhanced by 60% when miR-138 was antagonized. Target prediction analysis and experimental validation by luciferase 3′ UTR reporter assay confirmed focal adhesion kinase, a kinase playing a central role in promoting osteoblast differentiation, as a bona fide target of miR-138. We show that miR-138 attenuates bone formation in vivo, at least in part by inhibiting the focal adhesion kinase signaling pathway. Our findings suggest that pharmacological inhibition of miR-138 by antimiR-138 could represent a therapeutic strategy for enhancing bone formation in vivo. PMID:21444814

  14. Sorption of cesium in young till soils

    Lusa, Merja; Lempinen, Janne; Ahola, Hanna; Soederlund, Mervi; Lehto, Jukka [Helsinki Univ. (Finland). Laboratory of Radiochemistry; Lahdenperae, Anne-Maj [Saanio and Riekkola Oy, Consulting Engineers, Helsinki (Finland); Ikonen, Ari T.K. [Posiva Oy, Eurajoki (Finland)


    Soil samples from three forest soil pits were examined down to a depth of approximately three metres using 1 M ammonium acetate extraction and microwave-assisted extraction with concentrated nitric acid (HNO{sub 3}), to study the binding of cesium (Cs) at Olkiluoto Island, southern Finland. Ammonium acetate was used to extract the readily exchangeable Cs fractions roughly representing the Cs fraction in soil which is available for plants. Microwave-assisted HNO{sub 3} extraction dissolves various minerals, e.g. carbonates, most sulphides, arsenides, selenides, phosphates, molybdates, sulphates, iron (Fe) and manganese (Mn) oxides and some silicates (olivine, biotite, zeolite), and reflects the total Cs concentrations. Cs was mostly found in the strongly bound fraction obtained through HNO{sub 3} extraction. The average Cs concentrations found in this fraction were 3.53 ± 0.30 mg/kg (d.w.), 3.06 ± 1.86 mg/kg (d.w.) and 1.83 ± 0.42 mg/kg (d.w.) in the three soil pits, respectively. The average exchangeable Cs found in the ammonium acetate extraction in all three sampling pits was 0.015 ± 0.008 mg/kg (d.w.). In addition, Cs concentrations in the soil solution were determined and in situ distribution coefficients (K{sub d}) for Cs were calculated. Furthermore, the in situ K{sub d} data was compared with the Cs K{sub d} data obtained using the model batch experiments. The in situ K{sub d} values were observed to fairly well follow the trend of batch sorption data with respect to soil depth, but on average the batch distribution coefficients were almost an order of magnitude higher than the in situ K{sub d} data. In situ Cs sorption data could be satisfactory fitted with the Langmuir sorption isotherm, but the Freundlich isotherm failed to fit the data. Finally, distribution coefficients were calculated by an ion exchange approach using soil solution data, the cation exchange capacity (CEC) as well as Cs to sodium (Na) and Cs to potassium (K) ion exchange selectivity

  15. Ionization mechanism of cesium plasma produced by irradiation of dye laser

    Yamada, Jun; Shibata, Kohji; Uchida, Yoshiyuki; Hioki, Yoshiaki; Sahashi, Toshio.


    When a cesium vapor was irradiated by a dye laser which was tuned to the cesium atomic transition line, the number of charged particles produced by the laser radiation was observed. Several sharp peaks in the number of charged particles were observed, which corresponded to the atomic transition where the lower level was the 6P excited atom. The ionization mechanism of the laser-produced cesium plasma has been discussed. An initial electron is produced by laser absorptions of the cesium dimer. When the cesium density is high, many 6P excited atoms are excited by electron collisions. The 6P excited atom further absorbs the laser photon and is ionized through the higher-energy state. As the cesium vapor pressure increases, the resonance effect becomes observable. The 6P excited atom plays dominant role in the ionization mechanism of the laser-produced cesium plasma. (author)

  16. Cesium-137 accumulation in higher plants before and after Chernobyl

    Sawidis, T.; Drossos, E.; Papastefanou, C.; Heinrick, G.


    Cesium-137 concentrations in plant species of three biotypes of northern Greece, differing in location as well as in vegetation, are reported following the Chernobyl reactor accident. The cesium uptake by plants was due to the foliar deposition rather than the root uptake. The highest level of cesium in plants was found in Ranunculus sardous, a pubescent plant. The 137 Cs concentration was about 22kBq kg -1 d.w. A high level of cesium was also found in Salix alba ( 137 Cs: 19.6 kBq kg -1 d.w.), a deciduous tree showing that hairy leaves or leaves having rough and large surfaces can absorb greater amounts of radioactivity (surface effect). A comparison is also made between the results of measurements of the present study and the results of measurements of some herbarium plants collected one year before the accident as well as the results of measurements of some new plants grown and collected one year after the accident resulting in a natural removal rate of 137 Cs in plants varying from 14 to 130 days

  17. Monocrystallomimicry in the aerosols of ammonium and cesium halides

    Melikhov, I.V.; Kitova, E.N.; Kozlovskaya, EhD.; Kamenskaya, A.N.; Mikheev, N.B.; Kulyukhin, S.A.


    It is experimentally shown that initial CsI and NH 4 Hal nanocrystals combining into mixed aggregates of polyhedral form (pseudo monocrystals) are formed in the process of cocrystallization of ammonium halide and cesium iodide. The origination and growth of the pseudo monocrystals on the account of successive addition of initial crystals is described by the Fokker-Plank equation [ru

  18. Behaviour of cesium 134 and 137 in lake ecosystems

    Huebel, K.; Saenger, W.; Luensmann, W.


    The time dependent cesium activity concentration observed in surface water samples from South Bavarian lakes after the Chernobyl accident is analysed by use of a two-compartment model simulating the accidental transport of radiocesium from surface water to suspended particles. (orig.)

  19. Detection of quadrupole relaxation in an optically pumped cesium vapour

    Bernabeu, E; Tornos, J


    The relaxation of quadrupole orientation induced by means of optical pumping in a cesium vapour is experimentally studied, and the results are compared to the theoretical predictions. The optical detection process of this type of orientation is also discussed as a function of the polarization and spectral profile of the detection light.

  20. Kinetics of 137cesium in cerebral structures and blood

    Ribas, B.; Gonzalez, M.D.; Rio, J. del; Reus, M.I.S.; Gonzalez-Baron, M.


    The old clinical use of cesium in epilepsy expresses a relation of this metal with the central nervous system. Two groups of male Wistar rats of 200 g were administered single doses of 50μCi intravenously for blood kinetics and 2μCi 137 CsCl in each lateral ventricle of the brain for the kinetics in the cerebral structures, respectively. In both cases under ether anesthesia. Blood samples of IV gouts were weighed, and cerebral structure hypothalamus, hypocampus, striatum, cortex, cerebellum, mesencephalon and medulla oblongata dissected, cleaned, washed, dried, weighed, and in both cases cpm of the samples evaluated submitting it to the gamma radiations detector. In both experimental values of the 137 CsCl kinetics are expressed and applying the retroprojection method; parameters and constants are obtained. tsub(1/2) alpha = 0.0358 h and tsub(1/2) beta = 6.7159 h. In tables the equations of the alpha and beta phases are expressed. In blood after the rapid diminution of the radioactivity in the first 5 min the equilibrium phase is reached in 30 min afterwards, and the values remain almost the same 4 h after the injection and cesium is slowly eliminated by the rat. Cerebral structures after its intracerebroventricular application show that cesium has a great uptake velocity, it is rapidly incorporated by hypothalamus and after by cortex, hypocampus, striatum, mesencephalon and medulla oblongata, the two last showing the slower incorporation. After 24 h the cesium radioactivity declines slowly and progressively. (author)

  1. Strontium-90 and cesium-137 in fresh water


    Japan Chemical Analysis Center has analysed the strontium-90 and Cesium-137 contents in fresh water from 7 prefectures in Japan by the commission of Science and Technology Agency of Japanese Government. The method described in ''Radioactivity Survey Data in Japan No. 43 (NIRS-RSD-43, 1977) was applied to the analysis of these two radionuclides in samples. (author)

  2. Hot demonstration of proposed commercial cesium removal technology

    Lee, D.D.; Travis, J.R.; Gibson, M.R.


    This report describes the work done in support of the development of technology for the continuous removal and concentration of radioactive cesium in supernatant from Melton Valley Storage Tanks (MVSTs) at the ORNL site. The primary objective was to test candidate absorbers and ion exchangers under continuous-flow conditions using actual supernatant from the MVSTs. An experimental system contained in a hot-cell facility was constructed to test the materials in columns or modules using the same batch of supernatant to allow comparison on an equal basis. Resorcinol/formaldehyde (RF) resin was evaluated at three flow rates with 50% breakthrough ranges of 35 to 50 column volumes (CV) and also through a series of five loading/elution/regeneration cycles. The results reported here include the cesium loading breakthrough curves, elution curves (when applicable), and operational problems and observations for each material. The comparative evaluations should provide critical data for the selection of the sorbent for the ORNL Cesium Removal Demonstration project. These results will be used to help determine the design parameters for demonstration-scale systems. Such parameters include rates of cesium removal, quantity of resin or sorbent to be used, and elution and regeneration requirements, if applicable

  3. Membrane-based separation technologies for cesium, strontium, and technetium

    Kafka, T.


    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah

  4. Validation and Application of Concentrated Cesium Eluate Physical Property Models

    Choi, A.S.


    This work contained two objectives. To verify the mathematical equations developed for the physical properties of concentrated cesium eluate solutions against experimental test results obtained with simulated feeds. To estimate the physical properties of the radioactive AW-101 cesium eluate at saturation using the validated models. The Hanford River Protection Project (RPP) Hanford Waste Treatment and Immobilization Plant (WTP) is currently being built to extract radioisotopes from the vast inventory of Hanford tank wastes and immobilize them in a silicate glass matrix for eventual disposal at a geological repository. The baseline flowsheet for the pretreatment of supernatant liquid wastes includes removal of cesium using regenerative ion-exchange resins. The loaded cesium ion-exchange columns will be eluted with nitric acid nominally at 0.5 molar, and the resulting eluate solution will be concentrated in a forced-convection evaporator to reduce the storage volume and to recover the acid for reuse. The reboiler pot is initially charged with a concentrated nitric acid solution and kept under a controlled vacuum during feeding so the pot contents would boil at 50 degrees Celsius. The liquid level in the pot is maintained constant by controlling both the feed and boilup rates. The feeding will continue with no bottom removal until the solution in the pot reaches the target endpoint of 80 per cent saturation with respect to any one of the major salt species present

  5. Selective extraction of cesium: from compound to process

    Simon, N.; Eymard, S.; Tournois, B.; Dozol, J.F.


    Under the French law of 30 December 1991 on nuclear waste management, research is conducted to recover long-lived fission products from high-level radioactive effluents generated by spent fuel reprocessing, in order to destroy them by transmutation or encapsulate them in specific matrices. Cesium extraction with mono and bis-crown calix(4)arenes (Frame 1) is a candidate for process development. These extractants remove cesium from highly acidic or basic pH media even with high salinity. A real raffinate was treated in 1994 in a hot cell to extract cesium with a calix-crown extractant. The success of this one batch experiment confirmed the feasibility of cesium decontamination from high-level liquid waste. It was then decided to develop a process flowchart to extract cesium selectively from high-level raffinate, to be included in the general scheme of long-lived radionuclide partitioning. It was accordingly decided to develop a process based on liquid-liquid extraction and hence optimize a calixarene/diluent solvent according to: - hydraulic properties: density, viscosity, interfacial tension, - chemical criteria: sufficient cesium extraction (depending on the diluent), kinetics, third phase elimination... New mono-crown-calixarenes branched with long aliphatic groups (Frame 2) were designed to be soluble in aliphatic diluents. To prevent third phase formation associated with nitric acid extraction, the addition of modifiers (alcohol, phosphate and amide) in the organic phase was tested (Frame 3). Table 1 shows examples of calixarene/diluent systems suitable for a process flowchart, and Figure 2 provides data on cesium extraction with these new systems. Alongside these improvements, a system based on a modified 1,3-di(n-octyl-oxy)2,4-calix[4]arene crown and a modified diluent was also developed, considering a mixed TPH/NPHE system as the diluent, where TPH (hydrogenated tetra propylene) is a common aliphatic industrial solvent and NPHE is nitrophenyl

  6. Cesium separation using integrated electro-membrane technique

    Fors, Patrik; Lillfors-Pintér, Christina; Widestrand, Henrik; Velin, Anna; Bengtsson, Bernt


    Conventional separation technologies such as ion exchange, electro-deionisation and cross flow filtration are not always effective to eliminate nuclides, which are weekly ionised, complexed or hydrated in effluents. Specific nuclide selective absorbers perform well for the treatment of active and contaminated wastewaters but most absorbers generate additional waste while treating high volumes of contaminated water and often show limitations in operating at high flow rates. Electrochemical Ion Exchange (EIX) and EIX in combination with absorbers may offer an alternative solution that overcomes those limitations. This paper reports on the optimization and performance of the integrated technique EIX, for the treatment of low activity effluents that contain cesium and other nuclides. The three-compartment EIX system, which operates with authentic reactor coolant with enhanced nuclide content, indicates high, over 90%, elimination of cesium in a single pass operation mode. With the in-situ and instant ion exchange regeneration, the system successfully reduces the activity from an initial range of 400-2600 Bq/kg to close to detection limit at a velocity of 10-15 cm/min. The applied current density varies between 50-200 mA/cm 2 and the mass balance is close to 100%. During the process, the eliminated cesium and other nuclides are concentrated up to the limits where reverse migration from the concentrated chamber occurs. The concentrate could then be treated with specific absorbents at low flow rates. EIX in combination with cesium-selective ion exchanger CsTreat ® separates the cesium-137 efficiently, but up to now the process does not perform according to EIX principles for the treatment of low grade radioactive wastewaters it rather performs as an irreversible adsorber. The aim with the outcome of the presently ongoing long-term tests is to further support the Best Available Technique Minimizing All Nuclide (BATMAN) projects of Vattenfall NPPs. (author)

  7. Experimental study on cesium immobilization in struvite structures

    Wagh, Arun S.; Sayenko, S.Y.; Shkuropatenko, V.A.; Tarasov, R.V.; Dykiy, M.P.; Svitlychniy, Y.O.; Virych, V.D.; Ulybkina, E.A.


    Graphical abstract: X-ray diffraction patterns of Ceramicrete forms, green representing struvite-K, and red, struvite-(K,Cs) with 10 wt.% CsCl in it. Cs substitutes partially for K, which immobilizes Cs at room temperature by the acid–base reaction. - Highlights: • Struvite structure of Ceramicrete is an excellent host of radioactive cesium. • The volatility problem of cesium can be avoided by this method. • This method can be used to produce cesium waste forms in ambient conditions. • It can also be used to pretreat cesium in glass vitrification technology. • It also provides a method to produce safe sealed radioactive sources of cesium. - Abstract: Ceramicrete, a chemically bonded phosphate ceramic, was developed for nuclear waste immobilization and nuclear radiation shielding. Ceramicrete products are fabricated by an acid–base reaction between magnesium oxide and mono potassium phosphate that has a struvite-K mineral structure. In this study, we demonstrate that this crystalline structure is ideal for incorporating radioactive Cs into a Ceramicrete matrix. This is accomplished by partially replacing K by Cs in the struvite-K structure, thus forming struvite-(K, Cs) mineral. X-ray diffraction and thermo-gravimetric analyses are used to confirm such a replacement. The resulting product is non-leachable and stable at high temperatures, and hence it is an ideal matrix for immobilizing Cs found in high-activity nuclear waste streams. The product can also be used for immobilizing secondary waste streams generated during glass vitrification of spent fuel, or the method described in this article can be used as a pretreatment method during glass vitrification of high level radioactive waste streams. Furthermore, it suggests a method of producing safe commercial radioactive Cs sources.

  8. Analysis of cesium extracting solvent using GCMS and HPLC

    White, T.L.; Herman, C.C.; Crump, S.L.; Marinik, A.R.; Lambert, D.P.; Eibling, R.E.


    A high-level waste (HLW) remediation process scheduled to begin in 2007 at the Savannah River Site is the Modular Caustic Side Solvent Extraction (CSSX) Unit (MCU). The MCU will use a hydrocarbon solvent (diluent) containing a cesium extractant, a calix[4]arene compound, to extract radioactive cesium from caustic HLW. The resulting decontaminated HLW waste or raffinate will be processed into grout at the Saltstone Production Facility (SPF). The cesium containing CSSX stream will undergo washing with dilute nitric acid followed by stripping of the cesium nitrate into a very dilute nitric acid or the strip effluent stream and the CSSX solvent will be recycled. The Defense Waste Processing Facility (DWPF) will receive the strip effluent stream and immobilize the cesium into borosilicate glass. Excess CSSX solvent carryover from the MCU creates a potential flammability problem during DWPF processing. Bench-scale DWPF process testing was performed with simulated waste to determine the fate of the CSSX solvent components. A simple high performance liquid chromatography (HPLC) method was developed to identify the modifier (which is used to increase Cs extraction and extractant solubility) and extractant within the DWPF process. The diluent and trioctylamine (which is used to suppress impurity effect and ion-pair disassociation) were determined using gas chromatography mass spectroscopy (GCMS). To close the organic balance, two types of sample preparation methods were needed. One involved extracting aqueous samples with methylene chloride or hexane, and the second was capturing the off gas of the DWPF process using carbon tubes and rinsing the tubes with carbon disulfide for analysis. This paper addresses the development of the analytical methods and the bench-scale simulated waste study results. (author)

  9. Experimental study on cesium immobilization in struvite structures

    Wagh, Arun S., E-mail: [Environmental Science Division, Argonne National Laboratory, 9700 S. Cass Avenue, IL 60439 (United States); Sayenko, S.Y.; Shkuropatenko, V.A.; Tarasov, R.V.; Dykiy, M.P.; Svitlychniy, Y.O.; Virych, V.D.; Ulybkina, E.A. [National Science Center, Kharkov Institute of Physics and Technology, Kharkov (Ukraine)


    Graphical abstract: X-ray diffraction patterns of Ceramicrete forms, green representing struvite-K, and red, struvite-(K,Cs) with 10 wt.% CsCl in it. Cs substitutes partially for K, which immobilizes Cs at room temperature by the acid–base reaction. - Highlights: • Struvite structure of Ceramicrete is an excellent host of radioactive cesium. • The volatility problem of cesium can be avoided by this method. • This method can be used to produce cesium waste forms in ambient conditions. • It can also be used to pretreat cesium in glass vitrification technology. • It also provides a method to produce safe sealed radioactive sources of cesium. - Abstract: Ceramicrete, a chemically bonded phosphate ceramic, was developed for nuclear waste immobilization and nuclear radiation shielding. Ceramicrete products are fabricated by an acid–base reaction between magnesium oxide and mono potassium phosphate that has a struvite-K mineral structure. In this study, we demonstrate that this crystalline structure is ideal for incorporating radioactive Cs into a Ceramicrete matrix. This is accomplished by partially replacing K by Cs in the struvite-K structure, thus forming struvite-(K, Cs) mineral. X-ray diffraction and thermo-gravimetric analyses are used to confirm such a replacement. The resulting product is non-leachable and stable at high temperatures, and hence it is an ideal matrix for immobilizing Cs found in high-activity nuclear waste streams. The product can also be used for immobilizing secondary waste streams generated during glass vitrification of spent fuel, or the method described in this article can be used as a pretreatment method during glass vitrification of high level radioactive waste streams. Furthermore, it suggests a method of producing safe commercial radioactive Cs sources.

  10. 9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine).


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Primary conveyances (motor vehicle, rail, air, and marine). 3.138 Section 3.138 Animals and Animal Products ANIMAL AND PLANT HEALTH... (motor vehicle, rail, air, and marine). (a) The animal cargo space of primary conveyances used in...

  11. Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater

    Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.


    HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

  12. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

  13. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.


    ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... later than every three years from the year the limits of liability were last adjusted for inflation, the...

  14. 11 CFR 100.138 - Sale of food and beverages by vendor.


    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

  15. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.


    on the delayed disease status. However, the results demonstrate a high incidence of a single amino acid polymorphism (cysteine 138) in HIV-1 Nef. The allelic frequency of cysteine 138 between the delayed disease progression group and the progressor group was found to be statistically significant (P = 0.......0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased...... viral replication (Premkumar DR, et al. AIDS Res Hum Retroviruses 1996; 12(4): 337-45). A sequence database search for comparative mutations revealed a high frequency of cysteine 138 in patients with reported SP AIDS...

  16. Desorption of intrinsic cesium from smectite: inhibitive effects of clay particle organization on cesium desorption.

    Fukushi, Keisuke; Sakai, Haruka; Itono, Taeko; Tamura, Akihiro; Arai, Shoji


    Fine clay particles have functioned as transport media for radiocesium in terrestrial environments after nuclear accidents. Because radiocesium is expected to be retained in clay minerals by a cation-exchange reaction, ascertaining trace cesium desorption behavior in response to changing solution conditions is crucially important. This study systematically investigated the desorption behavior of intrinsic Cs (13 nmol/g) in well-characterized Na-montmorillonite in electrolyte solutions (NaCl, KCl, CaCl2, and MgCl2) under widely differing cation concentrations (0.2 mM to 0.2 M). Batch desorption experiments demonstrated that Cs(+) desorption was inhibited significantly in the presence of the environmental relevant concentrations of Ca(2+) and Mg(2+) (>0.5 mM) and high concentrations of K(+). The order of ability for Cs desorption was Na(+) = K(+) > Ca(2+) = Mg(2+) at the highest cation concentration (0.2 M), which is opposite to the theoretical prediction based on the cation-exchange selectivity. Laser diffraction grain-size analyses revealed that the inhibition of Cs(+) desorption coincided with the increase of the clay tactoid size. Results suggest that radiocesium in the dispersed fine clay particles adheres on the solid phase when the organization of swelling clay particles occurs because of changes in solution conditions caused by both natural processes and artificial treatments.

  17. Method and article for primary containment of cesium wastes. [DOE patent application

    Angelini, P.; Lackey, W.J.; Stinton, D.P.; Blanco, R.E.; Bond, W.D.; Arnold, W.D. Jr.


    A method for producing a cesium-retentive waste form, characterized by a high degree of compositional stability and mechanical integrity, is provided by subjecting a cesium-loaded zeolite to heat under conditions suitable for stabilizing the zeolite and immobilizing the cesium, and coating said zeolite for sufficient duration within a suitable environment with at least one dense layer of pyrolytic carbon to seal therein said cesium to produce a final, cesium-bearing waste form. Typically, the zolite is stabilized and the cesium immobilized in less than four hours by confinement within an air environment maintained at about 600/sup 0/C. Coatings are thereafter applied by confining the calcined zeolite within a coating environment comprising inert fluidizing and carbon donor gases maintained at 1000/sup 0/C for a suitable duration.

  18. Theoretical study of the chemical properties of cesium hydride; Teoreticke studium chemickych vlastnosti hydridu cezia

    Skoviera, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra fyzikalnej a teoretickej chemie, 84215 Bratislava (Slovakia)


    A theoretical study of radiofrequency source of hydrogen ions in the International Thermonuclear Experimental Reactor (ITER) used a cesium grid as a source of electrons for ionization of hydrogen. In the process of ionization of hydrogen, however, there is a weathering of cesium grid, resulting into a group of undesired products - cesium hydrides and materials derived from cesium hydride. We calculated the potential curves of cesium hydride and of its anion and cation, their spectroscopic properties and partly their electrical properties. To make electrical properties comparable with the experiment, we calculated for all also the vibration corrections. Lack of convergence in RASSCF step caused, that the electrical properties of excited states are still an open question of chemical properties of cesium hydride. (authors)

  19. Strontium-90 and cesium-137 in service water


    Prefectural public health laboratories and institutes and Japan Chemical Analysis Center have analysed the contents of strontium-90 and cesium-137 in service water under the commission of Science and Technology Agency. At each prefectural public health laboratories and institutes, 100 literes of service water (8 prefectures, water from the intake of each station of water works) and tap water (32 prefectures) were collected as sample twice a year. The samples were filtrated with large filter papers after addition and mixture of both some carries. The filtration was then applied on a column filled the sodium cation exchange resin, and all the cations were absorbed on it. These resin and filter papers were collected at Japan Chemical Analysis Center. At Japan Chemical Analysis Center, these collected samples were radiochemically analysed for strontium-90 and cesium-137 using the method applied for the analysis of rain and dry fallout materials. (author)

  20. Strontium-90 and cesium-137 in total diet


    Under the commission of Science and Technology Agency, Japan Chemical Analysis Center has analysed total diet samples collected from 30 prefectures (2 times per year), and determined to content of strontium-90 and cesium-137 in these samples. Each Prefectural public health laboratories and institutes have collected all the daily regular diet consumed for five persons, namely three meals and other eating between meals, for radiochemical analysis in polyethylene containers. These samples were collected to Japan Chemical Analysis Center after carbonization without smoke rising in the large stainless dish. At Japan Chemical Analysis Center, these samples were asked in an electric muffle furnance. And the ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The nuclides were dissolved into hydrochloric acid and filtrated, after it was added with nitric acid and heated to dryness. The filtrates was analysed for strontium-90 and cesium-137 using the method recommended by Science and Technology Agency. (author)

  1. Cesium-137 in Norwegian milk 1960-1976

    Hvinden, T.


    Cesium-137 in milk has been measured at 11 sampling sites in Norway since 1960. The results show seasonal variations, normally with a peak during summer, and variations from district to district, depending upon farming and precipitation conditions. The concentration of cesium-137, averaged over the 11 sampling sites, reached a maximum of 0.44 nanocurie/litre in 1964, decreasing to 0.05 in 1975 and 1976. The range of variations within the 11 sites is of the order of 10. At other sites, with high precipitation and low grazing field qualities, the concentration has been found to be higher than at the 11 sites, giving a range of variations of more than 100. (Auth.)

  2. Modelling the release behaviour of cesium during severe fuel degradation

    Lewis, B.J.; Andre, B.; Morel, B.


    An analytical model has been applied to describe the diffusional release of fission product cesium from Zircaloy-clad fuel under high-temperature reactor accident conditions. The present treatment accounts for the influence of the atmosphere (i.e., changing oxygen potential) on the state of fuel oxidation and the release kinetics. The effects of fuel dissolution on the volatile release behaviour (under reducing conditions) is considered in terms of earlier crucible experiments and a simple model based on bubble coalescence and transport in metal pools. The model has been used to interpret the cesium release kinetics observed in steam and hydrogen experiments at the Vertical Irradiation (VI) Facility in the Oak Ridge National Laboratory and at the HEVA/VERCORS Facility in the Commissariat a l'Energie Atomique. (author)

  3. Hydrological methods preferentially recover cesium from nuclear waste salt cake

    Brooke, J.N.; Hamm, L.L.


    The Savannah River Site is treating high level radioactive waste in the form of insoluble solids (sludge), crystallized salt (salt cake), and salt solutions. High costs and operational concerns have prompted DOE to look for ways to improve the salt cake treatment process. A numerical model was developed to evaluate the feasibility of pump and treat technology for extracting cesium from salt cake. A modified version of the VAM3DCG code was used to first establish a steady-state flow field, then to simulate 30 days of operation. Simulation results suggest that efficient cesium extraction can be obtained with low displacement volumes. The actual extraction process will probably be less impressive because of nonuniform properties. 2 refs., 2 figs

  4. Flow Cytometry Assessment of In Vitro Generated CD138+ Human Plasma Cells

    Rayelle Itoua Maïga


    Full Text Available The in vitro CD40-CD154 interaction promotes human B lymphocytes differentiation into plasma cells. Currently, CD138 is the hallmark marker enabling the detection of human plasma cells, both in vitro and in vivo; its presence can be monitored by flow cytometry using a specific antibody. We have developed a culture system allowing for the differentiation of memory B lymphocytes. In order to detect the newly formed plasma cells, we have compared their staining using five anti-CD138 monoclonal antibodies (mAbs. As a reference, we also tested human cell lines, peripheral blood mononuclear cells, and bone marrow samples. The five anti-CD138 mAbs stained RPMI-8226 cells (>98% with variable stain index (SI. The highest SI was obtained with B-A38 mAb while the lowest SI was obtained with DL-101 and 1D4 mAbs. However, the anti-CD138 mAbs were not showing equivalent CD138+ cells frequencies within the generated plasma cells. B-A38, B-B4, and MI-15 were similar (15–25% while DL-101 mAb stained a higher proportion of CD138-positive cells (38–42%. DL-101 and B-A38 mAbs stained similar populations in bone marrow samples but differed in their capacity to bind to CD138high and CD138lo cell lines. In conclusion, such cellular fluctuations suggest heterogeneity in human plasma cell populations and/or in CD138 molecules.

  5. Cesium contamination of mosses in county Vas, Hungary

    Golya, I.; Sebestyen, R.


    Two species of mosses were examined to assess radiocesium contamination of Vas county, and to analyse some aspects of mosses for use as indicator of radioactive contamination. Experimental results demonstrated that the distribution of contamination in a given region could be characterized by the cesium contamination of mosses. Sampling sites should be selected with special attention paid to spots with high contamination. Regression analysis proved that the contamination of mosses originated from Chernobyl fallout. (author) 4 refs.; 2 figs

  6. Detection of the actinides and cesium from environmental samples

    Snow, Mathew Spencer

    Detection of the actinides and cesium in the environment is important for a variety of applications ranging from environmental remediation to safeguards and nuclear forensics. The utilization of multiple different elemental concentrations and isotopic ratios together can significantly improve the ability to attribute contamination to a unique source term and/or generation process; however, the utilization of multiple elemental "signatures" together from environmental samples requires knowledge of the impact of chemical fractionation for various elements under a variety of environmental conditions (including predominantly aqueous versus arid conditions). The research reported in this dissertation focuses on three major areas: 1. Improving the understanding of actinide-mineral interactions at ultra-low concentrations. Chapter 2 reports a batch sorption and modeling study of Np(V) sorption to the mineral goethite from attomolar to micromolar concentrations. 2. Improving the detection capabilities for Thermal Ionization Mass Spectrometry (TIMS) analyses of ultra-trace cesium from environmental samples. Chapter 4 reports a new method which significantly improves the chemical yields, purification, sample processing time, and ultimately, the detection limits for TIMS analyses of femtogram quantities of cesium from a variety of environmental sample matrices. 3. Demonstrating how actinide and cesium concentrations and isotopic ratios from environmental samples can be utilized together to determine a wealth of information including environmental transport mechanisms (e.g. aqueous versus arid transport) and information on the processes which generated the original material. Chapters1, 3 and 5 demonstrate these principles using Pu, Am, Np, and Cs concentrations and isotopic ratios from contaminated soils taken near the Subsurface Disposal Area (SDA) of Idaho National Laboratory (INL) (a low level radioactive waste disposal site in southeastern Idaho).

  7. Extraction of cesium and strontium from nuclear waste

    Davis, Jr., Milton W.; Bowers, Jr., Charles B.


    Cesium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5) [1-hydroxy-2-ethylhexyl]benzo 18-crown-6 compound and a cation exchanger in a matrix solution. Strontium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5') [1-hydroxyheptyl]cyclohexo 18-crown-6 compound, and a cation exchanger in a matrix solution.

  8. Tunable Optical Delay in Doppler-Broadened Cesium Vapor


    REFERENCE: 36 % [1] J. M. Amini and H. Gould 37 % High Precision Measurement of the Static Dipole Polarizability of Cs 38 % Phys. Rev. Lett., American... polarizability of cesium. Phys. Rev. Lett. 91 (15), 153001. Andalkar, A. and R. B. Warrington (2002, Feb). High-resolution measurement of the pressure...Physics Publishing. Morgus, L., T. Morgus, T. Drake, and J. Huennekens (2008). Hyperfine state- changing collisions of Cs (6p1/2) atoms with argon

  9. Electrically switched cesium ion exchange. FY 1997 annual report

    Lilga, M.A.; Orth, R.J.; Sukamto, J.P.H.


    This paper describes the Electrically Switched Ion Exchange (ESIX) separation technology being developed as an alternative to ion exchange for removing radionuclides from high-level waste. Progress in FY 1997 for specific applications of ESIX is also outlined. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution can be controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. Based on the ferrocyanide film capacity, stability, rate of uptake, and selectivity shown during performance testing, it appears possible to retain a consistent rate of removal and elute cesium into the same elution solution over several load/unload cycles. In batch experiments, metal hexacyanoferrate films showed high selectivities for cesium in concentrated sodium solutions. Cesium uptake was unaffected by Na/Cs molar ratios of up to 2 x 10 4 , and reached equilibrium within 18 hours. During engineering design tests using 60 pores per inch, high surface area nickel electrodes, nickel ferrocyanide films displayed continued durability. losing less than 20% of their capacity after 1500 load/unload cycles. Bench-scale flow system studies showed no change in capacity or performance of the ESIX films at a flow rate up to 13 BV/h, the maximum flow rate tested, and breakthrough curves further supported once-through waste processing. 9 refs., 24 figs

  10. Effect of Suez Canal Marine Sediment on Sorption of Cesium

    Hassan, H.B.


    Suez Canal is surrounded by navigation, industrial, agricultural activities and suffers from high rate of population growth that discharging waste into Suez Canal. The Suez Canal coastal waters are influenced by a complex variety of physical, geochemical and biological processes, which influence the behavior, transport and fate of containments released into the marine environment. Sorption of releasing containment such as cesium in Suez Canal water is investigated because of its toxic effect on the marine environment. The object of present study is to determine the effects some of physical and chemical characteristics of collected sediment samples from the three important locations on Suez Canal (Suez Bay, Bitter Lakes and El- Temsah Lake beaches) on sorption behavior of cesium by using batch experiment. Batch experiment was used to study the sorption of the cesium ion. The sorption process is dependent on mineral constituents of Suez Canal sediment and their characteristics. Analytical methods which included particle size and X-ray diffraction (XRD) analyses found that particle size of Suez Canal sediment samples is characterized by sand to fine sand and quartz is the main mineralogical species. Distribution coefficient (K d ) which represent geochemical processes and particle size of these sediment samples effect on the degree of cesium sorption to the sediment. Also (K d ) increase with increase cation exchangeable capacity (CEC). The Suez Canal sediment samples have low (K d ) values which effected by their physical and chemical properties. Sample (2) has highest distribution coefficient (K d ) between measured samples due to containing ratio 30% of fine sand and high ratio of organic matter.

  11. Cesium dihydrophosphate monocrystal growth and certain of their properties

    Rashkovich, L.N.; Meteva, K.B.; Shevchik, Ya.Eh.; Goffman, V.G.; Mishchenko, A.V.


    Crystals of cesium dihydrophosphate (centrisymmetrical, monoclinic, point symmetric group 2/m) are obtained by methods involving solvent evaporation and temperature reduction. At -122 deg C, a ferroelectric phase transition occurs, and at 230 and 265 deg C first-kind transitions, which are not accompanied by composition changes. CsH 2 PO 4 solubility substantially increases with higher medium acidity, and remains approximately constant in alkali medium

  12. Juridical-penal aspects of the cesium-137 accident

    Soares, Carolina Chaves


    The study of the juridical-penal aspects of the Cesium-137 accident, has, as a base, the police inquiry and the penal lawsuit concerning to the episode. Due to the lack of a law which typified activities related with radioisotope material as crime, the responsible were sentenced according to the penalties of body injury crime and homicide. Among the 10 investigated people, only 5 were condemned by the Judiciary and only 4 serve the sentence. (author)

  13. Mechanism of cesium sorption on potassium titanium hexacyanoferrate

    Sun Yongxia; Xu Shiping; Song Chongli


    The mechanism of cesium sorption on potassium titanium hexacyanoferrate is described. The dependence of the sorption speed on temperature, particle granule size, and the stirring speed is studied. The results show that the sorption process is controlled by liquid film diffusion and particle diffusion. An exchange reaction occurs mainly between K + in the exchanger and Cs + in the solution, i.e. potassium titanium hexacyanoferrate, and Cs + of simulated high-level liquid waste

  14. Test procedures and instructions for Hanford tank waste supernatant cesium removal

    Hendrickson, D.W., Westinghouse Hanford


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test using Hanford Double-Shell Slurry Feed supernatant liquor from tank 251-AW-101 in a bench-scale column.Cesium sorbents to be tested include resorcinol-formaldehyde resin and crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-022, Hanford Tank Waste Supernatant Cesium Removal Test Plan.

  15. Test procedures and instructions for Hanford complexant concentrate supernatant cesium removal using CST

    Hendrickson, D.W.


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Complexant Concentrate supernatant liquor from tank 241-AN-107, in a bench-scale column. The cesium sorbent to be tested is crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-023, Hanford Complexant Concentrate Supernatant Cesium Removal Test Plan.

  16. Separation of radio cesium from PUREX feed solution by sorption on composite ammonium molybdo phosphate (AMP)

    Singh, I.J.; Achuthan, P.V.; Jain, S.; Janardanan, C.; Gopalakrishnan, V.; Wattal, P.K.; Ramanujam, A.


    Composite AMP exchanger was developed and evaluated for separation of radio cesium from dissolver solutions of PUREX process using a column experiment. The composite shows excellent sorption of radio cesium from dissolver solutions without any loss of plutonium and uranium. The removal of radio cesium from dissolver solutions will help in lowering the degradation of tri-n-butyl phosphate (TBP) in the solvent extraction process and will also help in reducing the radiation related problems. (author)

  17. The molar enthalpies of solution and vapour pressures of saturated aqueous solutions of some cesium salts

    Apelblat, Alexander; Korin, Eli


    Vapour pressures of water over saturated solutions of cesium chloride, cesium bromide, cesium nitrate, cesium sulfate, cesium formate, and cesium oxalate were determined as a function of temperature. These vapour pressures were used to evaluate the water activities, osmotic coefficients and molar enthalpies of vapourization. Molar enthalpies of solution of cesium chloride, Δ sol H m (T = 295.73 K; m = 0.0622 mol . kg -1 ) = (17.83 ± 0.50) kJ . mol -1 ; cesium bromide, Δ sol H m (T = 293.99 K; m = 0.0238 mol . kg -1 ) = (26.91 ± 0.59) kJ . mol -1 ; cesium nitrate, Δ sol H m (T = 294.68 K; m = 0.0258 mol . kg -1 ) = (37.1 ± 2.3) kJ . mol -1 ; cesium sulfate, Δ sol H m (T = 296.43 K; m = 0.0284 mol . kg -1 ) (16.94 ± 0.43) kJ . mol -1 ; cesium formate, Δ sol H m (T = 295.64 K; m = 0.0283 mol . kg -1 ) = (11.10 ± 0.26) kJ . mol -1 and Δ sol H m (T = 292.64 K; m = 0.0577 mol . kg -1 ) = (11.56 ± 0.56) kJ . mol -1 ; and cesium oxalate, Δ sol H m (T = 291.34 K; m = 0.0143 mol . kg -1 ) = (22.07 ± 0.16) kJ . mol -1 were determined calorimetrically. The purity of the chemicals was generally greater than 0.99 mass fraction, except for HCOOCs and (COOCs) 2 where purities were approximately 0.95 and 0.97 mass fraction, respectively. The uncertainties are one standard deviations

  18. Transition of cesium in food chains [after Chernobyl catastrophe

    Procházka, H.; Brunclík, T.; Jandl, J.; Jirásek, V.; Novosad, J.; Hampl, J.


    An investigation of 25,000 samples of foodstuffs and feedstuffs in Czechoslovakia, contaminated by fall-out cesium after the accident in the Chernobyl nuclear power plant, performed from May 5, 1986 to March 31, 1988, revealed that both the values of cesium transfer-factors in food--animal tissues--milk transitions and the values of biological half-life of cesium are functions of internal and external conditions of contamination. Organism individuality as the main internal condition causes the variance of about +/- 50% of the mean value of the respective transfer-factor. Through the external conditions, mainly the environmental contamination level, type of ingested food and time of ingestion, the mean values of transfer-factors are influenced up to 500%, e.g. to the value of 0.5. But this value converges with growing up contamination of food and environment to the limit of 0.3. The first two to three biological half-lives after the last ingestion of contaminated food are up to ten-times shorter than those at stabilized state

  19. Cesium transfer to agricultural crops for three years after Chernobyl

    Eriksson, A.; Rosen, K.


    In 1986 about 50 farms in the fallout region were selected for sampling at fixed sites of the soil surface layer and of the grassland and grain crops to come. The aim was to cover the different soil types and the farming practices of the region during studies on the transfer levels and on the change with time in transfer of cesium to the crops. It was found that the transfer level, as expected, was much higher for the grassland than for the grain crops. However, within both groups of considerable variation in the transfer level for the same year as measured by the transfer factors has occurred. For the former crops it can be concluded that the transfer factor during year 1 depends on the interception capacity of the plant cover and on the dilution by growth i.e on soil fertility and on fertilization level. In the following years the cesium TF-value for the grass cover was reduced by a factor from 2 to about 10. The reduction rate differed above all between the organic soils and the mineral soils and should largely depend on the type of the grass cover, on the different cesium fixing capacities of the two soil groups and on the potassium fertilization level. On ploughed land the transfer by root uptake to grain crops was about one magnitude lower than the transfer to the hey crops. (orig.)

  20. Mineral-deposit model for lithium-cesium-tantalum pegmatites

    Bradley, Dwight C.; McCauley, Andrew D.; Stillings, Lisa L.


    Lithium-cesium-tantalum (LCT) pegmatites comprise a compositionally defined subset of granitic pegmatites. The major minerals are quartz, potassium feldspar, albite, and muscovite; typical accessory minerals include biotite, garnet, tourmaline, and apatite. The principal lithium ore minerals are spodumene, petalite, and lepidolite; cesium mostly comes from pollucite; and tantalum mostly comes from columbite-tantalite. Tin ore as cassiterite and beryllium ore as beryl also occur in LCT pegmatites, as do a number of gemstones and high-value museum specimens of rare minerals. Individual crystals in LCT pegmatites can be enormous: the largest spodumene was 14 meters long, the largest beryl was 18 meters long, and the largest potassium feldspar was 49 meters long.Lithium-cesium-tantalum pegmatites account for about one-fourth of the world’s lithium production, most of the tantalum production, and all of the cesium production. Giant deposits include Tanco in Canada, Greenbushes in Australia, and Bikita in Zimbabwe. The largest lithium pegmatite in the United States, at King’s Mountain, North Carolina, is no longer being mined although large reserves of lithium remain. Depending on size and attitude of the pegmatite, a variety of mining techniques are used, including artisanal surface mining, open-pit surface mining, small underground workings, and large underground operations using room-and-pillar design. In favorable circumstances, what would otherwise be gangue minerals (quartz, potassium feldspar, albite, and muscovite) can be mined along with lithium and (or) tantalum as coproducts.Most LCT pegmatites are hosted in metamorphosed supracrustal rocks in the upper greenschist to lower amphibolite facies. Lithium-cesium-tantalum pegmatite intrusions generally are emplaced late during orogeny, with emplacement being controlled by pre-existing structures. Typically, they crop out near evolved, peraluminous granites and leucogranites from which they are inferred to be

  1. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan


    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore...

  2. Room temperature deposition of crystalline indium tin oxide films by cesium-assisted magnetron sputtering

    Lee, Deuk Yeon; Baik, Hong-Koo


    Indium tin oxide (ITO) films were deposited on a Si (1 0 0) substrate at room temperature by cesium-assisted magnetron sputtering. Including plasma characteristics, the structural, electrical, and optical properties of deposited films were investigated as a function of cesium partial vapor pressure controlled by cesium reservoir temperature. We calculated the cesium coverage on the target surface showing maximum formation efficiency of negative ions by means of the theoretical model. Cesium addition promotes the formation efficiency of negative ions, which plays important role in enhancing the crystallinity of ITO films. In particular, the plasma density was linearly increased with cesium concentrations. The resultant decrease in specific resistivity and increase in transmittance (82% in the visible region) at optimum cesium concentration (4.24 x 10 -4 Ω cm at 80 deg. C of reservoir temperature) may be due to enhanced crystallinity of ITO films. Excess cesium incorporation into ITO films resulted in amorphization of its microstructure leading to degradation of ITO crystallinity. We discuss the cesium effects based on the growth mechanism of ITO films and the plasma density

  3. Structure of cesium loaded iron phosphate glasses: An infrared and Raman spectroscopy study

    Joseph, Kitheri; Premila, M.; Amarendra, G.; Govindan Kutty, K.V.; Sundar, C.S.; Vasudeva Rao, P.R.


    The structure of cesium loaded iron phosphate glasses (IPG) was investigated using infrared and Raman spectroscopy. The spectra of the cesium doped samples revealed a structural modification of the parent glass owing to the incorporation of cesium. The structural changes could be correlated with the variation observed in the glass transition temperature of these glasses. Increased Cs-mediated cationic cross linking appears to be the reason for the initial rise in glass transition temperature up to 21 mol% Cs 2 O in IPG; while, breakdown of the phosphate network with increasing cesium content, brings down the glass transition temperature.

  4. Cesium Toxicity Alters MicroRNA Processing and AGO1 Expressions in Arabidopsis thaliana.

    Il Lae Jung

    Full Text Available MicroRNAs (miRNAs are short RNA fragments that play important roles in controlled gene silencing, thus regulating many biological processes in plants. Recent studies have indicated that plants modulate miRNAs to sustain their survival in response to a variety of environmental stimuli, such as biotic stresses, cold, drought, nutritional starvation, and toxic heavy metals. Cesium and radio-cesium contaminations have arisen as serious problems that both impede plant growth and enter the food chain through contaminated plants. Many studies have been performed to define plant responses against cesium intoxication. However, the complete profile of miRNAs in plants during cesium intoxication has not been established. Here we show the differential expression of the miRNAs that are mostly down-regulated during cesium intoxication. Furthermore, we found that cesium toxicity disrupts both the processing of pri-miRNAs and AGONOUTE 1 (AGO1-mediated gene silencing. AGO 1 seems to be especially destabilized by cesium toxicity, possibly through a proteolytic regulatory pathway. Our study presents a comprehensive profile of cesium-responsive miRNAs, which is distinct from that of potassium, and suggests two possible mechanisms underlying the cesium toxicity on miRNA metabolism.

  5. Laboratory plant for the separation of cesium from waste solutions of the PUREX process

    Richter, M.; Eckert, B.; Riemenschneider, J.; Mallon, C.; Mann, D.


    A laboratory plant for the separation of cesium from a fission product waste solution of the fuel reprocessing is described. The plant consists of two stages. In the first stage cesium is adsorbed on ammonium molybdatophosphate (AMP). Then the adsorbent is dissolved. From the solution cesium is adsorbed on a cationic ion exchanger in the second stage. Then AMP can be reproduced from this solution. For the elution of cesium in the second stage a NH 4 NO 3 solution (3 m) is used. Flow sheet, construction and the control device of the plant are described and the results of tests with a model solution are given. (author)

  6. Cesium transport in Four Mile Creek of the Savannah River Plant

    Kiser, D.L.


    The behavior of a large radioactive cesium release to a Savannah River Plant (SRP) stream was examined using a stable cesium release to Four Mile Creek. Measurements following the release show that most of the cesium released was transported downstream; however, sorption and desorption decreased the maximum concentration and increased the travel time and duration, relative to a dye tracer, at sampling stations downstream. The study was made possible by the development of an analytical technique using ammonium molybdophosphate and neutron activation that permitted the measurement of stable cesium concentrations as low as 0.2 μg/L

  7. Removal of radioactive cesium from soil by ammonium citrate solution and ionic liquid

    Ishiwata, Shunji; Kitakouji, Manabu; Taga, Atsushi; Ogata, Fumihiko; Ouchi, Hidekazu; Yamanishi, Hirokuni; Inagaki, Masayo


    Radioactive cesium has strongly bound soil as time proceeded, which could not be cleaved in mild condition. We have found that serial treatment of ammonium citrate solution and ionic liquid removed radioactive cesium from soil effectively. The sequence of the treatment is crucial, since inverse serial treatment or mixture of two kinds of solution did not show such an effect, which suggested that ammonium citrate unlocked trapped cesium in soil and ionic liquid solved it. We also found that repeating serial treatment and prolonged treatment time additively removed cesium from soil. (author)

  8. Ion exchange flowsheet for recovery of cesium from purex sludge supernatant at B Plant

    Carlstrom, R.F.


    Purex Sludge Supernatant (PSS) contains significant amounts of 137 Cs left after removal of strontium from fission product bearing Purex wastes. To remove cesium from PSS, an Ion Exchange Recovery system has been set up in Cells 17-21 at B Plant. The cesium that is recovered is stored within B Plant for eventual purification through the Cesium Purification process in Cell 38 and eventual encapsulation and storage in a powdered form at the Waste Encapsulation Storage Facility. Cesium depleted waste streams from the Ion Exchange processes are transferred to underground storage

  9. Desorption of radioactive cesium by seawater from the suspended particles in river water.

    Onodera, Masaki; Kirishima, Akira; Nagao, Seiya; Takamiya, Kouichi; Ohtsuki, Tsutomu; Akiyama, Daisuke; Sato, Nobuaki


    In 2011, the accident at the Fukushima-Daiichi nuclear power plant dispersed radioactive cesium throughout the environment, contaminating the land, rivers, and sea. Suspended particles containing clay minerals are the transportation medium for radioactive cesium from rivers to the ocean because cesium is strongly adsorbed between the layers of clay minerals, forming inner sphere complexes. In this study, the adsorption and desorption behaviors of radioactive cesium from suspended clay particles in river water have been investigated. The radioactive cesium adsorption and desorption experiments were performed with two kinds of suspended particulate using a batch method with 137 Cs tracers. In the cesium adsorption treatment performed before the desorption experiments, simulated river water having a total cesium concentration ([ 133+137 Cs + ] total ) of 1.3 nM (10 -9  mol/L) was used. The desorption experiments were mainly conducted at a solid-to-liquid ratio of 0.17 g/L. The desorption agents were natural seawater collected at 10 km north of the Fukushima-Daiichi nuclear power plant, artificial seawater, solutions of NaCl, KCl, NH 4 Cl, and 133 CsCl, and ultrapure water. The desorption behavior, which depends on the preloaded cesium concentration in the suspended particles, was also investigated. Based on the cesium desorption experiments using suspended particles, which contained about 1000 ng/g loaded cesium, the order of cesium desorption ratios for each desorption agent was determined as 1 M NaCl (80%) > 470 mM NaCl (65%) > 1 M KCl (30%) ≈ seawater (natural seawater and Daigo artificial seawater) > 1 M NH 4 Cl (20%) > 1 M 133 CsCl (15%) ≫ ultrapure water (2%). Moreover, an interesting result was obtained: The desorption ratio in the 470 mM NaCl solution was much higher than that in seawater, even though the Na + concentrations were identical. These results indicate that the cesium desorption mechanism is not a simple ion exchange reaction

  10. Solid state cesium ion guns for surface studies

    Souzis, A.E.; Carr, W.E.; Kim, S.I.; Seidl, M.


    Three cesium ion guns covering the energy range of 5--5000 V are described. These guns use a novel source of cesium ions that combine the advantages of porous metal ionizers with those of aluminosilicate emitters. Cesium ions are chemically stored in a solid electrolyte pellet and are thermionically emitted from a porous thin film of tungsten at the surface. Cesium supply to the emitting surface is controlled by applying a bias across the pellet. A total charge of 10.0 C can be extracted, corresponding to greater than 2000 h of lifetime with an extraction current of 1.0 μA. This source is compact, stable, and easy to use, and produces a beam with >99.5% purity. It requires none of the differential pumping or associated hardware necessary in designs using cesium vapor and porous tungsten ionizers. It has been used in ultrahigh-vacuum (UHV) experiments at pressures of -10 Torr with no significant gas load. Three different types of extraction optics are used depending on the energy range desired. For low-energy deposition, a simple space-charge-limited planar diode with a perveance of 1x10 -7 A/V 3/2 is used. Current densities of 10.0 μA/cm 2 at the exit aperture for energies ≤20 V are typical. This type of source provides an alternative to vapor deposition with the advantage of precise flux calibration by integration of the ion current. For energies from 50 to 500 V and typical beam radii of 0.5 to 0.2 mm, a high perveance Pierce-type ion gun is used. This gun was designed with a perveance of 1x10 -9 A/V 3/2 and produces a beam with an effective temperature of 0.35 eV. For the energy range of 0.5 to 5 keV, the Pierce gun is used in conjunction with two Einzel lenses, enabling a large range of imaging ratios to be obtained. Beam radii of 60 to 300 μm are typical for beam currents of 50 nA to 1.0 μA

  11. Radioactive cesium content in selected food products. Pt. 2. Radioactive cesium in daily food rations of selected population groups

    Skibniewska, K.; Smoczynski, S.S.; Wisniewska, I.


    The content of radioactive cesium isotopes emitting beta radiation was studied in daily food rations analysed in diets of working-class and non-working-class families from food products from the regions of Olsztyn, Poznan, Lublin, Warsaw and Wroclaw in 1987 and 1988. In 1987 the highest level of radioactive cesium was found in the food rations in Olsztyn, and lowest in the rations in Poznan (3.32 and 0.65 Bq/kg respectively). In 1988 higher radiocesium content was found in rations composed according to the data on the diet consumed daily in non-working-class families. In that case the highest content was in the daily food rations composed in Warsaw - 2.35 Bq/kg and lowest in Poznan - 1.19 Bq/kg in the daily food rations of working-class families about one half of that value was found. The calculated means values of both analysed rations were: 1.35 for Olsztyn, 0.89 for Poznan, and 1.86 Bq/kg for Warsaw. The calculated mean value of the contamination with radioactive cesium was in 1988 0.93 Bq/kg for the rations in working-class families (in 1987 it was 1.80 Bq/kg). (author). 15 refs, 1 tab

  12. Rocksalt or cesium chloride: Investigating the relative stability of the cesium halide structures with random phase approximation based methods

    Nepal, Niraj K.; Ruzsinszky, Adrienn; Bates, Jefferson E.


    The ground state structural and energetic properties for rocksalt and cesium chloride phases of the cesium halides were explored using the random phase approximation (RPA) and beyond-RPA methods to benchmark the nonempirical SCAN meta-GGA and its empirical dispersion corrections. The importance of nonadditivity and higher-order multipole moments of dispersion in these systems is discussed. RPA generally predicts the equilibrium volume for these halides within 2.4% of the experimental value, while beyond-RPA methods utilizing the renormalized adiabatic LDA (rALDA) exchange-correlation kernel are typically within 1.8%. The zero-point vibrational energy is small and shows that the stability of these halides is purely due to electronic correlation effects. The rAPBE kernel as a correction to RPA overestimates the equilibrium volume and could not predict the correct phase ordering in the case of cesium chloride, while the rALDA kernel consistently predicted results in agreement with the experiment for all of the halides. However, due to its reasonable accuracy with lower computational cost, SCAN+rVV10 proved to be a good alternative to the RPA-like methods for describing the properties of these ionic solids.

  13. 25 CFR 170.138 - Can roads be built in roadless and wild areas?


    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can be...

  14. Cesium uptake capacity of simulated ferrocyanide tank waste. Interim report FY 1994, Ferrocyanide Safety Project

    Burgeson, I.E.; Bryan, S.A.; Burger, L.E.


    The objective of this project is to determine the capacity for 137 CS uptake by mixed metal ferrocyanides present in Hanford waste tanks, and to assess the potential for aggregation of these 137 CS exchanged materials to form tank ''hot-spots.'' This research, performed at the Pacific Northwest Laboratory (PNL) for the Westinghouse Hanford Company (WHC), stems from concerns of possible localized radiolytic heating within the tanks. If radioactive cesium is exchanged and concentrated by the remaining nickel ferrocyanide present in the tanks, this heating could cause temperatures to rise above the safety limits specified for the ferrocyanide tanks. For the purposes of this study, two simulants, In-Farm-2 and U-Plant-2, were chosen to represent the wastes generated by the scavenging processes. These simulants were formulated using protocols from the original cesium scavenging campaign. Later additions of cesium-rich wastes from various processes also were considered. The simulants were prepared and centrifuged to obtain a moist ferrocyanide sludge. The centrifuged sludges were treated with the original supernate spiked with a known amount of cesium nitrate. After analysis by flame atomic absorption spectrometry, distribution coefficients (K d ) were calculated. The capacity of solid waste simulants to exchange radioactive cesium from solution was examined. Initial results showed that the greater the molar ratio of cesium to cesium nickel ferrocyanide, the less effective the exchange of cesium from solution. The theoretical capacity of 2 mol cesium per mol of nickel ferrocyanide was not observed. The maximum capacity under experimental conditions was 0.35 mol cesium per mol nickel ferrocyanide. Future work on this project will examine the layering tendency of the cesium nickel ferrocyanide species

  15. Recent development on the synthesis of calixcrowns and their application for cesium removal from high-level liquid waste

    Zhu Xiaowen; Gao Jianxun; Wang Jianchen; Yu Bo; Song Chongli


    The synthesis, extraction properties and molecular modeling of calixcrowns in concern of cesium removal is reviewed briefly. In particular, calix [4] crown-6 and some of its derivatives have been shown to be highly selective extractants for cesium ions

  16. 15 CFR 13.8 - Opportunity to comment on proposed Federal financial assistance and direct Federal development.


    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Opportunity to comment on proposed Federal financial assistance and direct Federal development. 13.8 Section 13.8 Commerce and Foreign Trade Office of the Secretary of Commerce INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF COMMERCE PROGRAMS AND ACTIVITIES § 13.8 Opportunity to comment on...

  17. Decorporation of mixture of strontium and cesium isotopes with domestic mineral waters

    Slavov, S.; Filev, G.; Kiradzhiev, G.


    The possibilities of Bulgarian mineral waters to decorporate mixtures of strontium and cesium radioisotopes, simultaneous entering the body, were studied. A modified effect in respect to radioactive strontium was found. Modification of the effect of mixing two diferent types of mineral waters was not proven. No effect was found of potassium-containing mineral water on radioactive cesium kinetics. 1 tab., 7 refs

  18. The effect of fertilizer application on 137 cesium accumulation in lucerne grown on a leached chernozem

    Konstantinov, G.; Kovachev, K.; Penchev, D.; Ermolaev, I.; Mirchev, M.


    On the basis of pot experiments, carried out in a glass-house the following conclusions on the effect of fertilizer application are made: nitrogen fertilizer application increases the amount of radioactive cesium in lucerne plants. Phosphorus fertilizer introduction, similarly to potassium fertilizer application decreases cesium uptake, resulting in an increase in available phosphorus in the soil. (M.Ts.)

  19. SIMS diagnostics of nanometer semiconductor structures with the use of cesium ions

    Pustovit, A.N.; Vyatkin, A.F.


    The modernization of cesium ion source was carried out to increase the lifetime, the power range of primary ions and temporary stability of primary ion beam. The elements depth profiles obtained with the help of primary cesium ions and primary iodine ions are in good agreement with transmission electron microscopy data [ru

  20. Redistribution of strontium and cesium during alteration of smectite to illite

    Ohnuki, Toshihiko; Murakami, Takashi; Sato, Tsutomu; Isobe, Hiroshi


    The redistribution of strontium and cesium during the alteration of smectite to illite has been studied under hydrothermal conditions at 200 C using solutions of 1x10 -4 M Sr and Cs. Two different sorption conditions were applied for the hydrothermal experiments. One was the condition in which strontium and cesium were sorbed by smectite before the hydrothermal experiments (dynamic condition). The other was the condition in which strontium and cesium were sorbed by the alteration products, illite/smectite (I/S) interstratified minerals after the hydrothermal experiments (static condition). The sorption characteristics of strontium and cesium by smectite, I/S interstratified minerals were examined by a sequential extraction method. Most of the strontium was desorbed from smectite and the I/S interstratified minerals with a 1 M KCl solution under both the dynamic and static conditions. Less than 1% of cesium was desorbed from the I/S interstratified minerals with any solution of a 1 M KCl, a 1 M HCl and a 6 M HCl under the dynamic condition, while most of cesium was desorbed with either solution of a 1 M KCl and 1 M HCl from smectite and from the I/S interstratified minerals under the static condition. These suggest that cesium sorbed by smectite changes its sorption characteristic during the alteration process, but strontium does not. Possible sites for more strongly bounded cesium to the I/S interstratified minerals may be at the 'ditrigonal cavity' of adjacent tetrahedral layers. (orig.)

  1. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    Andrello, Avacir C.; Appoloni, Carlos R., E-mail: acandrello@uel.b [Universidade Estadual de Londrina, PR (Brazil). Dept. de Fisica; Araujo, Ednaldo S. [EMBRAPA Agrobiologia, Seropedica, RJ (Brazil); Thomaz, Edivaldo L. [Universidade Estadual do Centro-Oeste - UNICENTRO, Guarapuava, PR (Brazil). Dept. de Geografia; Medeiros, Pedro Henrique Augusto [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia Agricola; Macedo, Iris L. [Universidade de Brasilia (UnB), DF (Brazil). Faculdade de Tecnologia. Dept. de Engenharia Civil e Ambiental


    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 +- 15 Bq.m{sup -2} for South region to 15 +- 2 Bq.m{sup -2} for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  2. Efficient electron injection from solution-processed cesium stearate interlayers in organic light-emitting diodes

    Wetzelaer, G. A. H.; Najafi, A.; Kist, R. J. P.; Kuik, M.; Blom, P. W. M.


    The electron-injection capability of solution-processed cesium stearate films in organic light-emitting diodes is investigated. Cesium stearate, which is expected to exhibit good solubility and film formation due to its long hydrocarbon chain, is synthesized using a straightforward procedure.

  3. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    Andrello, Avacir C.; Appoloni, Carlos R.; Thomaz, Edivaldo L.; Medeiros, Pedro Henrique Augusto; Macedo, Iris L.


    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 ± 15 Bq.m -2 for South region to 15 ± 2 Bq.m -2 for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  4. Cesium-137 uptake studies on ammonium phospho molybdate irradiated with electrons

    Rao, K.L.N.; Balasubramanian, K.R.; Shukla, J.P.


    Ammonium phospho molybdate is an important inorganic ion exchanger having high selectivity for cesium. This paper discusses the effects of electron irradiation to a dose of 1 mGy on this exchanger with special reference to its ion exchange performance using cesium-137 as a tracer. An explanation is attempted for the slight increase in the distribution coefficients. (author). 5 refs., 1 tab

  5. Utilization of cesium-137 environmental contamination from fallout in erosion and sedimentation studies

    Guimaraes, M.F. da; Pessenda, L.C.R.; Fernandes, E.A.N.; Freire, O.; Nascimento Filho, V.F. do; Ferraz, E.S.B.


    The radioactivity of cesium-137 from fallout in different soils profiles for erosion and sedimentation studies are described. The potential of this technique for hydrographic basin in Piracicaba/Sao Paulo is evaluated. Due to the existence of natural radionuclides in soil, with energy near to cesium-137, the soil samples are determined by a high-purity Ge detectors. (author)

  6. The determination of cesium and rubidium in highly radioactive waste liquid

    Wei Songsheng


    Cesium and rubidium in high-level waste liquid were determined by atomic absorption spectrometry with the instrument modified for analyzing radioactive samples. The results show that the method is effective and safe. The error of the method is less than +- 3%, and it has been used in the production of cesium

  7. Using copper hexacyanoferrate (II) impregnated zeolite for cesium removal from radioactive liquid waste

    Fumio, K.; Kenji, M.


    Experiments were performed to obtain fundamental data on cesium ion removal characteristics of metal hexacyanoferrate (II) impregnated zeolite in radioactive liquid waste containing a large amount of sodium sulfate. Copper hexacyanoferrate (II) impregnated zeolite (CuFZ) was prepared and showed a high selectivity for cesium ion. The material was suitable for use in an ion exchange column. This exchanger could selectively and efficiently remove the cesium even if there is 15 wt% Na 2 SO 4 in the solution. Cesium removal ability and stability of CuFZ were excellent over a wide pH range between 1.5 and 10. The cesium ion exchange ability was not influenced by the presence of the alkali metal ions, calcium and magnesium, and carbonate ions even at concentrations 25 times greater than the cesium ion. However, since ammonium ion behaves similarly to cesium ion and interrupts latter ion adsorption, the presence of ammonium ion is not desirable. The CuFZ offers the possibility of separating and removing cesium from liquid wastes produced in facilities handling radioactive materials

  8. Dosage of cesium 137 in radioactive wastes by the application of sodium tetraphenylborate; Dosage du cesium 137 dans les effluents radioactifs par le tetraphenylborate de sodium

    Testemale, G; Girault, J [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires


    A simple technique of the dosage of {sup 137}Cs has been developed. The technique consists in the formation of cesium tetraphenyl borate, followed by a double extraction with isoamyl acetate, and washing of the organic phase. The counting of known parts of the cesium solution assaying of its purity by {gamma} spectrometry enable the determination of the {sup 137}Cs. The yield is about 98 per cent. (authors) [French] Une technique simple du dosage du {sup 137}Cs a ete mise au point. Elle consiste en une double extraction du tetraphenylborate de cesium forme par l'acetate d'isoamyle suivie d'un lavage de la phase organique. Des comptages sur des parties aliquotes de la solution de cesium et un controle de purete par spectrometrie {gamma} permettent la determination de cet element. Rendement: environ 98 pour cent. (auteurs)

  9. Sorption of iodine, chlorine, technetium and cesium in soil

    Soederlund, M.; Lusa, M.; Lehto, J.; Hakanen, M.; Vaaramaa, K.


    The safety assessment of final disposal of spent nuclear fuel will include an estimate for the behavior of waste nuclides in the biosphere. As a part of this estimate also the sorption of radioactive iodine, chlorine, technetium and cesium in soil is to be considered. The chemistry and the sorption of these radionuclides in soils are described in this literature survey. Behavior of I-129, Cl-36 and Tc-99 in the environment is of great interest because of their long half-lives and relatively high mobilities. The importance of Cs-135 arises from its high content in spent nuclear fuel and long physical half-life, even though it is considered relatively immobile in soil. Factors affecting the migration and sorption of radionuclides in soils can be divided into elemental and soil specific parameters. The most important elemental factor is the speciation of the element, which is influenced by the soil redox potential, pH and complex forming ligands. Soil micro-organisms can either serve as sorbents for radionuclides or affect their speciation by altering the prevailing soil redox conditions. Soil organic matter content and mineral properties have a marked influence on the retention of radionuclides. The sorption of anionic radionuclides such as I-, Cl- and TcO 4 - is pronounced in the presence of organic matter. Clay minerals are known to bound cesium effectively. The effect of speciation of radioactive iodine, chlorine, technetium and cesium in soil is considered in this study, as well as the effect of soil micro-organisms, organic matter and mineral properties. (orig.)

  10. Cesium ion exchange using actual waste: Column size considerations

    Brooks, K.P.


    It is presently planned to remove cesium from Hanford tank waste supernates and sludge wash solutions using ion exchange. To support the development of a cesium ion exchange process, laboratory experiments produced column breakthrough curves using wastes simulants in 200 mL columns. To verify the validity of the simulant tests, column runs with actual supernatants are being planned. The purpose of these actual waste tests is two-fold. First, the tests will verify that use of the simulant accurately reflects the equilibrium and rate behavior of the resin compared to actual wastes. Batch tests and column tests will be used to compare equilibrium behaviors and rate behaviors, respectively. Second, the tests will assist in clarifying the negative interactions between the actual waste and the ion exchange resin, which cannot be effectively tested with simulant. Such interactions include organic fouling of the resin and salt precipitation in the column. These effects may affect the shape of the column breakthrough curve. The reduction in column size also may change the shape of the curve, making the individual effects even more difficult to sort out. To simplify the evaluation, the changes due to column size must be either understood or eliminated. This report describes the determination of the column size for actual waste testing that best minimizes the effect of scale-down. This evaluation will provide a theoretical basis for the dimensions of the column. Experimental testing is still required before the final decision can be made. This evaluation will be confined to the study of CS-100 and R-F resins with NCAW simulant and to a limited extent DSSF waste simulant. Only the cesium loading phase has been considered

  11. Cesium-137 inventory of the undisturbed soil areas in the Londrina Region, Parana, Brazil

    Andrello, Avacir C.; Appoloni, Carlos Roberto


    Cesium-137 is an artificial radionuclide introduced in the environment through the radioactive fallout of the superficial tests of nuclear weapons. The cesium-137 deposition occurred to middles of the 1980-decade and, due to the Chernobyl accident, great part of Europe had a additional fallout of cesium-137. The contaminations of this accident do not have reached Southern Hemisphere. Cesium-137 is an alkaline metal, high electropositive, that in contact with the soil is strongly adsorbed to the clay in the FES (Frayed Edge Sites) and RES (Regular Edge Sites) positions, and it movement by chemical processes in the soil is insignificant. Because of this, cesium-137 became a good soil marker, and its movement is related to the soil movement particles, so that the cesium-137 have been used in the study of the soil redistribution processes, as a tool of quantifying the rates of soil losses and gain. To use this methodology, it is necessary the knowledge of the reference inventory of cesium-137, that is given as function of the total concentration of cesium-137 deposited in an area by the radioactive fallout. If a sampling point presents less cesium-137 than the reference inventory, this point is considered a point with soil loss; otherwise, the point is considered a point with soil deposition. To evaluate the cesium-137 inventory in the Londrina region, four areas of the undisturbed soil were sampling in grid of 3x3, with a distance of 9 meters among the points. Of these four sampling areas, three areas were of native forest (labeled Mata1, Mata2 and Mata UEL), and one was a pasture area. Cesium-137 inventory was 223 ± 41 Bq m -2 , 240 ± 65 Bq m -2 and 305 ± 36 Bq m -2 for Mata UEL, Mata1 and Mata2, respectively, and of 211 ± 28 Bq m -2 for the native pasture. Considering the deviation in each value, it is not possible to conclude that there are differences among the values of cesium-137 inventory, so that the average reference inventory of cesium-137 for the

  12. High-current negative hydrogen ion beam production in a cesium-injected multicusp source

    Takeiri, Y.; Tsumori, K.; Kaneko, O.


    A high-current negative hydrogen ion source has been developed, where 16.2 A of the H - current was obtained with a current density of 31 mA/cm 2 . The ion source is a multicusp source with a magnetic filter for negative ion production, and cesium vapor is injected into the arc chamber, leading to enhancement of the negative ion yields. The cesium-injection effects are discussed, based on the experimental observations. Although the surface production of the negative ions on the cesium-covered plasma grid is thought to be a dominant mechanism of the H - current enhancement, the cesium effects in the plasma volume, such as the cesium ionization and the electron cooling, are observed, and could contribute to the improved operation of the negative ion source. (author)

  13. Actual situation of concentration and inventory of radioactive cesium in Matsukawaura Lagoon sediment, Fukushima Prefecture

    Arita, Koichi; Yabe, Tohru; Hayashi, Seiji


    In order to qualitatively evaluate the current status of inventory of radioactive cesium in Matsukawaura Lagoon, profiles of radioactive cesium concentration in sediment cores and sediment characteristics were measured at 36 points. It was shown that sediment characteristics were different even at high concentration of radioactive cesium to the same extent. As a result, the inventory of radioactive cesium were also different. Even at high concentration of radioactive cesium, inventory in southwestern high mud content rate was less than the western. The total inventory of down to 20 cm of sediment throughout Matsukawaura Lagoon was estimated to be about 220 GBq, that more than 80% distributed to 15 cm shallower than has been revealed. (author)

  14. Potassium effect on cesium 137 behaviour in natural waters of contaminated regions (Belarus)

    Kudel'skij, A.V.; Pashkevich, V.I.; Ovsyannikova, S.V.; Petrovich, A.A.; Smit, D.T.


    Very close relationships between cesium 137 activity of water objects (soil solutions, bog and lake water) and their stable potassium contents have been revealed in the contaminated area in south-eastern Belarus. It was revealed the increase of cesium 137 activity in soil solutions and bog ecosystems proportionally with the increase of potassium content. The exponential dependence of cesium 137 activity of fish production was similar to reverse. The coefficient of cesium 137 accumulation in plants was estimated to be reverse connected with the potassium content in soils. So an universal character of these relations and their specificity are of interest when elaborating countermeasures for reducing population dose loads due to cesium 137 water migration

  15. Cesium fallout in Norway after the Chernobyl accident

    Backe, S.; Bjerke, H.; Rudjord, A.L.; Ugletveit, F.


    Results of country-wide measurements of 137 Cs and 134 Cs in soil samples in Norway after the Chernobyl accident are reported. The results clearly demonstrates that municipalities in the central part of southern Norway, Troendelag and the southern part of Nordland, have been rather heavily contaminated. The total fallout of 137 Cs and 134 Cs from the Chernobyl accident in Norway is estimated to 2300 TBq and 1200 TBq, respectively. This is approximately 6% of the cesium activity released from the reactor

  16. Adsorbtion of oxygen and cesium on lanthanum hexaboride

    Gorodetskij, D.A.; Tskhakaya, V.K.; Shchudlo, Yu.G.; Yarygin, V.I.; Yas'ko, A.A.


    Oxygen and cesium adsorption on lanthanum hexaboride was investigated. Especial attention was paid to structural investigations of the LaB 6 (100)-O system. Diffraction pictures and curves of changes in work function in the process of oxygen disorption have been obtained. At oxygen adsorption on a crystal heated up to different temperatures in the range of 900-1400 K the same diffraction pictures as at corresponding annealing temperatures observed were. It is noted that adsorption heat changes slightly in the LaB 6 -O-Cs system

  17. Low-temperature phase transformation in rubidium and cesium superoxides

    Alikhanov, R.A.; Toshich, B.S.; Smirnov, L.S.


    Crystal structures of rubidium and cesium superoxides which are two interpenetrating lattices of metal ions and oxygen molecule ions reveal a number of phase transformations with temperature decrease. Crystal-phase transformations in CsO 2 are 1-2, 2-3 and low temperature one 3-4 at 378, 190 and 10 K. Low temperature transition is considered as the instability of lattice quadrupoles of oxygen molecule ions to phase transformation of the order-disorder type. Calculated temperatures of low temperature phase transformations in PbO 2 and CsO 2 agree with experimental calculations satisfactory [ru

  18. Safety evaluation for packaging (onsite) singly encapsulated cesium chloride capsules

    Smyth, W.W.


    Three nonstandard Waste Encapsulation and Storage Facility (WESF) cesium chloride capsules are being shipped from WESF (225B building) to the 324 building. They would normally be shipped in the Beneficial Uses Shipping System (BUSS) cask under its US Department of Energy (DOE) license (DOE 1996), but these capsules are nonstandard: one has a damaged or defective weld in the outer layer of encapsulation, and two have the outer encapsulation removed. The 3 capsules, along with 13 other capsules, will be overpacked in the 324 building to meet the requirements for storage in WESF's pool

  19. Radiolysis of dilute aqueous solutions of cesium iodide

    Gorbovitskaya, T.I.; Galinkin, D.L.; Kants, L.K.; Tiliks, Yu.E.; Kotelkin, I.M.; Luzanova, L.M.


    Study of physical-chemical processes in the NPP containment by severe accident is carried out. Radiolysis of reactor cooling water containing iodine and cesium radionuclides penetrated therein in the course of accident is considered as of such processes. Role of ionizing radiation in the process of formation and release of ecologically hazardous volatile forms of radioiodine from reactor water into environment is studied. Experiments on radiolysis of CsI diluted water solutions are carried out. The data obtained were used for clarification of radiolysis mechanism for iodine-containing water system, enabling forecast of iodine behaviour in the course of the accident. 5 refs., 4 figs., 1 tab

  20. Sorption of trace cesium on 21 Hanford Site sediment types

    Routson, R.C.; Barney, G.S.; Smith, R.M.; Delegard, C.A.


    Sorption of trace cesium (Cs) was measured on 21 Hanford Site sediment types. A Box-Behnken statistical design was used to develop empirical-statistical equations predicting 137 Cs sorption as a function of the equilibrium concentrations of macroions Na + , K + , and Ca +2 in solution over the concentration ranges of 3.0 to 0.001M, 0.2 to 0.002M, and 0.2 to 0.002M, respectively. These equations are required to estimate trace Cs transport from Hanford ground disposal sites. Average Cs sorption equations for the 21 sediments will be presented and discussed

  1. Magnetite effect in radionuclide retention : cesium, strontium, molybdenum and selenium

    Rovira, M.; Casas, I.; Gimenez, J.; Clarens, F.; Pablo, J. de


    In this work we have investigated the interaction of magnetite with cesium, strontium, molybdenum and selenium, in the frame of radionuclide retention by canister corrosion products. For each radionuclide, the retention on magnetite has been studied as a function of pH and the mass/ volume ratio. The experimental results have been modeled by means of Surface Complexation Models (SCM), that constitute a tool that allows an approach to sorption mechanisms in a wide range of experimental conditions taking into account electrostatic interactions at the mineral-water interface.(Author)

  2. Phase separation of cesium from lead borosilicate glass by heat treatment under a reducing atmosphere

    Xu, Zhanglian; Okada, Takashi, E-mail:; Nishimura, Fumihiro; Yonezawa, Susumu


    Highlights: • Cesium was phase separated from lead borosilicate glass under a reductive atmosphere. • The phase separation occurred on the glass surface that was in contact with the gas. • The leachability of cesium was enhanced by the phase separation. • The degree of such enhancement varied depending on the heat treatment conditions. - Abstract: A phase-separation technique for removing sodium from glass using a heat-treatment method under a reducing atmosphere was previously developed for sodium recovery from waste glass. In this study, this technique was applied to cesium-containing lead borosilicate glass to concentrate the cesium in phase-separated sodium-rich materials for efficient cesium extraction. The theoretical phase-separation temperature of the sodium-rich phase was simulated by thermodynamic equilibrium calculations and was predicted to occur below 700 °C for lead borosilicate glass. Experimentally, a simulated lead borosilicate glass was melted at 1000 °C and subsequently annealed below 700 °C under a CO-containing reducing atmosphere. The phase separation of cesium was found to occur with sodium enrichment on the glass surface that was in contact with the gas phase, promoting cesium extraction from the treated glass using water. The cesium extraction efficiency was affected by the surface area of the treated glass that was in contact with water, and under the examined conditions, the cesium extraction efficiency was up to 66%. Phase separation using reductive heat treatment, combined with a water leaching technique, is suggested to be effective for extracting cesium incorporated in borosilicate glass waste.

  3. Modelling the transport of radioactive cesium released from the Fukushima Dai-ichi NPP with sediments through the hydrologic system

    Kinouchi, T.; Omata, T.; Wei, L.; Liu, T.; Araya, M.


    Due to the accident of the Fukushima Dai-ichi Nuclear Power Plant on March 2011, a huge amount of radionuclides including Cesium-134 and Cesium-137 was deposited over the main island of Japan and the Pacific Ocean, resulting in further transfer and diffusion of Cesium through the atmospheric flow, watershed hydrological processes, and terrestrial ecosystem. Particularly, for the transfer of Cesium-134 and Cesium-137, sediments eroded and transported by the rainfall-runoff processes play an important role as Cesium tends to be strongly adsorbed to soil particles such as clay and silt. In this study, we focus on the transport of sediment and adsorbed Cesium in the watershed-scale hydrologic system to predict the long-term change of distribution of Cesium and its discharge to rivers and ocean. We coupled a physically-based distributed hydrological model with the modules of erosion and transport of sediments and adsorbed Cesium, and applied the coupled model to the Abukuma River watershed, which is located over the area of higher deposition of Cesium. In the model, complex land use and land cover distributions, and the effect of human activities such as irrigation, dam control and urban drainage system are taken into accounts. Simulation was conducted for the period of March 2011 until August 2012, with initial spatial distribution of Cesium-134 and Cesium-137 obtained by the airborne survey. Simulated flow rates and sediment concentrations agreed well with observed, and found that since the accident, two major storms in July and September 2011 transported about 50% of total sediments transported during the simulated periods. Cesium concentration in the sediment was reproduced well except for the difference in the initial periods. This difference is attributable to the uncertainty arisen from the initial distribution of Cesium in the soil and the transfer of Cesium from the forest canopy.

  4. A138

    K. Yurchenko


    Thus, results suggest that vascular disruption in the NDV-treated group indicates the virus ability to directly or indirectly affect tumor angiogenesis and regulate tissue trophism in that way. Understanding how and in which step this effect occurs may provide capacity to use oncolytic NDV strains for therapeutic benefit.

  5. An Experimental Study of the Fluorescence Spectrum of Cesium Atoms in the Presence of a Buffer Gas

    Davydov, V. G.; Kulyasov, V. N.


    A direct experiment is performed to determine the quantum efficiency of a cesium fluorescence filter. The fluorescence spectra of cesium atoms are recorded under excitation of the upper states of the second resonance doublet with a Bell-Bloom cesium lamp. Introduction of different noble gases into the cell with cesium leads to the appearance of additional fluorescence photons. It is found that a fluorescence filter based on atomic cesium vapor with addition of helium in the working cell has the highest efficiency and response rate of all known fluorescence filters based on alkali-metal atomic vapors.

  6. Mobility of radioactive cesium in soil originated from the Fukushima Daiichi nuclear disaster. Application of extraction experiments

    Yoshikazu Kikawada; Takao Oi; Katsumi Hirose; Masaaki Hirose; Atsushi Tsukamoto; Ko Nakamachi; Teruyuki Honda; Hiroaki Takahashi


    Extraction experiments on soil radioactively contaminated by the Fukushima Daiichi Nuclear Power Plant accident were conducted by using a variety of extractants to acquire knowledge on the mobility of radioactive cesium in soil. The experimental results revealed that cesium is tightly bound with soil particles and that radioactive cesium newly deposited on soil due to the accident had apparently a higher mobility than stable cesium commonly existing in soil. The results suggested that radioactive cesium deposited on soil hardly migrates via aqueous processes, although chemical and mineralogical conditions of soil affect their mobility. (author)

  7. A solution for cesium removal from high-salinity acidic or alkaline liquid waste: The crown calix[4]arenes

    Dozol, J.F.; Simon, N.; Lamare, V.; Rouquette, H.; Eymard, S.; Tournois, B.; Marc, D. de; Macias, R.M.


    Calix[4]arenes monocrown or biscrown, blocked in 1,3 alternative cone conformation, display an exceptional efficiency for cesium extraction, even from very acid or alkaline media. Moreover, they possess an important selectivity for cesium over sodium that makes possible the extraction of cesium from media containing high sodium nitrate loadings. Another advantage, since the extraction of cesium is reversible, is that the stripping of cesium can be carried out in deionized water, a property which leads to very high concentration factors. 79 refs., 10 figs., 6 tabs

  8. Morphological and electrical properties of zirconium vanadate doped with cesium

    Marwa F. Elkady


    Full Text Available Cesium doped zirconium vanadate ZrV2O7 with different Cs dopant content (Cs/Zr varied from 0 to 0.5 in weight ratio were fabricated by hydrothermal technique at 120 °C for 60 min. The synthesized materials are thermally treated using microwave technique. The structural and morphological properties of the synthesized materials and thermally treated samples were investigated using XRD and SEM respectively. It was evident that all synthesized specimens have cubic phase structural without any extra phase but after heat treatment Orthorhombic phase appear with doped samples. However, the morphological structure of the doped synthesized materials has transferred from nanoparticles into rods aspect with heat treatment for the different dopant ratio. Moreover, the electrical properties of both the synthesized and thermally treated materials are studied by AC impedance measurements. The results indicated that the ionic conductivity of Cs-doped ZrV2O7 materials decreased by increasing the dopant ratio while that thermally treated samples the ionic conductivity increase by increasing the dopant ratio. Finally, the concentration of cesium dopants is found to play crucial role in tuning the morphology and electrical properties of nanostructures.

  9. Kelvin probe studies of cesium telluride photocathode for AWA photoinjector

    Wisniewski, Eric E., E-mail: [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Velazquez, Daniel [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Yusof, Zikri, E-mail: [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Spentzouris, Linda; Terry, Jeff [Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Sarkar, Tapash J. [Rice University, 6100 Main, Houston, TX 77005 (United States); Harkay, Katherine [Accelerator Science Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States)


    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (≈50nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating. -- Highlights: ► The correlation between Quantum Efficiency (QE) and work function. ► How QE and work function evolve together. ► Rejuvenation of the photocathode via heating and the effect on work function. ► The effects on the work function due to exposure to UV light.

  10. Design alternatives report for the cesium removal demonstration

    Walker, J.F. Jr.; Youngblood, E.L.


    The Cesium Removal Demonstration (CRD) project will use liquid low-level waste (LLLW) stored in the Oak Ridge National Laboratory Melton Valley Storage Tanks to demonstrate cesium removal from sodium nitrate-based supernates. This report presents the results of a conceptual design study to scope the alternatives for conducting the demonstration at ORNL. Factors considered included (1) sorbent alternatives, (2) facility alternatives, (3) process alternatives, (4) process disposal alternatives, and (5) relative cost comparisons. Recommendations included (1) that design of the CRD system move forward based on information obtained to date from tests with Savannah River Resin, (2) that the CRD system be designed so it could use crystalline silicotitanates (CST) if an engineered form of CST becomes available prior to the CRD, (3) that the system be designed without the capability for resin regeneration, (4) that the LLLW solidification facility be used for the demonstration (5) that vitrification of the loaded resins from the CRD be demonstrated at the Savannah River Site, and (6) that permanent disposal of the loaded and/or vitrified resin at the Nevada Test Site be pursued.

  11. Computer simulation of liquid cesium using embedded atom model

    Belashchenko, D K; Nikitin, N Yu


    The new method is presented for the inventing an embedded atom potential (EAM potential) for liquid metals. This method uses directly the pair correlation function (PCF) of the liquid metal near the melting temperature. Because of the specific analytic form of this EAM potential, the pair term of potential can be calculated using the pair correlation function and, for example, Schommers algorithm. Other parameters of EAM potential may be found using the potential energy, module of compression and pressure at some conditions, mainly near the melting temperature, at very high temperature or in strongly compressed state. We used the simple exponential formula for effective EAM electronic density and a polynomial series for embedding energy. Molecular dynamics method was applied with L. Verlet algorithm. A series of models with 1968 atoms in the basic cube was constructed in temperature interval 323-1923 K. The thermodynamic properties of liquid cesium, structure data and self-diffusion coefficients are calculated. In general, agreement between the model data and known experimental ones is reasonable. The evaluation is given for the critical temperature of cesium models with EAM potential

  12. Sorption of cesium on montmorillonite and effect of salt concentration

    Atun, G.; Bilgin, B.; Mardinli, A.


    The sorption behavior of cesium on montmorillonite type[e clay was studied by using radioactivity measurements. Concentrations of Cs + ions ranged from 10 -6 to 10 -2 M. Cesium retention reduced with increasing salt concentration which was varied between 10 -4 and 10 -1 M. Selectivity coefficients K CsNa for the exchange between Cs and Na were calculated for different equivalent fractions of Cs on the solid phase. Using the K CsNa values, free energy change was found to be 7.8 kJ/mol. The data could be fitted to a Freundlich isotherm, and empirical Freundlich parameters enabled the generation of a site distribution function. By fitting the data to the Dubinin-Radushkevich (D-R) isotherm, a mean energy of sorption of 8.6kJ/mole was calculated which corresponds to the energy of ion exchange reactions. The values of energy changes calculated by using two different methods were in good agreement. (author)

  13. Design alternatives report for the cesium removal demonstration

    Walker, J.F. Jr.; Youngblood, E.L.


    The Cesium Removal Demonstration (CRD) project will use liquid low-level waste (LLLW) stored in the Oak Ridge National Laboratory Melton Valley Storage Tanks to demonstrate cesium removal from sodium nitrate-based supernates. This report presents the results of a conceptual design study to scope the alternatives for conducting the demonstration at ORNL. Factors considered included (1) sorbent alternatives, (2) facility alternatives, (3) process alternatives, (4) process disposal alternatives, and (5) relative cost comparisons. Recommendations included (1) that design of the CRD system move forward based on information obtained to date from tests with Savannah River Resin, (2) that the CRD system be designed so it could use crystalline silicotitanates (CST) if an engineered form of CST becomes available prior to the CRD, (3) that the system be designed without the capability for resin regeneration, (4) that the LLLW solidification facility be used for the demonstration (5) that vitrification of the loaded resins from the CRD be demonstrated at the Savannah River Site, and (6) that permanent disposal of the loaded and/or vitrified resin at the Nevada Test Site be pursued

  14. Lasing in robust cesium lead halide perovskite nanowires

    Eaton, Samuel W.; Lai, Minliang; Gibson, Natalie A.; Wong, Andrew B.; Dou, Letian; Ma, Jie; Wang, Lin-Wang; Leone, Stephen R.; Yang, Peidong


    The rapidly growing field of nanoscale lasers can be advanced through the discovery of new, tunable light sources. The emission wavelength tunability demonstrated in perovskite materials is an attractive property for nanoscale lasers. Whereas organic–inorganic lead halide perovskite materials are known for their instability, cesium lead halides offer a robust alternative without sacrificing emission tunability or ease of synthesis. Here, we report the low-temperature, solution-phase growth of cesium lead halide nanowires exhibiting low-threshold lasing and high stability. The as-grown nanowires are single crystalline with well-formed facets, and act as high-quality laser cavities. The nanowires display excellent stability while stored and handled under ambient conditions over the course of weeks. Upon optical excitation, Fabry–Pérot lasing occurs in CsPbBr3 nanowires with an onset of 5 μJ cm−2 with the nanowire cavity displaying a maximum quality factor of 1,009 ± 5. Lasing under constant, pulsed excitation can be maintained for over 1 h, the equivalent of 109 excitation cycles, and lasing persists upon exposure to ambient atmosphere. Wavelength tunability in the green and blue regions of the spectrum in conjunction with excellent stability makes these nanowire lasers attractive for device fabrication. PMID:26862172

  15. Accumulation and mobility of cesium in roots of tulip popular seedlings

    Cox, T.L.


    Tulip poplar, Liriodendron tulipifera L., seedlings were stem-well tagged with cesium, periodically harvested, and separated into root and shoot compartments to determine seasonal cesium distributions in different root-diameter classes and to delineate element pathways to forest soils. The cesium concentration (μCi/g) in roots less than 0.1 cm in diameter averaged 1.5 and 3.0 times greater than in roots in the 0.5- to 0.1-cm- and 1.0- to 0.5-cm-diameter classes, respectively. Roots contained 24 percent of the seedling pool of cesium in 1 week and about 40 percent in 7 weeks after inoculation. Sixty-five percent of the seedling content was in the root system 8 months after tagging. On an annual basis, roots of the less than 0.5-cm-diameter classes contained an average of 36 percent of the seedling pool (root and shoot) and 72 percent of the root pool of cesium. This is important because small roots constituted a considerable portion of the annual turnover in these root systems. Soil content of cesium (3.37 μCi) at the termination of the study and analysis of treatment effects (aboveground inputs to soil allowed or not allowed) indicated that root processes contributed twice as much cesium to the soil during the study period as the combined aboveground processes contributed

  16. Cesium-plasma-conductivity enhancement in the advanced thermionic energy converter. Final report

    Manikopoulos, C.N.

    Two methods of plasma conductivity enhancement in a cesium vapor thermionic energy converter have been studied. The first involved resonance photoabsorption of several cesium lines and the second utilized cesium plasma sustenance by application of microwave power. An extensive study of ionization processes in a cesium discharge in the presence of resonance ionization was made. Calculations were made of expected percentage excitation levels for several cesium resonance transitions for different values of neutral density and temperature as well as incident radiation power levels. The results of some of these computations were tabulated. Several ionization schemes were considered. A number of cesium transitions were investigated in the range of 799 to 870 nanometers for four different cesium reservoir temperatures, 467, 511, 550 and 591 K. The related absorption coefficients of the radiation lines in the plasma were deduced and tabulated. The resulting plasma conductivity increase was recorded and the associated ionization enhancement was deduced. A microwave cavity was built where the emitter and collector of a simple thermionic converter made up two of the cavity walls and resonant microwave power was externally applied. The I-V characteristics of the thermionic converter were studied under several microwave power levels in the range of 0 to 2 watts. Significant shifts to higher currents were observed as the microwave power levels were raised. In conclusion, both methods show promise as auxiliary ionization mechanisms for the thermionic energy converter, especially at low emitter temperatures

  17. Measurements of the cesium flow from a surface-plasma H- ion source

    Smith, H.V.; Allison, P.W.


    A surface ionization gauge (SIG) was constructed and used to measure the Cs 0 flow rate through the emission slit of a surface-plasma source (SPS) of H - ions with Penning geometry. The equivalent cesium density in the SPS discharge is deduced from these flow measurements. For dc operation the optimum H - current occurs at an equivalent cesium density of approx. 7 x 10 12 cm -3 (corresponding to an average cesium consumption rate of 0.5 mg/h). For pulsed operation the optimum H - current occurs at an equivalent cesium density of approx. 2 x 10 13 cm -3 (1-mg/h average cesium consumption rate). Cesium trapping by the SPS discharge was observed for both dc and pulsed operation. A cesium energy of approx. 0.1 eV is deduced from the observed time of flight to the SIG. In addition to providing information on the physics of the source, the SIG is a useful diagnostic tool for source startup and operation

  18. Fast concentration of dissolved forms of cesium radioisotopes from large seawater samples

    Jan Kamenik; Henrieta Dulaiova; Ferdinand Sebesta; Kamila St'astna; Czech Technical University, Prague


    The method developed for cesium concentration from large freshwater samples was tested and adapted for analysis of cesium radionuclides in seawater. Concentration of dissolved forms of cesium in large seawater samples (about 100 L) was performed using composite absorbers AMP-PAN and KNiFC-PAN with ammonium molybdophosphate and potassium–nickel hexacyanoferrate(II) as active components, respectively, and polyacrylonitrile as a binding polymer. A specially designed chromatography column with bed volume (BV) 25 mL allowed fast flow rates of seawater (up to 1,200 BV h -1 ). The recovery yields were determined by ICP-MS analysis of stable cesium added to seawater sample. Both absorbers proved usability for cesium concentration from large seawater samples. KNiFC-PAN material was slightly more effective in cesium concentration from acidified seawater (recovery yield around 93 % for 700 BV h -1 ). This material showed similar efficiency in cesium concentration also from natural seawater. The activity concentrations of 137 Cs determined in seawater from the central Pacific Ocean were 1.5 ± 0.1 and 1.4 ± 0.1 Bq m -3 for an offshore (January 2012) and a coastal (February 2012) locality, respectively, 134 Cs activities were below detection limit ( -3 ). (author)

  19. Preliminary Evaluation of Cesium Distribution for Wet Sieving Process Planned for Soil Decontamination in Japan - 13104

    Enokida, Y.; Tanada, Y.; Hirabayashi, D. [Graduate School of Engineering, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan); Sawada, K. [EcoTopia Science Institute, Nagoya University, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan)


    For the purpose of decontaminating radioactive cesium from a huge amount of soil, which has been estimated to be 1.2x10{sup 8} m{sup 3} by excavating to a 5-cm depth from the surface of Fukushima Prefecture where a severe nuclear accident occurred at TEPCO's power generating site and has emitted a significant amount of radioactive materials, mainly radioactive cesium, a wet sieving process was selected as one of effective methods available in Japan. Some private companies have demonstrated this process for soil treatment in the Fukushima area by testing at their plants. The results were very promising, and a full-fledged application is expected to follow. In the present study, we spiked several aqueous samples containing soil collected from an industrial wet sieving plant located near our university for the recycling of construction wastes with non-radioactive cesium hydroxide. The present study provides scientific data concerning the effectiveness in volume reduction of the contaminated soil by a wet sieving process as well as the cesium distribution between the liquid phase and clay minerals for each sub-process of the full-scale one, but a simulating plant equipped with a process of coagulating sedimentation and operational safety fundamentals for the plant. Especially for the latter aspect, the study showed that clay minerals of submicron size strongly bind a high content of cesium, which was only slightly removed by coagulation with natural sedimentation (1 G) nor centrifugal sedimentation (3,700 G) and some of the cesium may be transferred to the effluent or recycled water. By applying ultracentrifugation (257,000 G), most of submicron clay minerals containing cesium was removed, and the cesium amount which might be transferred to the effluent or recycled water, could be reduced to less than 2.3 % of the original design by the addition of a cesium barrier consisting of ultracentrifugation or a hollow fiber membrane. (authors)

  20. Test procedures and instructions for single shell tank saltcake cesium removal with crystalline silicotitanate

    Duncan, J.B.


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Single Shell Tank Saltcake from tanks 24 t -BY- I 10, 24 1 -U- 108, 24 1 -U- 109, 24 1 -A- I 0 1, and 24 t - S-102, in a bench-scale column. The cesium sorbent to be tested is crystalline siticotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-024, Hanford Single Shell Tank Saltcake Cesium Removal Test Plan.

  1. Historical Cost Curves for Hydrogen Masers and Cesium Beam Frequency and Timing Standards

    Remer, D. S.; Moore, R. C.


    Historical cost curves were developed for hydrogen masers and cesium beam standards used for frequency and timing calibration in the Deep Space Network. These curves may be used to calculate the cost of future hydrogen masers or cesium beam standards in either future or current dollars. The cesium beam standards are decreasing in cost by about 2.3% per year since 1966, and hydrogen masers are decreasing by about 0.8% per year since 1978 relative to the National Aeronautics and Space Administration inflation index.

  2. Effects of mineralogy on sorption of strontium and cesium onto Calico Hills Tuff

    Meyer, R.E.; Arnold, W.D.; Case, F.I.; O'Kelley, G.D.; Land, J.F.


    The sorption properties of tuff formations at the proposed site for the high-level nuclear waste repository at Yucca Mountain, Nevada, have been extensively studied. Sorption and desorption measurements were made of strontium and cesium onto clinoptilolite and Calico Hills Tuff. The object was to see whether there was a correlation between sorption of strontium and cesium onto Calico Hills Tuff and the sorption of strontium and cesium onto clinoptilolite based on the content of clinoptilolite in the Calico Hills Tuff. 13 refs., 10 figs., 6 tabs

  3. Distribution of plutonium and cesium in alluvial soils of the Los Alamos environs

    Nyhan, J.W.; Miera, F.R. Jr.; Peters, R.J.


    The alluvial soils of three liquid waste disposal areas at Los Alamos were sampled to determine plutonium and cesium distributional relationships and correlations with soil physical-chemical properties. Radionuclide concentrations were determined for soil samples as a function of soil depth and distance from the waste outfall. The cesium-plutonium data were correlated with levels of organic carbon, carbonates, exchangeable and water-soluble cations, pH, cation exchange capacity, bulk density, surface area and geometric particle size of these soils. The distribution patterns of soil plutonium and cesium were also compared to the waste use history of the three study areas

  4. Sorption and desorption of cesium and strontium on TA-2 and TA-41 soils and sediments

    Kung, K. Stephen; Li, Benjamin W.; Longmire, P.A.; Fowler, M.M.


    Current environmental monitoring has detected radioactive contaminants in alluvial groundwater, soils, and sediments in the TA-2 and TA-41 areas along the north central edge of Los Alamos National Laboratory. Because of this contamination, this study was initiated. The objective of this study is to quantify the sorptivity of cesium and strontium onto TA-2 and TA-41 site specific soil samples under a controlled environment in the laboratory. The purposes of this work are to determine cesium and strontium sorption coefficient for these sit specific soils and to evaluate the potential transport of cesium and strontium. Based on this information, a risk assessment and remediation strategy can be developed

  5. High voltage holding in the negative ion sources with cesium deposition

    Belchenko, Yu.; Abdrashitov, G.; Ivanov, A.; Sanin, A.; Sotnikov, O., E-mail: [Budker Institute of Nuclear Physics, Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation)


    High voltage holding of the large surface-plasma negative ion source with cesium deposition was studied. It was found that heating of ion-optical system electrodes to temperature >100 °C facilitates the source conditioning by high voltage pulses in vacuum and by beam shots. The procedure of electrode conditioning and the data on high-voltage holding in the negative ion source with small cesium seed are described. The mechanism of high voltage holding improvement by depletion of cesium coverage is discussed.

  6. Advance in the study of removal of cesium from radioactive wastewater by inorganic ion exchangers

    Wang Songping; Wang Xiaowei; Du Zhihui


    The excellent performance in the removal of cesium from radioactive wastewater by inorganic ion exchangers has received extensive attention due to their characteristic physico-chemical features. The paper summarized research progress of removal of cesium by different inorganic ion exchangers such as silicoaluminate, salts of hetero polyacid, hexacyanoferrate, insoluble salts of acid with multivalent metals, insoluble hydrous oxides of multivalent metals and silicotitanate and reviewed several removal systems of cesium by inorganic ion exchangers which might offer China some reference in treatment and disposal of radioactive wastewater. (authors)

  7. Summary report on partitioning cesium from the Chinese high level liquid waste(HLLW) by calixcrown

    Wang Jianchen; Chen Jing


    The partitioning of Cesium from the HLLW with a higher-salts liquid from PUREX is a better choice for its further treatment or disposal. In this work, the progress of partitioning Cesium from the Chinese HLLW by 25,27-bis(2-propyloxy) calix[4]-26,28-crown-6(iPr-C[4]C-6) were introduced, including the synthesis method of calixcrown, selection of diluents, extraction properties, the radiolytic stability, cold test and hot test of cascade extraction for removing cesium from HLLW. (author)

  8. 28 CFR 0.138 - Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco...


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco, Firearms, and Explosives, Bureau of Prisons, Federal... Administrative Matters § 0.138 Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of...

  9. Analysis on metallogenetic geological and physicochemical conditions in uranium deposit No.138

    Tang Qitao


    The uranium deposit No.138 is of Mesozoic volcano-sedimentary transformation type. This paper discusses such geological conditions as source of uranium, stratigraphy and lithology, lithofacies and paleogeography, paleoclimate, structure and reworking-regeneration, and such physicochemical conditions as uranium adsorbent and reductant, effective porosity, chemical compositions, pH and Eh of rocks in the deposit

  10. Down-regulation of human cytomegalovirus UL138, a novel latency ...


    Jul 12, 2013 ... observed a 74.6% decrease in luciferase activity and a 46.2% decrease in HCMV UL138 protein expression. Our .... Trizol agent (Takara, Dalian, China), according to the man- ... hybrid primer and polyA structure were found in the se- quence. ..... resolution profiling and analysis of viral and host small RNAs.

  11. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  12. Radioactive and Stable Cesium Distributions in Fukushima Forests

    Ioshchenko, V.; Kivva, S.; Konoplev, A.; Nanba, K.; Onda, Y.; Takase, T.; Zheleznyak, M.


    Fukushima Dai-ichi NPP accident has resulted in release into the environment of large amounts of 134Cs and 137Cs and in radioactive contamination of terrestrial and aquatic ecosystems. In Fukushima prefecture up to 2/3 of the most contaminated territory is covered with forests, and understanding of its further fate in the forest ecosystems is essential for elaboration of the long-term forestry strategy. At the early stage, radiocesium was intercepted by the trees' canopies. Numerous studies reported redistribution of the initial fallout in Fukushima forests in the followed period due to litterfall and leaching of radiocesium from the foliage with precipitations. By now these processes have transported the major part of deposited radiocesium to litter and soil compartments. Future levels of radiocesium activities in the aboveground biomass will depend on relative efficiencies of the radiocesium root uptake and its return to the soil surface with litterfall and precipitations. Radiocesium soil-to-plant transfer factors for typical tree species, soil types and landscape conditions of Fukushima prefecture have not been studied well; moreover, they may change in time with approaching to the equilibrium between radioactive and stable cesium isotopes in the ecosystem. The present paper reports the results of several ongoing projects carried out by Institute of Environmental Radioactivity of Fukushima University at the experimental sites in Fukushima prefecture. For typical Japanese cedar (Cryptomeria japonica) forest, we determined distributions of radiocesium in the ecosystem and in the aboveground biomass compartments by the end of 2014; available results for 2015 are presented, too, as well as the results of test application of D-shuttle dosimeters for characterization of seasonal variations of radiocesium activity in wood. Based on the radiocesium activities in biomass we derived the upper estimates of its incorporation and root uptake fluxes, 0.7% and 3% of the total

  13. Semaphorin 4C Protects against Allergic Inflammation: Requirement of Regulatory CD138+ Plasma Cells.

    Xue, Di; Kaufman, Gabriel N; Dembele, Marieme; Beland, Marianne; Massoud, Amir H; Mindt, Barbara C; Fiter, Ryan; Fixman, Elizabeth D; Martin, James G; Friedel, Roland H; Divangahi, Maziar; Fritz, Jörg H; Mazer, Bruce D


    The regulatory properties of B cells have been studied in autoimmune diseases; however, their role in allergic diseases is poorly understood. We demonstrate that Semaphorin 4C (Sema4C), an axonal guidance molecule, plays a crucial role in B cell regulatory function. Mice deficient in Sema4C exhibited increased airway inflammation after allergen exposure, with massive eosinophilic lung infiltrates and increased Th2 cytokines. This phenotype was reproduced by mixed bone marrow chimeric mice with Sema4C deficient only in B cells, indicating that B lymphocytes were the key cells affected by the absence of Sema4C expression in allergic inflammation. We determined that Sema4C-deficient CD19 + CD138 + cells exhibited decreased IL-10 and increased IL-4 expression in vivo and in vitro. Adoptive transfer of Sema4c -/- CD19 + CD138 + cells induced marked pulmonary inflammation, eosinophilia, and increased bronchoalveolar lavage fluid IL-4 and IL-5, whereas adoptive transfer of wild-type CD19 + CD138 + IL-10 + cells dramatically decreased allergic airway inflammation in wild-type and Sema4c -/- mice. This study identifies a novel pathway by which Th2-mediated immune responses are regulated. It highlights the importance of plasma cells as regulatory cells in allergic inflammation and suggests that CD138 + B cells contribute to cytokine balance and are important for maintenance of immune homeostasis in allergic airways disease. Furthermore, we demonstrate that Sema4C is critical for optimal regulatory cytokine production in CD138 + B cells. Copyright © 2016 by The American Association of Immunologists, Inc.

  14. Prompt and delayed excitation and photolysis of cesium dimers

    Davanloo, F.; Collins, C.B.; Inamdar, A.S.; Mehendale, N.Y.; Nagvi, A.S.


    In this work a time-delayed, double resonance technique was used for the study of the state selective photolysis of Cs 2 excited in the yellow range of visible wavelengths. Particular attention being placed on the production of the fine structure components of the 5 2 D and 6 2 P states of Cs and upon the lifetimes of the product populations in the cesium vapor. A quantitative model was constructed to fit the data and rate coefficients were extracted for processes tending to attenuate the product state selectivity. Reported here is what appears to be the first value for the fine-structure mixing cross section for Cs(5 2 D5/2 → 5 2 D 3 /sub 3/2/) of 17 A 2 +-50%, close to the geometric cross section

  15. Mass spectrometric study of vaporization of cesium tellurate and tellurite

    Semenov, G.A.; Fokina, L.A.; Mouldagalieva, R.A.


    The process of vaporization of cesium tellurate and tellurite was studied by the Knudsen effusion method with a mass spectrometric analysis of the vapor composition. The thermal dissociation of Cs 2 TeO 4 to Cs 2 TeO 3 and the congruent vaporization of Cs 2 TeO 3 were established. Thermodynamic functions for gaseous Cs 2 TeO 3 have been calculated. The standard enthalpy of sublimation Δ s H (298.15)=268.1±13.0 kJ mol -1 was determined by the 2nd and 3rd laws of thermodynamics. The enthalpy of formation Δ f H (298.15)=-725.1±13.0 kJ mol -1 for gaseous Cs 2 TeO 3 and the enthalpy of atomization Δ at H (298.15)=1841.3±15.0 kJ mol -1 have been computed. ((orig.))

  16. Cesium-137 accident lessons in Goiania, Goias State, Brazil


    This document relates the experience obtained by several professionals which had an important role in the cesium-137 accident occurred in Goiania, Goias State, Brazil in September, 1987. It's divided into chapters, according to the action area - medical, nursing, social assistance, odontological and psychological. At first, some notions of radioprotection are explained, followed by the accident history and by the doctors and nurses action during the emergency phase and the medical, odontological, social and psychological assistance to the victims. The social assistance report shows some statistical data about the economic, occupational and social conditions of the accident victims. It is shown some information about the health institutions and the sanitary care in the ionizing radiation and about the occupational radiological protection in Goiania

  17. Cesium-137 body burden in Japanese from 1967 to 1975

    Anzai, I; Ueda, K; Togo, M [Tokyo Univ. (Japan). Faculty of Medicine


    Cesium-137 concentrations in Japanese male adults were measured monthly during 1967 to 1975 by whole body counting. The /sup 137/Cs content decreased rapidly until 1968, then the reduction rate was considerably decelerated, being probably affected by the French and Chinese nuclear testing. A small rise was observed at the end of 1970, and its causes have been multilaterally studied from the radioecological viewpoints, which has not resulted in a clearcut conclusion. Daily intake estimated from body burden varies in a wide range but, on the average, agrees well with the reported values based on the radiochemical analyses of foods. The integrated absorbed dose from January 1967 to April 1975 is calculated to be 2.5 mrads. The authors re-emphasize the importance of the periodic measurement of human population.

  18. Trade study for the disposition of cesium and strontium capsules

    Claghorn, R.D.


    This trade study analyzes alternatives for the eventual disposal of cesium and strontium capsules currently stored at the Waste Encapsulation and Storage Facility as by-product. However, for purposes of this study, it is assumed that at some time in the future, the capsules will be declared high-level waste and therefore will require disposal at an offsite geologic repository. The study considered numerous alternatives and selected three for detailed analysis: (1) overpack and storage at high-level waste canister storage building, (2) overpack at the high-level waste vitrification facility followed by storage at a high-level waste canister storage building, and (3) blend capsule contents with other high-level waste feed streams and vitrify at the high-level waste vitrification facility

  19. Solution-Phase Synthesis of Cesium Lead Halide Perovskite Nanowires.

    Zhang, Dandan; Eaton, Samuel W; Yu, Yi; Dou, Letian; Yang, Peidong


    Halide perovskites have attracted much attention over the past 5 years as a promising class of materials for optoelectronic applications. However, compared to hybrid organic-inorganic perovskites, the study of their pure inorganic counterparts, like cesium lead halides (CsPbX3), lags far behind. Here, a catalyst-free, solution-phase synthesis of CsPbX3 nanowires (NWs) is reported. These NWs are single-crystalline, with uniform growth direction, and crystallize in the orthorhombic phase. Both CsPbBr3 and CsPbI3 are photoluminescence active, with composition-dependent temperature and self-trapping behavior. These NWs with a well-defined morphology could serve as an ideal platform for the investigation of fundamental properties and the development of future applications in nanoscale optoelectronic devices based on all-inorganic perovskites.

  20. Diffusion of water, cesium and neptunium in pores of rocks

    Puukko, E.; Heikkinen, T.; Hakanen, M.


    Teollisuuden Voima Oy (TVO) is investigating the feasibility to dispose of spent nuclear fuel within Finland. The present plan calls for the repository to be located in crystalline rock at a depth of several hundred meters. The safety assessment of the repository includes calculations of migration of waste nuclides. The flow of waste elements in groundwater will be retarded through sorption interaction with minerals and through diffusion into rock. Diffusion is the only mechanism retarding the migration of non-sorbing species and, it is expected to be the dominating retardation mechanism of many of the sorbing elements. In the investigation the simultaneous diffusion of tritiated water (HTO), cesium and neptunium in rocks of TVO investigation sites at Kivetty, Olkiluoto and Romuvaara were studied. (11 refs., 33 figs., 9 tabs.)

  1. Estimating soil erosion losses in Korea with fallout cesium-137

    Menzel, R.G.; Pilkyun Jung; Kwanshig Ryu; Kitai Um


    The contents of fallout 137 Cs in soil profiles were used to estimate erosion losses from steeply sloping croplands in Korea. Seven undisturbed sites with no apparent erosion or deposition, and 15 cropland sites were examined to a depth of 30 cm. The cropland sites had been cultivated for periods ranging from 5 to more than 80 y (median 10 y), and their slopes ranged from 5 to 26% (median 13%). All except one of the cropland sites contained less 137 Cs than undisturbed sites in the same area. Three cropland sites contained essentially no 137 Cs, indicating erosion of the entire cultivated layer of soil in from 6 to 10 years. Other cropland sites, particularly those with sandy texture, showed little loss of 137 Cs over longer periods of cultivation. Cesium-137 measurements may be useful in identifying site characteristics that reduce the vulnerability of sloping soils to erosion damage. (author)

  2. Photoinduced charge transfer phase transition in cesium manganese hexacyanoferrate

    Matsuda, Tomoyuki; Tokoro, Hiroko; Hashimoto, Kazuhito; Ohkoshi, Shin-ichi


    Cesium manganese hexacyanoferrate, Cs 1.51 Mn[Fe(CN) 6 ], shows a thermal phase transition between Mn II -NC-Fe III [high-temperature (HT) phase] and Mn III -NC-Fe II [low-temperature (LT) phase] with phase transition temperatures of 170 K (HT→LT) and 230 K (LT→HT). The LT phase shows ferromagnetism with Curie temperature of 7 K and coercive field of 60 Oe. Irradiating with 532 nm laser light converts the LT phase into the photoinduced (PI) phase, which does not have spontaneous magnetization. The electronic state of the PI phase corresponds to that of the HT phase and the relaxation temperature from the PI to the LT phase is observed at 90 K

  3. Hyperfine relaxation of an optically pumped cesium vapor

    Tornos, J.; Amare, J.C.


    The relaxation of hyperfine orientation indirectly induced by optical pumping with a σ-polarized D 1 -light in a cesium vapor in the presence of Ar is experimentally studied. The detection technique ensures the absence of quadrupole relaxation contributions in the relaxation signals. The results from the dependences of the hyperfine relaxation rate on the temperature and argon pressure are: diffusion coefficient of Cs in Ar, D 0 = 0.101 +- 0.010 cm 2 s -1 at 0 0 C and 760 Torr; relaxation cross section by Cs-Ar collisions, σ/sub c/ = (104 +- 5) x 10 -23 cm 2 ; relaxation cross section by Cs-Cs (spin exchange) collisions, σ/sub e//sub x/ = (1.63 +- 0.13) x 10 -14 cm 2

  4. Quality assurance program plan for cesium legacy project

    Tanke, J.M.


    This Quality Assurance Program Plan (QAPP) provides information on how the Quality Assurance Program is implemented for the Cesium Legacy Project. It applies to those items and tasks which affect the completion of activities identified in the work breakdown structure of the Project Management Plan (PMP). These activities include all aspects of cask transportation, project related operations within the 324 Building, and waste management as it relates to the specific activities of this project. General facility activities (i.e. 324 Building Operations, Central Waste Complex Operations, etc.) are covered in other appropriate QAPPs. The 324 Building is currently transitioning from being a Pacific Northwest National Laboratory (PNNL) managed facility to a B and W Hanford Company (BWHC) managed facility. During this transition process existing PNNL procedures and documents will be utilized until replaced by BWHC procedures and documents

  5. Decreasing radioactive cesium in lodged buckwheat grain after harvest

    Katashi Kubo


    Full Text Available This study assessed soil contamination with high radioactive cesium (R–Cs concentration in buckwheat grains by lodging, and assessed the possibility of R–Cs reduction in grain through post-harvest preparation. Analysis of buckwheat grain produced in farmers’ fields and reports from farmers indicated that grain from fields that had lodging showed higher R–Cs than grain from fields with no lodging. A field experiment demonstrated that R–Cs in grain after threshing and winnowing (TW was about six times higher in lodged plants than in nonlodged plants. In lodged plants, R–Cs in grain was decreased to about one-fourth by polishing, and was decreased to about one-seventh by ultrasonic cleaning, compared with R–Cs in grain after TW. These results demonstrate that R–Cs of buckwheat grain of lodged plants can be decreased by removing soil from the grain surface by polishing and winnowing.

  6. Norbadione A: synthetic approach and cesium complexation studies

    Desage - El Murr, M.


    This work was dedicated to the study of the synthesis and complexation studies of norbadione A: a pigment originating from a mushroom. A synthetic approach, based on a double Suzuki-Miyaura coupling, was developed. This strategy was applied with high yields to the synthesis of various norbadione A analogues, as well as to the synthesis of simple pulvinic acids. Access to functionalized precursors of the molecule was also studied and the final coupling remains to be done. Besides, a speciation study based on electro-spray ionization mass spectrometry was conducted with norbadione A and one of the analogues. This study allowed the assessment of the cesium complexation abilities of each molecule. Structural data was also obtained and complexation constants were calculated. Finally, norbadione A and various synthetic products have been tested via high-throughput screening methods and strong antioxidant properties were observed. Other biological results are also reported. (author)

  7. Vitrification of cesium-contaminated organic ion exchange resin

    Sargent, T.N. Jr.


    Vitrification has been declared by the Environmental Protection Agency (USEPA) as the Best Demonstrated Available Technology (BDAT) for the permanent disposal of high-level radioactive waste. Savannah River Site currently uses a sodium tetraphenylborate (NaTPB) precipitation process to remove Cs-137 from a wastewater solution created from the processing of nuclear fuel. This process has several disadvantages such as the formation of a benzene waste stream. It has been proposed to replace the precipitation process with an ion exchange process using a new resorcinol-formaldehyde resin developed by Savannah River Technical Center (SRTC). Preliminary tests, however, showed that problems such as crust formation and a reduced final glass wasteform exist when the resin is placed in the melter environment. The newly developed stirred melter could be capable of overcoming these problems. This research explored the operational feasibility of using the stirred tank melter to vitrify an organic ion exchange resin. Preliminary tests included crucible studies to determine the reducing potential of the resin and the extent of oxygen consuming reactions and oxygen transfer tests to approximate the extent of oxygen transfer into the molten glass using an impeller and a combination of the impeller and an external oxygen transfer system. These preliminary studies were used as a basis for the final test which was using the stirred tank melter to vitrify nonradioactive cesium loaded organic ion exchange resin. Results from this test included a cesium mass balance, a characterization of the semi-volatile organic compounds present in the off gas as products of incomplete combustion (PIC), a qualitative analysis of other volatile metals, and observations relating to the effect the resin had on the final redox state of the glass

  8. Ion-exchange properties of cesium and strontium into zeolites from sodium salt solutions

    Kanno, Takuji; Hashimoto, Hiroyuki; Ohtani, Tozo.


    The ion-exchange properties of cesium and strontium into zeolite from sodium salt solution has been studied in zeolite A, zeolite X, zeolite Y, mordenite and clinoptilolite. The distribution of cesium into mordenite from about 1 -- 2 M sodium chloride and sodium hydroxide solutions is considerably larger than that into zeolite A. The distribution coefficient for 2 M solution of sodium salts was about 300. Therefore, the separation of cesium from sodium salt solution is possible by using mordenite. The distribution of strontium into zeolites form 1 -- 2 M solutions of sodium chloride and sodium nitrate were in the order of zeolite A>zeolite X>zeolite Y asymptoticaly equals mordenite. The distribution coefficient of 230 was obtained for 1 M solutions of sodium salts. The anion in solutions had no effect on the distribution of cesium and strontium into zeolite from sodium salt solution. (author)

  9. Efficiency of Dry (Psidium guava) Leaves for The Removal of Cesium-137 from Aqueous Solutions

    Omar, H.A.; Abu-Kharda, S.A.; Abd El -Baset, L.A.; Abu-Shohba, R.M.


    Batch experiments for the removal of cesium-137 from aqueous solution onto guava leaves (psidium guava) and carbonized guava leaves were studied as a function of contact time, dosage, ph value and initial concentration ion. The sorption process was described by pseudo first-order, pseudo second-order, Morris and Elovich kinetic models. Cesium concentrations were ranged between 2x10 -5 - 1x10 -3 M. Sorption data have been interpreted in terms of Langmuir, Freundlich and Dubinin-Radushkevich isotherms. The maximum sorption capacity of carbonized guava leaves adsorbent for cesium removal was 8.02 mgg -1 . The results of the present study suggest that carbonized guava leaves can be used beneficially for cesium removal from aqueous solution.

  10. Strontium-90 and cesium-137 in milk (consuming districts) (from May. 1982 to Mar. 1983)


    Strontium-90 and cesium-137 in milk (consuming districts from May 1982 to Mar. 1983) were determined. Commercial milk was purchased in 25 consuming districts. The results are shown in a table. (J.P.N.)

  11. End-of-Life Indicators for NIMA's High-Performance Cesium Frequency Standards

    Brock, C; Tolman, B. W; Taylor, R. E


    .... The mean lifetime of the cesium-beam tube (CBT) is approximately 6 years; failure or end-of-life of the CBT is a significant cause in the reduction of data used to produce the NIMA GPS precise ephemeris...

  12. Biological effects of cesium-137 injected in beagle dogs of different ages

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others


    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.


    Smith, F.; Hamm, Luther; Aleman, Sebastian; Michael, Johnston


    The performance of spherical Resorcinol-Formaldehyde ion-exchange resin for the removal of cesium from alkaline radioactive waste solutions has been investigated through computer modeling. Cesium adsorption isotherms were obtained by fitting experimental data using a thermodynamic framework. Results show that ion-exchange is an efficient method for cesium removal from highly alkaline radioactive waste solutions. On average, two 1300 liter columns operating in series are able to treat 690,000 liters of waste with an initial cesium concentration of 0.09 mM in 11 days achieving a decontamination factor of over 50,000. The study also tested the sensitivity of ion-exchange column performance to variations in flow rate, temperature and column dimensions. Modeling results can be used to optimize design of the ion exchange system

  14. Ability of phytoremediation for absorption of strontium and cesium from soils using Cannabis sativa

    Parisa Seyed Hoseini


    Conclusion: Our findings suggest that strontium can be absorbed by Cannabis sativa, with the highest absorption by the roots, stems, and leaves. However, cesium does not reach the plant because of its single capacity and inactive complex formation.

  15. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    Peterson, R.A.


    This report contains the results from a study requested by High Level Waste Division on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na+] increased the rate at which cesium tetraphenylborate (KTPB) in the presence of high [Na+] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice

  16. Total deposition of cesium-137 measured in Finland during the exercise 'RESUME 95' in August 1995

    Geer, L.E. De; Vintersved, I.; Arntsing, R.


    In the exercise called 'RESUME 95' the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au)

  17. New separation techniques of cesium by redox type ion exchange materials

    Tanihara, Koichi


    RIECS method, new cesium separation method, was developed in which a porous strong base anionic exchanger with copper ferrocyanide (CuFC) and inhibitor were used. Cesium could be separated from the high concentration nitric solution. By developing new impregnation method, large amount of CuFC was impregnated into the micropolar porous resin and silica gel pores. KFC adhered to outside of pores was recovered. Good complex with CuFC was prepared by use of copper chloride in ethyl alcohol solution. The adsorption ratio of cesium increased radically to 80% level in the very small range of hydrazine concentration 1.7 to 2.4x10 -4 M. The adsorption-desorption ratio of cesium did not decrease by repeating it seven times. The glassificated materials decreased large amount of γ-ray unless increase of volume could be produced by built RIECS method in the high level waste processing system. (S.Y.)

  18. Investigations of the sorption of cesium from acid solutions by various inorganic sorbents

    Suess, M.; Pfrepper, G.


    Studies have been made to investigate the suitability of various inorganic sorbents for separating and obtaining cesium from acid solutions. In greater details, the distribution coefficients of cesium from nitric acid and ammonium nitrate solution were determined. To determine the saturation capacities it was necessary to plot the isotherms of adsorption from 0.5 N and 3.1 N nitric acid. Experimental sorption from a model solution, of which the composition was equal to that of the liquid Purex waste, enabled the suitability of the various exchangers for obtaining cesium from fission product solutions to be determined. From the results obtained it is apparent that ammonium phosphomolybdate is best suited for obtaining cesium from acid fission product solutions. (orig.)

  19. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Geer, L.E. De; Vintersved, I.; Arntsing, R. [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)


    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  20. Efficient non-linear two-photon effects from the Cesium 6D manifold

    Haluska, Nathan D.; Perram, Glen P.; Rice, Christopher A.


    We report several non-linear process that occur when two-photon pumping the cesium 6D states. Cesium vapor possess some of the largest two-photon pump cross sections in nature. Pumping these cross sections leads to strong amplified spontaneous emission that we observe on over 17 lasing lines. These new fields are strong enough to couple with the pump to create additional tunable lines. We use a heat pipe with cesium densities of 1014 to 1016 cm-3 and 0 to 5 Torr of helium buffer gas. The cesium 6D States are interrogated by both high energy pulses and low power CW sources. We observe four-wave mixing, six-wave mixing, potential two-photon lasing, other unknown nonlinear processes, and the persistence of some processes at low thresholds. This system is also uniquely qualified to support two-photon lasing under the proper conditions.

  1. Studies on the synthesis and characterization of cesium-containing iron phosphate glasses

    Joseph, Kitheri; Govindan Kutty, K. V.; Chandramohan, P.; Vasudeva Rao, P. R.


    Isotopes of cesium and strontium can be utilized as radiation source for various industrial and medical applications after their separation from high level nuclear waste. However, these elements need to be immobilized in a suitable matrix. In the present work, a systematic approach has been made to immobilize inactive cesium into iron phosphate glass. Up to 36 mol% of Cs 2O has been loaded successfully without crystallization. The glass transition temperature of the cesium loaded glass was found to increase initially and then decrease as a function of Cs 2O content. Mössbauer studies show that the concentration of Fe 3+ ions in the cesium loaded glasses is >95%. Volatilization experiments at 1263 K show that the weight loss is >0.5% for a period of 4 h. The 36 mol% of Cs 2O loaded iron phosphate glass with high Fe 3+ content described in this paper is reported for the first time.

  2. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium.

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru


    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. Strontium-90 and cesium-137 in milk (consuming districts) (from May 1982 to Aug. 1982)


    Strontium-90 and cesium-137 in milk (consuming districts from May to Aug. 1982) were determined. Commercial milk was purchased in 20 consuming districts. The results are shown in a table. (Namekawa, K.)

  4. Biological effects of cesium-137 injected in beagle dogs of different ages

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C.


    The toxicity of cesium-137 ( 137 Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of 137 Cs are important to understand because 137 Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy

  5. IceBridge Scintrex CS-3 Cesium Magnetometer L1B Geolocated Magnetic Anomalies, Version 1

    National Aeronautics and Space Administration — The NASA IceBridge Scintrex CS-3 Cesium Magnetometer L1B Geolocated Magnetic Anomalies (IMCS31B) data set contains magnetic field readings taken over Greenland using...

  6. IceBridge Scintrex CS-3 Cesium Magnetometer L0 Raw Magnetic Field, Version 1

    National Aeronautics and Space Administration — The NASA IceBridge Scintrex CS-3 Cesium Magnetometer L0 Raw Magnetic Field data set contains magnetic field readings and fluxgate values taken over Greenland using...

  7. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Geer, L.E. De; Vintersved, I; Arntsing, R [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)


    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  8. MicroRNA-138 is a potential regulator of memory performance in humans

    Julia eSchröder


    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  9. Cesium relocation in mixed-oxide fuel pins resulting from increased temperature reirradiation

    Lawrence, L.A.; Woodley, R.E.; Weber, E.T.


    Mixed-oxide fuel pins from EBR-II test subassemblies PNL-3 and PNL-4 were reirradiated in the GETR to study effects of increased fuel and cladding temperatures on chemical and thermomechanical behavior. Radial and axial distributions of cesium were obtained using postirradiation nondestructive precision gamma-scanning techniques. Data presented relate to the dependence of cesium distribution and transport processes on temperature gradients which were altered after substantial steady-state operation

  10. Contribution of the pectin in the cesium elimination in organism. results of analysis on Belarus children


    The results make appear that the cesium 137 would be eliminated less quick than what the ICRP considered for its models. Pectin would accelerate the cesium elimination but less quick than what is announced by its promotors. Politically speaking, the pectin is ignored by the officials of medicine and radiation protection at the pretext that its efficiency is not proved but no study is made. (N.C.)

  11. Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory

    Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.


    At Los Alamos National Laboratory, cesium-137 ({sup 137}Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles {<=}2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of {sup 137}Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of {sup 137}Cs.

  12. Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory

    Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.


    At Los Alamos National Laboratory, cesium-137 ( 137 Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles ≤2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of 137 Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of 137 Cs

  13. Concentrating cesium-137 from seawater using resorcinol-formaldehyde resin for radioecological monitoring

    Egorin, Andrei; Tokar, Eduard; Tutov, Mikhail; Avramenko, Valentin [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation); Far Eastern Federal Univ., Vladivostok (Russian Federation); Palamarchuk, Marina; Marinin, Dmitry [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation)


    A method of preconcentrating cesium-137 from seawater using a resorcinol-formaldehyde resin, which enables one to optimize the ecological monitoring procedure, has been suggested. Studies of sorption of cesium-137 from seawater by resorcinol-formaldehyde resin have been performed, and it has been demonstrated that the cation exchanger is characterized by high selectivity with respect to cesium-137. It was found that the selectivity depended on the temperature of resin solidification and the seawater pH value. The maximal value of the cesium-137 distribution coefficient is equal to 4.1-4.5 x 10{sup 3} cm{sup 3} g{sup -1}. Under dynamic conditions, the ion-exchange resin capacity is 310-910 bed volumes depending on the seawater pH, whereas the efficiency of cesium removal exceeds 95%. The removal of more than 95% of cesium-137 has been attained using 1-3 M solutions of nitric acid: here, the eluate volume was 8-8.4 bed volumes. Application of 3 M solution of nitric acid results in resin degradation with the release of gaseous products.

  14. Cesium absorption from acidic solutions using ammonium molybdophosphate on a polyacrylonitrile support (AMP-PAN)

    Miller, C.J.; Olson, A.L.; Johnson, C.K.


    Recent efforts at the Idaho Chemical Processing Plant (ICPP) have included evaluation of cesium removal technologies as applied to ICPP acidic radioactive waste streams. Ammonium molybdophosphate (AMP) immobilized on a polyacrylonitrile support (AMP-PAN) has been studied as an ion exchange agent for cesium removal from acidic waste solutions. Capacities, distribution coefficients, elutability, and kinetics of cesium-extraction have been evaluated. Exchange breakthrough curves using small columns have been determined from 1M HNO 3 and simulated waste solutions. The theoretical capacity of AMP is 213 g Cs/kg AMP. The average experimental capacity in batch contacts with various acidic solutions was 150 g Cs/kg AMP. The measured cesium distribution coefficients from actual waste solutions were 3287 mL/g for dissolved zirconia calcines, and 2679 mL/g for sodium-bearing waste. The cesium in the dissolved alumina calcines was analyzed for; however, the concentration was below analytical detectable limits resulting in inconclusive results. The reaction kinetics are very rapid (2-10 minutes). Cesium absorption appears to be independent of acid concentration over the range tested (0.1 M to 5 M HNO 3 )

  15. Review and assessment of technologies for the separation of cesium from acidic media

    Orth, R.J.; Brooks, K.P.; Kurath, D.E.


    A preliminary literature survey has been conducted to identify and evaluate methods for the separation of cesium from acidic waste. The most promising solvent extraction, precipitation, and ion exchange methods, along with some of the attributes for each method, are listed. The main criteria used in evaluating the separation methods were as follows: (1) good potential for cesium separation must be demonstrated (i.e., cesium decontamination factors on the order of 50 to 100). (2) Good selectivity for cesium over bulk components must be demonstrated. (3) The method must show promise for evolving into a practical and fairly simple process. (4) The process should be safe to operate. (5) The method must be robust (i.e., capable of separating cesium from various acidic waste types). (6) Secondary waste generation must be minimized. (7) The method must show resistance to radiation damage. The most promising separation methods did not necessarily satisfy all of the above criteria, thus key areas requiring further development are suggested for each method. The report discusses in detail these and other areas requiring further development, as well as alternative solvent extraction, precipitation, ion exchange, and {open_quote}other{close_quote} technologies that, based on current information, show less promise for the separation of cesium from acidic wastes because of significant process limitations. When appropriate, the report recommends areas of future development.

  16. Caustic-Side Solvent Extraction: Prediction of Cesium Extraction from Actual Wastes and Actual Waste Simulants

    Delmau, L.H.; Haverlock, T.J.; Sloop, F.V. Jr.; Moyer, B.A.


    This report presents the work that followed the CSSX model development completed in FY2002. The developed cesium and potassium extraction model was based on extraction data obtained from simple aqueous media. It was tested to ensure the validity of the prediction for the cesium extraction from actual waste. Compositions of the actual tank waste were obtained from the Savannah River Site personnel and were used to prepare defined simulants and to predict cesium distribution ratios using the model. It was therefore possible to compare the cesium distribution ratios obtained from the actual waste, the simulant, and the predicted values. It was determined that the predicted values agree with the measured values for the simulants. Predicted values also agreed, with three exceptions, with measured values for the tank wastes. Discrepancies were attributed in part to the uncertainty in the cation/anion balance in the actual waste composition, but likely more so to the uncertainty in the potassium concentration in the waste, given the demonstrated large competing effect of this metal on cesium extraction. It was demonstrated that the upper limit for the potassium concentration in the feed ought to not exceed 0.05 M in order to maintain suitable cesium distribution ratios

  17. Measurement of cesium emissions during the vitrification of simulated high level radioactive waste

    Zamecnik, J.R.; Miller, D.H.; Carter, J.T.


    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to eliminate a startup test that would involve adding small amounts of radioactive cesium-137 to simulated high-level waste. In order to eliminate this test, a reliable method for measuring non-radioactive cesium in the offgas system from the glass melter is required. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICPMS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. Typical particulate loadings ranged from 800 μg of cesium. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. The decontamination factors measured experimentally compared favorably with the process design basis values

  18. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    Hu, Baiyang [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Fugetsu, Bunshi, E-mail: [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Yu, Hongwen [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Abe, Yoshiteru [Kyoei Engineering Corporation, Niigata 959-1961 (Japan)


    Highlights: Black-Right-Pointing-Pointer Prussian blue was sealed in cavities of diatomite using carbon nanotubes. Black-Right-Pointing-Pointer The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. Black-Right-Pointing-Pointer Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  19. Diffusion of cesium in sodium-borosilicate glasses for nuclear waste immobilisation. Diffusie van cesium in natrium borosilicaat glazen voor het immobiliseren van radioaktief afval

    Janssen, F.J.J.G.; Sengers, E.G.F. (Keuring van Electrotechnische Materialen NV, Arnhem (Netherlands)); Waal, H. de (TPD-TNO-Glass technology, Eindhoven (Netherlands))


    Diffusion of cesium in borosilicate glass for high-level radioactive waste is discussed. For this purpose model glasses with non-radioactive elements are being made, in accordance with the specifications of the reprocessing plants, from which concentration couples are composed. A concentration couple consists of two cylinders of borosilicate glass which contain different amounts of cesium. After heat treatment the couples are studied by means of the scanning electron microscopy and X-ray microanalysis. The model study will provide a basis for predictions of the containment achieved over a longer period of time. (author). 11 refs.; 2 figs.; 2 tabs.

  20. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.


    .0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased......-1 isolates from patients in a long-term non-progressor (LTNP) cohort and a slow-progressor (SP) cohort (n = 11) was analysed and compared with isolates from a control patient group of progressors (n = 18). Most of the patients with delayed disease progression had extensive medical records, providing...... an insight into the LTNP disease profile and allowing for the stratification of patients based on their CD4 cell decline. RESULTS: In sequences from nine patients, most of the functional domains of HIV-1 Nef appeared intact, and no major deletions were observed to possibly account for an effect...

  1. Natural radioactive nuclides 138La and 176Lu in rare earth ore samples

    Zhang Weiping; Shen Jianfeng; Lu Zhaolun; Jiang Rangrong


    The contents of 1 '3 8 La and 176 Lu in some rare earth mines have been measured with a HPGE γ spectrometer. The measurements show that the contents of 138 La and 176 Lu in one rare earth mine are remarkably different from those in the other and they do not display a proportional relation, and that the contents of 40 K in this mine are very low

  2. Radioiodine therapy in management of thyroid carcinoma - A review of 138 patients

    Hossain, A.S.; Hossain, S.; Hafiz, N.; Taslima, D.A.; Rashid, H.


    Differentiated thyroid carcinomas are being treated by using a widely accepted protocol of surgery and radioiodine therapy followed by supplementation of thyroid hormones in the Nuclear Medicine Centre (NMC), Dhaka Medical College Hospital (DMCH) since 1990. In the present study 138 patients(Male-54, Female-84) with differentiated thyroid cancers received radioiodine therapy for ablation of residual thyroid tissue with a dose of 2.77-3.7 GBq (75-100 mCi), for lymph node metastases 5.55-6.5 GBq(150-175mCi), for lung metastases 5.55 GBq(150 mCi) and for bony metastases 7.4 GBq (200 mCi). Among 138 patients papillary carcinoma was observed in 94 cases (68%; Male-42, Female-52), follicular type was found in 30 cases (22%; Male-8, Female-22) and mixed type in 14 patients (10%, Male-4, Female-10). Single dose of 2.77-3.7 GBq(75-100 mCi) of radioiodine was received by all 138 patients. Among the unablated patients 62 received double doses totalling 9.25 GBq (250 mCi), 44 received three doses 12.95 GBq (350 mCi) and one patient received 8 doses 33.3 GBq (900 mCi). Out of 138 patients single dose ablated 76 cases and 62 remain unablated. Multiple doses ablated 28 patients and 34 still remain unablated and is under follow up. The success and failure in management of patients with differentiated thyroid cancer over 8 years period have been discussed here revealing a satisfactory outcome. (author)

  3. Post-irradiation characterization of PH13-8Mo martensitic stainless steel

    Jong, M.; Schmalz, F.; Rensman, J.W. [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Luzginova, N.V., E-mail: [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Wouters, O.; Hegeman, J.B.J.; Laan, J.G. van der [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands)


    The irradiation response of PH13-8Mo stainless steel was measured up to 2.5 dpa at 200 and 300 deg. C irradiation temperatures. The PH13-8Mo, a martensitic precipitation-hardened steel, was produced by Hot Isostatic Pressing at 1030 deg. C. The fatigue tests (high cycle fatigue and fatigue crack propagation) showed a test temperature dependency but no irradiation effects. Tensile tests showed irradiation hardening (yield stress increase) of approximately 37% for 200 deg. C irradiated material tested at 60 deg. C and approximately 32% for 300 deg. C irradiated material tested at 60 deg. C. This contradicts the shift in reference temperature (T{sub 0}) measured in toughness tests (Master Curve approach), where the {Delta}T{sub 0} for 300 deg. C irradiated is approximately 170 deg. C and the {Delta}T{sub 0} for the 200 deg. C irradiated is approximately 160 deg. C. This means that the irradiation hardening of PH13-8Mo steel is not suitable to predict the shift in the reference temperature for the Master Curve approach.

  4. 14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii.


    ... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

  5. 40 CFR 63.138 - Process wastewater provisions-performance standards for treatment processes managing Group 1...


    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process wastewater provisions-performance standards for treatment processes managing Group 1 wastewater streams and/or residuals removed from Group 1 wastewater streams. 63.138 Section 63.138 Protection of Environment ENVIRONMENTAL...

  6. Small Column Ion Exchange Analysis for Removal of Cesium from SRS Low Curie Salt Solutions Using Crystalline Silicotitanate (CST) Resin



    Savannah River Technology Center (SRTC) researchers modeled ion exchange removal of cesium from dissolved salt waste solutions. The results assist in evaluating proposed configurations for an ion exchange process to remove residual cesium from low curie waste streams. A process for polishing (i.e., removing small amounts) of cesium may prove useful should supernate draining fail to meet the Low Curie Salt (LCS) target limit of 0.1 Ci of Cs-137 per gallon of salt solution. Cesium loading isotherms and column breakthrough curves for Low Curie dissolved salt solutions were computed to provide performance predictions for various column designs

  7. Formation, decomposition and cesium adsorption mechanisms of highly alkali-tolerant nickel ferrocyanide prepared by interfacial synthesis

    Ichikawa, Tsuneki; Yamada, Kazuo; Osako, Masahiro; Haga, Kazuko


    Highly alkali-tolerant nickel ferrocyanide was prepared as an adsorbent for preventing the leaching of radioactive cesium from municipal solid waste incinerator fly ash containing large amounts of calcium hydroxide and potassium chloride, which act as an alkaline source and the suppressor for cesium adsorption, respectively. Nickel ferrocyanide prepared by contacting concentrated nickel and ferrocyanide solutions without mixing adsorbed cesium ions in alkaline conditions even the concentration of coexisting potassium ions was more than ten thousand times higher than that of the cesium ions. Large particles of nickel ferrocyanide slowly grew at the interface between the two solutions, which reduced the surface energy of the particles and therefore increased the alkali tolerance. The interfacially-synthesized nickel ferrocyanide was possible to prevent the leaching of radioactive cesium from cement-solidified fly ash for a long period. The mechanisms of the formation, selective cesium adsorption, and alkali-induced decomposition of the nickel ferrocyanide were elucidated. Comparison of the cesium adsorption mechanism with that of the other adsorbents revealed that an adsorbent can selectively adsorb cesium ions without much interference from potassium ions, if the following conditions are fulfilled. 1) The adsorption site is small enough for supplying sufficient electrostatic energy for the dehydration of ions adsorbed. 2) Both the cesium and potassium ions are adsorbed as dehydrated ions. 3) The adsorption site is flexible enough for permitting the penetration of dehydrated ions with the size comparable to that of the site. (author)

  8. Quantitative analysis on dose to humans as a result of consuming tuna fish contaminated by cesium radionuclides

    Khani, J.; Donev, J.M.K.C.


    Quantitative empirical data is presented on the dose exposure to North Americans consuming tuna fish that have accumulated concentrations of radioactive isotopes. The two particular radioactive isotopes of interest are cesium-137 and cesium-134. Though biological effects of radiation are a widely debatable topic, the consumption of tuna fish does not support significant increased risk of cancer to humans. An important comparison is made between the elevated levels of radioactive cesium concentrations to naturally occurring radionuclides, namely potassium-40 and polonium-210. It is calculated that naturally occurring radioactive isotopes are in the orders of magnitude greater than the cesium radionuclides in tuna fish. (author)

  9. Quantitative analysis on dose to humans as a result of consuming tuna fish contaminated by cesium radionuclides

    Khani, J.; Donev, J.M.K.C., E-mail:, E-mail: [Univ. of Calgary, Calgary, AB (Canada)


    Quantitative empirical data is presented on the dose exposure to North Americans consuming tuna fish that have accumulated concentrations of radioactive isotopes. The two particular radioactive isotopes of interest are cesium-137 and cesium-134. Though biological effects of radiation are a widely debatable topic, the consumption of tuna fish does not support significant increased risk of cancer to humans. An important comparison is made between the elevated levels of radioactive cesium concentrations to naturally occurring radionuclides, namely potassium-40 and polonium-210. It is calculated that naturally occurring radioactive isotopes are in the orders of magnitude greater than the cesium radionuclides in tuna fish. (author)

  10. Retrospective radiation-hygienic assessment of cesium-137 intake with feeding in the organisms of the Altai Territory habitants

    Meshkov, N.A.; Val'tseva, E.A.


    Radioactive precipitations as the result of atmospheric nuclear tests on the Semipalatinsk test site turned to local soil contamination by cesium-137 on the territory of the Altai Territory and Gorny Altai. The distribution of long-lived radioisotopes, cesium-137 in particular, in the main food staffs for local population is investigated. The retrospective analysis of cesium-137 specific activity in food products produced on these territories is carried out. It is ascertained that cesium-137 in meat has the general contribution to intake with food into organisms of adult population [ru

  11. Modeling approach to various time and spatial scale environmental issues in Fukushima. Related to radioactive cesium migration in aquatic systems

    Kurikami, Hiroshi; Kitamura, Akihiro; Yamada, Susumu; Machida, Masahiko


    Several numerical models have been prepared to deal with various time- and spatial-scale issues related to radioactive cesium migration in environment in Fukushima area. The SACT (Soil and Cesium Transport) model developed by the Japan Atomic Energy Agency (JAEA) predicts middle- to long-term evolution of radioactive cesium distribution due to soil erosion, subsequent sediment transport and deposition, and radioactive cesium migration based on the Universal Soil Loss Equation (USLE). The TODAM (Time-dependent One-dimensional Degradation and Migration) model, iRIC/Nays2D and the FLESCOT (Flow, Energy, Salinity, Sediment, Contaminant Transport) model are one-, two- and three-dimensional river/reservoir/coastal models, respectively. Based on conservation equations of sediment and radioactive cesium, they treat advection and diffusion of suspended sediment and cesium, deposition of sediment to bed, re-suspension from bed and adsorption/desorption of radioactive cesium. These models are suitable for small and short time scale issues such as high discharges of sediment and radioactive cesium from rivers due to heavy rainfall events. This paper describes fragments of the JAEA’s approaches of modeling to deal with the issues corresponding to radioactive cesium migration in environment with some case studies. (author)

  12. Effect of electrolytes concentration on recovery of cesium from AMP-PAN by Electrodialysis-Ion Exchange (EDIX)

    Mahendra, Ch.; Rajan, K.K.; SatyaSai, P.M.; Anand Babu, C.


    Cesium from the simulated acidic waste solution was separated using Ammonium Molybdophosphate (AMP) - Polyacrylonitrile (PAN) ion exchange resin in column operations. Electrodialysis - Ion exchange (EDIX) has been tried for the recovery of cesium from the AMP-PAN which was saturated with cesium. The electrodialysis setup consists of three compartments; cesium loaded AMP-PAN is placed in the middle compartment and is separated from the anode and cathode compartments by cation exchange membranes. Ammonium sulphate was used as anolyte and HNO 3 as catholyte. 0.1N HNO 3 was circulated in the middle compartment containing AMP-PAN to keep the resin in acidic form. On application of potential, the ammonium ions from the anode compartment migrate towards cathode through the middle compartment where they exchange with cesium ions on the resin and the exchanged cesium ions migrate towards cathode to get concentrated. Some part of cesium is recovered in the middle compartment due to convection. Cesium recovery from the AMP-PAN in the electrodialysis setup was studied at different anolyte and catholyte concentrations. All the experiments were carried out at constant current density of 40 mA/cm 2 for 15h. It was found that more than 50% of cesium recovery was observed for all the experiments studied and recovery percentage increased with increasing the anolyte concentration. It was observed that the electrolytes concentration affects the voltage drop across the cell

  13. Engineered Materials for Cesium and Strontium Storage Final Technical Report

    Sean M. McDeavitt


    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at

  14. Engineered Materials for Cesium and Strontium Storage. Final Technical Report

    McDeavitt, Sean M.


    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at Purdue

  15. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    Schultz, F.J.; Tompkins, J.A.; Haff, K.W.; Case, F.N.


    Twenty-seven fully loaded 137 Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 1500 0 C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of 137 Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded 137 Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10 -10 kg m -2 s -1 , while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10 -12 kg m -2 s -1 . The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level 137 Cs aluminosilicate pellets were 1.29 x 10 -16 m 2 s -1 , 6.88 x 10 -17 m 2 s -1 , and 1.35 x 10 -17 m 2 s -1 , respectively

  16. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    Peterson, R.A.


    This report contains the results from a study requested by High Level Waste on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na + ] increased the rate at which cesium tetraphenylborate (CsTPB) precipitates also increases. Serkiz also demonstrated that the precipitation of potassium tetraphenylborate (KTPB) in the presence of high [Na + ] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice. In the crystallographic structure of these three tetraphenylborate salts (Cs,K,NaTPB), the tetraphenylborate ion dominates the size of the crystals. Also, note that the three crystals have nearly identical structures with the exception of two additional peaks in the cesium pattern. Given these similarities, TPB precipitation in the presence of Na + , Cs + and K + likely produces an impure isomorphic crystalline mixture of CsTPB, KTPB and NaTPB. The authors speculate that the primary crystalline structure resembles that of KTPB with NaTPB and CsTPB mixed throughout the crystal structure. The precipitation of NaTPB makes some of the anticipated excess tetraphenylborate relatively unavailable for precipitation of cesium. Thus, the amount of excess tetraphenylborate required to completely precipitate all of the potassium and cesium may increase significantly

  17. Strontium-90 and cesium-137 in sea sediments (from May 1984 to Sep 1984)


    Strontium-90 and cesium-137 monitoring results are presented for sea sediment samples of 12 sampling points located all over Japan from Tomari, Hokkaido to Kinnakagusuku Bay, Okinawa. The samples were collected by considering of enough sea water depth, no significant sedimental movement and sediment characteristics, and by employing a conventional sampling device. Approximately 4 kg-wet sample was dried and was passed through a 20 cm mesh sieve. After adding of strontium and cesium carriers, strontium-90 and cesium-137 were leached with a hot hydrochloric acid solution. The leachate was treated by ion exchange and coprecipitation to concentrate and isolate strontium-90 or cesium-137. Radiation counting was carried out by employing a low background beta counter usually for 60 minutes for the samples of strontium carbonate or cesium chloroplatinate. Determined strontium-90 contents in sea sediment were distributed from 0 +- 2.7 pCi/kg-dry (Mutsu Bay, Aomori, Yamaguchi Bay, Yamaguchi) to 14 +- 3.2 pCi/kg-dry (Mutsu Bay), and those of cesium-137 were from 9 +- 3.5 pCi/kg-dry (Mutsu Bay) to 250 +- 9 pCi/kg-dry (Off-Niigata Port, Niigata). Local variation of the contents of these radionuclides was very large, and for seasonal variation, it was also found large for the both nuclides content in the Mutsu Bay samples of May, 1984 and August 1984, as for strontium-90, 0 +- 2.7 pCi/kg and 14 +- 3.2 pCi/kg, for cesium-137, 9 +- 3.5 pCi/kg and 200 +- 8 pCi/kg, respectively. (Takagi, S.)

  18. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail:


    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  19. Improvement of cesium retention in uranium dioxide by additional phases; Amelioration de la retention du cesium dans le dioxyde d`uranium au moyen de phases exogenes

    Gamaury Dubois, S


    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs{sub 2}O-Al{sub 2}O{sub 3}-SiO{sub 2} et Cs{sub 2}O-ZrO{sub 2}-SO{sub 2}. The compounds CsAISi{sub 2}O{sub 6} and Cs{sub 2}ZrSi{sub 6}O{sub 15} were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al{sub 2}O{sub 3} + SiO{sub 2}) or (ZrO{sub 2} + SiO{sub 2}) and the intergranular phase was characterized. In the presence of (Al{sub 2}O{sub 3} + SiO{sub 2}), the sintering is realized at 1610 deg C in H{sub 2}. It is a liquid phase sintering. On the other end, with (ZrO{sub 2} + SiO{sub 2}), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO{sub 2+x}. We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs.

  20. Slow hot carrier cooling in cesium lead iodide perovskites

    Shen, Qing; Ripolles, Teresa S.; Even, Jacky; Ogomi, Yuhei; Nishinaka, Koji; Izuishi, Takuya; Nakazawa, Naoki; Zhang, Yaohong; Ding, Chao; Liu, Feng; Toyoda, Taro; Yoshino, Kenji; Minemoto, Takashi; Katayama, Kenji; Hayase, Shuzi


    Lead halide perovskites are attracting a great deal of interest for optoelectronic applications such as solar cells, LEDs, and lasers because of their unique properties. In solar cells, heat dissipation by hot carriers results in a major energy loss channel responsible for the Shockley-Queisser efficiency limit. Hot carrier solar cells offer the possibility to overcome this limit and achieve energy conversion efficiency as high as 66% by extracting hot carriers. Therefore, fundamental studies on hot carrier relaxation dynamics in lead halide perovskites are important. Here, we elucidated the hot carrier cooling dynamics in all-inorganic cesium lead iodide (CsPbI3) perovskite using transient absorption spectroscopy. We observe that the hot carrier cooling rate in CsPbI3 decreases as the fluence of the pump light increases and the cooling is as slow as a few 10 ps when the photoexcited carrier density is 7 × 1018 cm-3, which is attributed to phonon bottleneck for high photoexcited carrier densities. Our findings suggest that CsPbI3 has a potential for hot carrier solar cell applications.

  1. ATLAS tile calorimeter cesium calibration control and analysis software

    Solovyanov, O; Solodkov, A; Starchenko, E; Karyukhin, A; Isaev, A; Shalanda, N


    An online control system to calibrate and monitor ATLAS Barrel hadronic calorimeter (TileCal) with a movable radioactive source, driven by liquid flow, is described. To read out and control the system an online software has been developed, using ATLAS TDAQ components like DVS (Diagnostic and Verification System) to verify the hardware before running, IS (Information Server) for data and status exchange between networked computers, and other components like DDC (DCS to DAQ Connection), to connect to PVSS-based slow control systems of Tile Calorimeter, high voltage and low voltage. A system of scripting facilities, based on Python language, is used to handle all the calibration and monitoring processes from hardware perspective to final data storage, including various abnormal situations. A QT based graphical user interface to display the status of the calibration system during the cesium source scan is described. The software for analysis of the detector response, using online data, is discussed. Performance of the system and first experience from the ATLAS pit are presented

  2. Primary standardization of cesium-137 for international intercomparison

    Srivastava, P.K.


    Primary standards of cesium-137 are of great importance for precise radiation measurements because, due to its simple decay-scheme and long half-life, it is widely used for the calibration of radiation detectors. Also 137 Cs is used for the measurement of fission-yield and uranium burn-up in reactor engineering studies. In view of these, an international intercomparison was organised on a limited scale to correlate the standards established at the Bhabha Atomic Research Centre (BARC), Bombay(India) and Physikalisch-Technische Bundesanstalt (PTB), West Germany. The ''efficiency tracing technique'' was developed at BARC for the primary standardization of 137 Cs for this intercomparison. Two tracers, namely 82 Br and 60 Co, were employed to trace the beta efficiency of the 4 πβ-γ coincidence counting system. It is shown that this technique offers high accuracy and inherent reliability. The ''tracing-technique'' for 137 Cs standardization is briefly described. The gravimetric method of dilution and preparation of mixed sources of 137 Cs - 82 Br and 137 Cs - 60 Co are given. The various counting parameters and settings are included. Data reduction and the estimation of systematic and statistical errors are discussed. The results of the intercomparison, which are also included, show that the agreement between the measurments of BARC and PTB is within 0.5%. (author)

  3. Proton tunneling in low dimensional cesium silicate LDS-1

    Matsui, Hiroshi; Iwamoto, Kei; Mochizuki, Dai; Osada, Shimon; Asakura, Yusuke; Kuroda, Kazuyuki


    In low dimensional cesium silicate LDS-1 (monoclinic phase of CsHSi2O5), anomalous infrared absorption bands observed at 93, 155, 1210, and 1220 cm-1 are assigned to the vibrational mode of protons, which contribute to the strong hydrogen bonding between terminal oxygen atoms of silicate chain (O-O distance = 2.45 Å). The integrated absorbance (oscillator strength) for those modes is drastically enhanced at low temperatures. The analysis of integrated absorbance employing two different anharmonic double-minimum potentials makes clear that proton tunneling through the potential barrier yields an energy splitting of the ground state. The absorption bands at 93 and 155 cm-1, which correspond to the different vibrational modes of protons, are attributed to the optical transition between the splitting levels (excitation from the ground state (n = 0) to the first excited state (n = 1)). Moreover, the absorption bands at 1210 and 1220 cm-1 are identified as the optical transition from the ground state (n = 0) to the third excited state (n = 3). Weak Coulomb interactions in between the adjacent protons generate two types of vibrational modes: symmetric mode (93 and 1210 cm-1) and asymmetric mode (155 and 1220 cm-1). The broad absorption at 100-600 cm-1 reveals an emergence of collective mode due to the vibration of silicate chain coupled not only with the local oscillation of Cs+ but also with the proton oscillation relevant to the second excited state (n = 2).

  4. Cesium immobilization in (Ba,Cr)-hollandites: Effects on structure

    Tumurugoti, Priyatham; Sundaram, S. K.; Misture, Scott T.


    Hollandites with compositions Ba1.15-xCs2xCr2.3Ti5.7O16 (0 ≤ x ≤ 1.15) intended for the immobilization of cesium (Cs) from nuclear waste have been prepared, characterized, and analyzed for Cs retention properties. Sol-gel synthesized powders were used for structural characterization using a combination of X-ray, neutron, and electron diffraction techniques. Phase-pure hollandites adopting tetragonal (I4/m) or monoclinic symmetry (I2/m) were observed to form in the compositional range 0 ≤ x ≤ 0.4. Structural models for the compositions, x = 0, 0.15, and 0.25 were developed from Rietveld analysis of powder diffraction data. Refined anisotropic displacement parameters (βij) for the Ba and Cs ions in the hollandite tunnels indicate local disorder of Ba/Cs along the tunnel direction. In addition, weak superlattice reflections were observed in X-ray and electron diffraction patterns that were due to the compositional modulation i.e., ordering of ions and vacancies along tunnel direction. Our overall observations suggest the phase-pure hollandites studied assumed supercell structures with ordered tunnel cations, which in turn have positional disorder in individual supercells.

  5. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)



    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  6. Sorption Coefficients for Iodine, Silver, and Cesium on Dust Particles

    Stempniewicz, M.M.; Goede, P.


    This paper describes the work performed to find relevant experimental data and find the sorption coefficients that represent well the available data for cesium, iodine, and silver on dust particles. The purpose of this work is to generate a set of coefficients that may be recommended for the computer code users. The work was performed using the computer code SPECTRA. Calculations were performed for the following data: • I-131 on AVR dust; • Ag-110m on AVR dust; • Cs-13 and Cs-137 on AVR dust. Available data was matched using the SPECTRA Sorption Model. S = A(T) · C_V-B(T) · C_d. The results are summarized as follows: • The available data can be correlated. The data scatter is about 4 orders of magnitude. Therefore the coefficients of the Langmuir isotherms vary by 4 orders of magnitude. • Sorption rates are higher at low temperatures and lower at high temperatures. This tendency has been observed in the data compiled at Oak Ridge. It is therefore surmised that the highest value of the sorption coefficients are appropriate for the low temperatures and the lowest value of the sorption coefficients are appropriate for the high temperatures. The recommended sorption coefficients are presented in this paper. • The present set of coefficients is very rough and should be a subject for future verification against experimental data. (author)

  7. ATLAS tile calorimeter cesium calibration control and analysis software

    Solovyanov, O; Solodkov, A; Starchenko, E; Karyukhin, A; Isaev, A; Shalanda, N [Institute for High Energy Physics, Protvino 142281 (Russian Federation)], E-mail:


    An online control system to calibrate and monitor ATLAS Barrel hadronic calorimeter (TileCal) with a movable radioactive source, driven by liquid flow, is described. To read out and control the system an online software has been developed, using ATLAS TDAQ components like DVS (Diagnostic and Verification System) to verify the hardware before running, IS (Information Server) for data and status exchange between networked computers, and other components like DDC (DCS to DAQ Connection), to connect to PVSS-based slow control systems of Tile Calorimeter, high voltage and low voltage. A system of scripting facilities, based on Python language, is used to handle all the calibration and monitoring processes from hardware perspective to final data storage, including various abnormal situations. A QT based graphical user interface to display the status of the calibration system during the cesium source scan is described. The software for analysis of the detector response, using online data, is discussed. Performance of the system and first experience from the ATLAS pit are presented.

  8. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)


    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department's mission as stated in that document. ''The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.''

  9. Thermal Analysis of Lampung Zeolite as Ion Cesium Replacement

    Aslina-Br-Ginting; Dian-Anggraini; Arif-Nugroho


    Zeolite have the cation can move freely and as exchangeable partly or totally with other cations. Therefore, it can serve the purpose of ion exchanger very selectively to ion cesium which is present in fuel waste. In this research analysis of pore surface area, radius pore, and adsorption have been done. After the characters of Lampung zeolite is known and then analysis of cation exchange capacity (CEC) toward ion 137 Cs is conducted, analysis of Lampung zeolite adsorption to ion 137 Cs in waste of fissile product and in research waste is subsequently done. Result of analysis show Lampung zeolite has surface area of 10,0478 m 2 , specific surface area of 47,0841 m 2 /g, pore radius of 19,3020 o A and adsorption of 24,500 cc/g. For application as a ion exchange, Lampung zeolite can adsorb ion 137 Cs reaching maximum at concentration of CsCl 0,5 N with the contact time 1 day and the optimum KTK value is 0,8360 m eq/g. While Lampung zeolite is able to adsorb 86,4 % ion Cs in waste of fission product. (author)

  10. Characterization of deamidation at Asn138 in L-chain of recombinant humanized Fab expressed from Pichia pastoris.

    Ohkuri, Takatoshi; Murase, Eri; Sun, Shu-Lan; Sugitani, Jun; Ueda, Tadashi


    A method was previously established for evaluating Asn deamidation by matrix-assisted laser desorption/ionization time of flight-mass spectrometry using endoproteinase Asp-N. In this study, we demonstrated that this method could be applied to the identification of the deamidation site of the humanized fragment antigen-binding (Fab). First, a system for expressing humanized Fab from methylotrophic yeast Pichia pastoris was constructed, resulting in the preparation of ∼30 mg of the purified humanized Fab from 1 l culture. Analysis of the L-chain derived from recombinant humanized Fab that was heated at pH 7 and 100°C for 1 h showed the deamidation at Asn138 in the constant region. Then, we prepared L-N138D Fab and L-N138A Fab and examined their properties. The circular dichroism (CD) spectrum of the L-N138D Fab was partially different from that of the wild-type Fab. The measurement of the thermostability showed that L-N138D caused a significant decrease in the thermostability of Fab. On the other hand, the CD spectrum and thermostability of L-N138A Fab showed the same behaviour as the wild-type Fab. Thus, it was suggested that the introduction of a negative charge at position 138 in the L-chain by the deamidation significantly affected the stability of humanized Fab.

  11. Removal of cesium from simulated liquid waste with countercurrent two-stage adsorption followed by microfiltration

    Han, Fei; Zhang, Guang-Hui [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Gu, Ping, E-mail: [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China)


    Highlights: Black-Right-Pointing-Pointer The adsorption isotherm of cesium by copper ferrocyanide followed a Freundlich model. Black-Right-Pointing-Pointer Decontamination factor of cesium was higher in lab-scale test than that in jar test. Black-Right-Pointing-Pointer A countercurrent two-stage adsorption-microfiltration process was achieved. Black-Right-Pointing-Pointer Cesium concentration in the effluent could be calculated. Black-Right-Pointing-Pointer It is a new cesium removal process with a higher decontamination factor. - Abstract: Copper ferrocyanide (CuFC) was used as an adsorbent to remove cesium. Jar test results showed that the adsorption capacity of CuFC was better than that of potassium zinc hexacyanoferrate. Lab-scale tests were performed by an adsorption-microfiltration process, and the mean decontamination factor (DF) was 463 when the initial cesium concentration was 101.3 {mu}g/L, the dosage of CuFC was 40 mg/L and the adsorption time was 20 min. The cesium concentration in the effluent continuously decreased with the operation time, which indicated that the used adsorbent retained its adsorption capacity. To use this capacity, experiments on a countercurrent two-stage adsorption (CTA)-microfiltration (MF) process were carried out with CuFC adsorption combined with membrane separation. A calculation method for determining the cesium concentration in the effluent was given, and batch tests in a pressure cup were performed to verify the calculated method. The results showed that the experimental values fitted well with the calculated values in the CTA-MF process. The mean DF was 1123 when the dilution factor was 0.4, the initial cesium concentration was 98.75 {mu}g/L and the dosage of CuFC and adsorption time were the same as those used in the lab-scale test. The DF obtained by CTA-MF process was more than three times higher than the single-stage adsorption in the jar test.

  12. Development program for magnetically assisted chemical separation: Evaluation of cesium removal from Hanford tank supernatant

    Nunez, L.; Buchholz, B.A.; Ziemer, M.; Dyrkacz, G.; Kaminski, M.; Vandegrift, G.F.; Atkins, K.J.; Bos, F.M.; Elder, G.R.; Swift, C.A.


    Magnetic particles (MAG*SEP SM ) coated with various absorbents were evaluated for the separation and recovery of low concentrations of cesium from nuclear waste solutions. The MAG*SEP SM particles were coated with (1) clinoptilolite, (2) transylvanian volcanic tuff, (3) resorcinol formaldehyde, and (4) crystalline silico-titanate, and then were contacted with a Hanford supernatant simulant. Particles coated with the crystalline silico-titanate were identified by Bradtec as having the highest capacity for cesium removal under the conditions tested (variation of pH, ionic strength, cesium concentration, and absorbent/solution ratio). The MAG*SEP SM particles coated with resorcinol formaldehyde had high distribution ratios values and could also be used to remove cesium from Hanford supernant simulant. Gamma irradiation studies were performed on the MAG*SEP SM particles with a gamma dose equivalent to 100 cycles of use. This irradiation decreased the loading capacity and distribution ratios for the particles by greater than 75%. The particles demonstrated high sensitivity to radiolytic damage due to the degradation of the polymeric regions. These results were supported by optical microscopy measurements. Overall, use of magnetic particles for cesium separation under nuclear waste conditions was found to be marginally effective

  13. Strontium-90 and cesium-137 in sea water (from Jul 1984 to Sep 1984)


    Monitoring results are presented on strontium-90 and cesium-137 contents in sea water of 11 sampling points all over Japan from Hokkaido to Okinawa coast. Sampling points were selected by the criterion that the effect of terrestrial fresh water and atmospheric precipitation was expected to be ignorable. Sample collection was carried out in the Period from July to September, 1984. With a special care for prevention of any contamination. The collected sea water samples were acidified immediately and they were served for radiochemical separation and purification of strontium-90 and cesium-137. Radiation counting was made for yttrium-90 hydroxide sample and cesium chloroplatinate sample with a low background beta counter normally for 60 minutes. As for strontium-90 contents in sea water, they were ranged from 0.07 +- 0.010 pCi/l (Mutsu Bay, Aomori) to 0.11 +- 0.012 pCi/l (Off Niigata Port, Niigata) and the average value was 0.09 pCi/l. As for cesium-137 contents, they were ranged from 0.08 +- 0.011 pCi/l (Ise Bay, Aichi) to 0.14 +- 0.012 pCi/l (Yamaguchi Bay, Yamaguchi) and the average value was 0.106 pCi/l. It is clarified that no abnormal values were determined for strontium-90 or cesium-137 contents in coastal sea water around Japan from a fallout origin. (Takagi, S.)

  14. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    Houssni El-Saied


    Full Text Available In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+ on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the kaolin. Paper handsheets were prepared containing various percentages of the modified kaolin. The mechanical and optical properties of paper handsheets were studied. The prepared paper handsheets were irradiated by gamma irradiation using different doses. Fourier transform infrared (FTIR spectroscopy was used to study the effect of kaolin modification by cesium and gamma irradiation on paper handsheets properties. The results indicated that modified kaolin enhanced the mechanical and optical properties of paper handsheets. Electron spin resonance (ESR spectroscopy and laser-induced breakdown spectroscopy (LIBS were also used. They provided rapid, sensitive and nondestructive techniques in differentiating between different questioned documents. This study presents a new concept in manufacturing security papers and anticounterfeiting applications.

  15. Hybrid micro-particles as a magnetically-guidable decontaminant for cesium-eluted ash slurry

    Namiki, Yoshihisa; Ueyama, Toshihiko; Yoshida, Takayuki; Watanabe, Ryoei; Koido, Shigeo; Namiki, Tamami


    Decontamination of the radioactive cesium that is widely dispersed owing to a nuclear power station accident and concentrated in fly ash requires an effective elimination system. Radioactive fly ash contains large amounts of water-soluble cesium that can cause severe secondary contamination and represents a serious health risk, yet its complete removal is complicated and difficult. Here it is shown that a new fine-powder formulation can be magnetically guided to eliminate cesium after being mixed with the ash slurry. This formulation, termed MagCE, consists of a ferromagnetic porous structure and alkaline- and salt-resistant nickel ferrocyanide. It has potent cesium-adsorption- and magnetic-separation-properties. Because of its resistance against physical and chemical attack such as with ash particles, as well as with the high pH and salt concentration of the ash slurry, MagCE simplifies the decontamination process without the need of the continued presence of the hazardous water-soluble cesium in the treated ash.

  16. Measurement of cesium and mercury emissions from the vitrification of simulated high level radioactive waste

    Zamecnik, J.R.


    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to measure non-radioactive cesium in the offgas system from the glass melter. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICP-MS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. In addition, total particulate measurements were also made. Measurements of mercury decontamination factors were made on the same equipment; the results indicate that most of the mercury in the offgas system probably exists as elemental mercury and HgCl 2 , with some HgO and Hg 2 Cl 2 . The decontamination factors determined for cesium, total particulate, and mercury all compared favorably with the design values

  17. Local mat-forming cyanobacteria effectively facilitate decontamination of radioactive cesium in rice fields

    Yamamoto, Atsushi; Yoshida, Shigeru; Okumura, Hiroshi; Inagaki, Masayo; Yamanishi, Hirokuni; Ito, Tetsuo; Furukawa, Michio


    The most effective and widespread method to decontaminate radioactive cesium from the Fukushima Daiichi Nuclear Power Plant Disaster was peeling topsoil. But the method had problems, such as large amounts of discarded soil and large-scale work. In nature, cyanobacteria formed biomats on the ground surface and facilitated peeling topsoil when the biomats dried. The cyanobacteria-facilitating peeling decontamination method utilized these cyanobacterial properties. Cyanobacteria are located all over Japan and 'local' cyanobacteria could be used for decontamination without introducing new species. Utilizing cyanobacteria could decrease the amount of discarded soil to about 30% and downsize the execution-scale to individual locations. Cyanobacterial biomats were easily cultivated, especially in rice fields, by maintaining wet conditions and exposure to 100 - 83% solar radiation. Shading by a thin net was helpful in maintaining an environment suitable for cyanobacteria. Nowadays, to prevent uptake of radioactive cesium into rice, K + is usually added to fertilizer in rice fields. The K + fertilization in rice fields might also enhance cyanobacterial capture of radioactive cesium, because high concentrations of K + enhanced cyanobacterial uptake of Cs + . Cyanobacteria could also mitigate the risk of radioactive cesium moving away from a decontaminating rice field. Therefore, the cyanobacteria-facilitating peeling decontamination method was proposed as an easy and safe 'D.I.Y.' method for both farmers and the environment. Besides, plowing rice fields with water before peeling improved the efficiency of this method, because plowing increased the radioactive cesium concentration in the topsoil. (author)

  18. Efficiency of fly ash belite cement and zeolite matrices for immobilizing cesium

    Goni, S.; Guerrero, A.; Lorenzo, M.P.


    The efficiency of innovative matrices for immobilizing cesium is presented in this work. The matrix formulation included the use of fly ash belite cement (FABC-2-W) and gismondine-type Na-P1 zeolite, both of which are synthesized from fly ash of coal combustion. The efficiency for immobilizing cesium is evaluated from the leaching test ANSI/ANS 16.1-1986 at the temperature of 40 deg. C, from which the apparent diffusion coefficient of cesium is obtained. Matrices with 100% of FABC-2-W are used as a reference. The integrity of matrices is evaluated by porosity and pore-size distribution from mercury intrusion porosimetry, X-ray diffraction and nitrogen adsorption analyses. Both matrices can be classified as good solidify systems for cesium, specially the FABC-2-W/zeolite matrix in which the replacement of 50% of belite cement by the gismondine-type Na-P1 zeolite caused a decrease of two orders of magnitude of cesium mean Effective Diffusion Coefficient (D e ) (2.8e-09 cm 2 /s versus 2.2e-07 cm 2 /s, for FABC-2-W/zeolite and FABC-2-W matrices, respectively)

  19. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences; Localisation moleculaire de l'americium, du technetium et du cesium chez des animaux marins comestibles leur comportement metabolique et ses consequences

    Pieri, J; Goudard, F; Milcent, M C [Laboratoire de Biochimie et Radiochimie, Faculte des Sciences et des Techniques, Nantes Cedex (France)


    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  20. Cesium-137 in soil texture fractions and its impact on Cesium-137 soil-to-plant transfer

    Gerzabek, M.H.; Mohamad, S.A.; Mueck, K.


    Field studies at two sites contaminated by the Chernobyl fallout showed 137 Cesium (Cs) soil-to-plant transfer factors in wheat, rye and potato. Transfer values ranged from 0.0017 (potato tuber) to 0.07 (wheat straw). Generally transfer coefficients in cereal grains and potato tubers were significantly below the values of the shoots. A comparison of the two sites led to the conclusion that for all plants investigated 137 Cs transfer factors were higher in Lower Austria (Calcic Chernozem) than in Upper Austria (Eutric Cambisol). The specific activities of the texture fractions of the two soil types increased from sand to silt and clay. In the Calcic Chernozem the ratio of the 137 Cs activity in the silt fraction to the total activity in the soil was considerably higher than in the Eutric Cambisol. At the same time extractability of 137 Cs from the silt fraction of the latter soil was clearly lower. Both results mainly were attributed to the differences between the soils according to the organic matter content of the silt fractions, the Calcic Chernozem being seven times higher. Therefore, the differences in the 137 Cs-soil-to-plant transfer can be attributed partly to these soil characteristics. (authors)

  1. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms; Sympathetisches Kuehlen in einer Rubidium-Caesium-Mischung: Erzeugung ultrakalter Caesiumatome

    Haas, M.


    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m{sub f}=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m{sub f}=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m{sub f}=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The

  2. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences

    Pieri, J.; Goudard, F.; Milcent, M.C.


    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  3. Clinical characteristics of 138 Chinese female patients with idiopathic hypogonadotropic hypogonadism

    Rui-yi Tang


    Full Text Available Objective: To evaluate the clinical features of Chinese women with idiopathic hypogonadotropic hypogonadism (IHH. Methods: We retrospectively reviewed the clinical characteristics, laboratory and imaging findings, therapeutic management and fertility outcomes of 138 women with IHH. All patients had been treated and followed up at an academic medical centre during 1990–2016. Results: Among the 138 patients, 82 patients (59.4% were diagnosed with normosmic IHH and 56 patients (40.6% were diagnosed with Kallmann syndrome (KS. The patients with IHH experienced occasional menses (4.3%, spontaneous thelarche (45.7% or spontaneous pubarche (50.7%. Women with thelarche had a higher percentage of pubarche (P < 0.001 and higher gonadotropin concentrations (P < 0.01. Olfactory bulb/sulci abnormalities were found during the magnetic resonance imaging (MRI of all patients with KS. Most patients with IHH had osteopenia and low bone age. Among the 16 women who received gonadotropin-releasing hormone treatment, ovulation induction or assisted reproductive technology, the clinical pregnancy rate was 81.3% and the live birth rate was 68.8%. Conclusions: The present study revealed that the phenotypic spectrum of women with IHH is broader than typical primary amenorrhoea with no secondary sexual development, including occasional menses, spontaneous thelarche or pubarche. MRI of the olfactory system can facilitate the diagnosis of KS. Pregnancy can be achieved after receiving appropriate treatment.


    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang


    Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

  5. [Clinical analysis of 138 multiple primary cancers diagnosed of digestive system malignant tumor initially].

    Lyu, J M; Xiong, H C; Wu, B; Zhou, X Q; Hu, J


    Objective: To study the clinical characteristics, strategy of treatment and prognosis of multiple primary cancers(MPC) diagnosed of digestive system malignant tumor firstly. Methods: From January, 2000 to December, 2015, the clinical, follow-up and prognostic data of 138 MPC patients diagnosed of digestive system malignant tumor firstly were retrospectively analyzed. Results: 138 cases were found in 10 580 cases with malignant tumors, and the incidence was 1.30%. There were 129 cases of duplex primary cancers, 8 cases of triple primary cancers and 1 case of quintuple primary cancers. The repetitive primary cancer was occurred in digestive system (61cases, 44.2%) most frequently, with the next in respiratory system (46 cases, 33.3%). 52.2% (72 cases) suffered second primary cancer in 2 years after first primary cancer diagnosed, and 75.4% (104 cases) in 5 years. The median overall survival in patients with all cancer lesions radically treated was 168 months, better than any other treatment (68 months, P digestive system malignant tumor most frequently occurred in the digestive system and respiratory system. More concern should be attracted in follow-up, especially in the first 5 years. The key to improve patient' prognosis was radical treatment to every primary cancer.

  6. Spin-dependent γ softness or triaxiality in even-even 132-138Nd nuclei

    Chai, Qing-Zhen; Wang, Hua-Lei; Yang, Qiong; Liu, Min-Liang


    The properties of γ instability in rapidly rotating even-even 132-138Nd isotopes have been investigated using the pairing-deformation self-consistent total-Routhian-surface calculations in a deformation space of (β2, γ, β4). It is found that even-even 134-138Nd nuclei exhibit triaxiality in both ground and excited states, even up to high-spin states. The lightest isotope possesses a well-deformed prolate shape without a γ deformation component. The current numerical results are compared with previous calculations and available observables such as quadrupole deformation β2 and the feature of γ-band levels, showing basically a general agreement with the observed trend of γ correlations (e.g. the pattern of the odd-even energy staggering of the γ band). The existing differences between theory and experiment are analyzed and discussed briefly. Supported by National Natural Science Foundation of China (10805040,11175217), Foundation and Advanced Technology Research Program of Henan Province(132300410125) and S & T Research Key Program of Henan Province Education Department (13A140667)

  7. Modeling the fate transport of cesium in crushed granite

    Lee, C.B.; Kuo, Y.M.; Hsu, C.N.; Li, M.H.; Cheng, H.P.; Teng, S.P.


    Full text of publication follows: In order to assess the safety of a underground radwaste repository, reactive transport models suitable for evaluating the fate and transport of radionuclides need to be established based on experimental observation and analysis. The goal of this study is to construct adequate models simulating the reactive transport of cesium (Cs) in crushed granite through a systematic analysis, where synthetic groundwater (SGW) and synthetic seawater (SSW) were employed as the liquid phase. To build such models, this study applied N 2 -BET, x-ray diffraction (XRD), polar-microscopy/ auto-radiography, and solid-phase digestion for the analysis of granite, kinetic batch tests for the characterization of sorption/desorption of Cs, and multi-stage advection-dispersion column tests for the determination of major transport processes and the calibration/validation of hypothesized reactive transport models. Based on the results of solid phase analysis and batch tests, a two-site Langmuir kinetic model has been determined capable of appropriately describing Cs sorption/desorption under test conditions. From the results of non-reactive HTO column tests, a mobile/immobile transport model was proposed to capture the major transport processes in our column system. However, the combination of the two-site Langmuir model and the mobile/immobile transport model failed to provide numerical breakthrough curves matching the Cs experimental breakthroughs. It implied that our model needs to be further refined. To achieve this, the setup of our column test needs to be modified first to reduce the volume of column connecting space, so that the effect of extra diffusion/dispersion on breakthroughs would be minimized and major transport characteristics can be clearly revealed. Moreover, more investigations on the reaction mechanisms and transport processes of the reactive transport system must be conducted. (authors)

  8. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    Klein, M.; Weyers, C.; Goossens, W.R.A.


    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103 Ru, 134 Cs and 124 Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10 -3 to 5.10 -5 % of the Ru fed, for Cs the corresponding release fraction ranges between 3.10 -3 to 10 -4 % and for Sb the release fraction ranges between 1.7 10 -4 to 1.7 10 -5 %. The same experiments were performed at a throughput of 1 to 2 1 h -1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103 Ru and 134 Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  9. 3D Planetary Data Visualization with CesiumJS

    Larsen, K. W.; DeWolfe, A. W.; Nguyen, D.; Sanchez, F.; Lindholm, D. M.


    Complex spacecraft orbits and multi-instrument observations can be challenging to visualize with traditional 2D plots. To facilitate the exploration of planetary science data, we have developed a set of web-based interactive 3D visualizations for the MAVEN and MMS missions using the free CesiumJS library. The Mars Atmospheric and Volatile Evolution (MAVEN) mission has been collecting data at Mars since September 2014. The MAVEN3D project allows playback of one day's orbit at a time, displaying the spacecraft's position and orientation. Selected science data sets can be overplotted on the orbit track, including vectors for magnetic field and ion flow velocities. We also provide an overlay the M-GITM model on the planet itself. MAVEN3D is available at the MAVEN public website at: The Magnetospheric MultiScale Mission (MMS) consists of one hundred instruments on four spacecraft flying in formation around Earth, investigating the interactions between the solar wind and Earth's magnetic field. While the highest temporal resolution data isn't received and processed until later, continuous daily observations of the particle and field environments are made available as soon as they are received. Traditional `quick-look' static plots have long been the first interaction with data from a mission of this nature. Our new 3D Quicklook viewer allows data from all four spacecraft to be viewed in an interactive web application as soon as the data is ingested into the MMS Science Data Center, less than one day after collection, in order to better help identify scientifically interesting data.

  10. Strontium-90 and cesium-137 in freshwater (from Sept. 1983 to Dec. 1983)


    Fresh water, 100 l each, was collected, and to which the carriers of strontium and cesium were added immediately after the sampling. The sample was vigorously stirred and filtered, and passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The eluate was used for radiochemical analysis. The chemical separation of strontium-90 and cesium-137 was carried out, and the chemical yields were determined. The precipitates were counted for the activity using low background beta counters normally for 60 min. The net sample counting rate was corrected for the counter efficiency, recovery, self-absorption and decay, to obtain the radioactivity per sample aliquot, and the concentrations of these nuclides in the original samples were calculated. The data at six sampling locations in Japan from September to December, 1983, on fresh water are reported. (Kako, I.)

  11. Studies of cesium and strontium migration in unconsolidated Canadian geological materials

    Gillham, R.W.; Lindsay, L.E.; Reynolds, W.D.; Kewen, T.J.; Cherry, J.A.; Reddy, M.R.


    Distribution coefficients (Ksub(d)) were measured for cesium and strontium in 16 samples of Canadian unconsolidated geological materials. The samples were collected to cover a wide range of grain size, clay-mineral composition, cation exchange capacity and carbonate mineral content. Distribution coefficients ranged between 10 2 and 2.0 x 10 4 ml/g for cesium and between 2.5 and 10 2 ml/g for strontium, indicating that most unconsolidated geological materials have a substantial ability to retard the migration of cesium, while strontium could generally be expected to be somewhat more mobile. The measured K values were not significantly correlated with the measured soil properties, but appeared to be significantly affected by the background concentration of stable isotopes of the respective radionuclides

  12. Effect of K-fertilization, liming and placement on crop uptake of cesium and strontium

    Haak, E.


    remedial measures to reduce crop uptake of cesium and strontium under Swedish field conditions have been investigated in micro plot experiments. For cesium the effect of K-fertilization was studied on three soils with oats, peas and mustard and, in combination with placement, on two other soils with wheat, barley and rape. For strontium the effect of liming was studied on three soils with oats, barley and peas and, in combination with placement, on two other soils with wheat, oats, barley and peas. In this paper results are summarized for the grain products. Deep placement of nuclides in combination with K-fertilization and liming reduced the crop uptake of cesium and strontium by a factor of 10 and 4, respectively. On the basis of the experimental results, the practical advantages of K-fertilization and liming, as well as deep ploughing of surface contaminated land are discussed

  13. Reduction of cesium levels in the diet through management of food

    Gerzabek, M.H.


    Several processes influence the radionuclide concentration of food products during processing: dilution, losses, concentration. Boiling of leaf vegetables yields a decontamination effect of up to 80% in the case of radioiodine. Peeling of potato tubers results in a reduction of the cesium concentration of 30%. The cesium and strontium concentration of flour is a factor of two lower as compared to the corresponding cereal grain due to the milling process. Significant discrimination occurs during the milk processing. The skimmed milk is significantly richer in cesium, iodine and especially in strontium than the cream. It follows that butter is depleted in its radionuclide contents as compared to other milk produce. Strontium is concentrated in the casein. Pressurized cooking in combination with salting or a treatment with acetic acid results in an Cs-activity loss of beef, veal and lamb meat of 50 to 90%. (Author) 3 figs., 7 tabs., 13 refs

  14. Decontamination of Radioactive Cesium Released from Fukushima Daiichi Nuclear Power Plant - 13277

    Parajuli, Durga; Minami, Kimitaka; Tanaka, Hisashi; Kawamoto, Tohru [Nanosystem Research Institute, National Institute of Advanced Industrial Science and Technology - AIST (Japan)


    Peculiar binding of Cesium to the soil clay minerals remained the major obstacle for the immediate Cs-decontamination of soil and materials containing clay minerals like sludge. Experiments for the removal of Cesium from soil and ash samples from different materials were performed in the lab scale. For soil and sludge ash formed by the incineration of municipal sewage sludge, acid treatment at high temperature is effective while washing with water removed Cesium from ashes of plants or burnable garbage. Though total removal seems a difficult task, water-washing of wood-ash or garbage-ash at 40 deg. C removes >90% radiocesium, while >60% activity can be removed from soil and sludge-ash by acid washing at 95 deg. C. (authors)

  15. Effect of Cesium and Xenon Seeding in Negative Hydrogen Ion Sources

    Bacal, M.; Brunteau, A.M.; Deniset, C.; Elizarov, L.I.; Sube, F.; Tontegode, A.Y.; Whealton, J.H.


    It is well known that cesium seeding in volume hydrogen negative ion sources leads to a large reduction of the extracted electron current and in some cases to the enhancement of the negative ion current. The cooling of the electrons due to the addition of this heavy impurity was proposed as a possible cause of the mentioned observations. In order to verify this assumption, the authors seeded the hydrogen plasma with xenon, which has an atomic weight almost equal to that of cesium. The plasma properties were studied in the extraction region of the negative ion source Camembert III using a cylindrical electrostatic probe while the negative ion relative density was studied using laser photodetachment. It is shown that the xenon mixing does not enhance the negative ion density and leads to the increase of the electron density, while the cesium seeding reduces the electron density

  16. Use of cesium-137 to assess soil erosion rates under soybean, coffee and pasture

    Andrello, A.C.; Appoloni, C.R.; Guimaraes, M.F.


    The methodology cesium-137 was used to assess soil erosion and deposition rates in a small watershed with varied crops, at 23 deg 16' S and 51 deg 17' W, in a district of Cambe, Parana State, Brazil. A theoretical equation which considers soil loss or gain directly proportional to the cesium-137 redistribution was utilized in this study. In the watershed, soil redistribution was assessed by transect sampling, and the regional input of cesium-137 by radioactive rainfall determined based on samples from a point in the native forest. Most sampled pasture points presented soil loss, as well as the points in the soybean area under conventional tillage, while in the coffee crop there was neither soil loss nor gain. (author)

  17. Crown bridged thiacalix[4]arenes as cesium-selective ionophores in solvent polymeric membrane electrodes

    Bereczki, Robert; Csokai, Viktor; Gruen, Alajos; Bitter, Istvan; Toth, Klara


    Novel 1,3-alternate thiacalix[4]mono- and biscrown-6 ethers were studied as ionophores in poly(vinyl chloride) membrane electrodes. Their selectivity behavior was characterized with respect to large number of cations, including potential interferents in environmental samples, and the membrane composition was optimized for cesium ion response. Among the ionophores, 1,3-alternate thiacalix[4]mono(crown-6) ether showed, especially high selectivity for cesium over other alkali-metal ions. Transition and heavy metal ions did not interfere seriously with the electrode response, which indicates that the bridging sulfur atoms do not take part in the ion recognition process. The potentiometric cesium responses of all electrodes involved in this study were found close to Nernstian and the detection limits were lower than 10 -7 M. The Cs + /Na + selectivity of the different ionophore-based sensors and the solvent extraction ability of the ligands were interpreted based on the respective constants of complex formation

  18. Studies on synthesis of some composites and their uses for cesium separation

    Someda, H.H.; El-Zahhar, A.A.; Shehata, M.K.K.; El-Naggar, H.A.


    In this study some composite sorbents were prepared by supporting hexacyanoferrate complexes of some transition metals like Co, Ni, Fe and Zn on some different solid supports e.g. cellulose and other natural materials as wood powder. These composites were used for cesium sorption and showed that the highest sorption capacity is for zinc composite and the lowest is for cobalt composite. Also the factors affecting the sorption capacity like acid concentration, competing ions and cesium ion concentration were studied. The release of the sorbed cesium from the composite materials was also studied under different concentrations of different solutions like sodium nitrate, silver nitrate, ammonium nitrate and a mixture of ammonium nitrate and silver nitrate solutions

  19. Phase equilibria and critical phenomena in the cesium nitrate-water-diethylamine ternary system

    Il'in, K.K.; Kurskij, V.F.; Cherkasov, D.G.


    Phase equilibria and critical events in ternary cesium nitrate-water-diethylamine system, where border binary liquid system is characterized by aliquation with lower critical temperature of solution (LCTS), have been investigated by visual-polythermal method in the 60-150 Deg C range. Interaction of cesium nitrate in the water-diethylamine system leads to lowering of its LCTS from 146.1 to 69.3 Deg C and decrease of mutual solubility. Distribution ratios of diethylamine between water and organic phases of monotectic equilibrium are calculated at different temperatures. Diethylamine salting out from aqueous solutions by cesium nitrates becomes stronger with rising temperature. Plotted isotherms of phase confirms generalized scheme of topological transformations of ternary systems phase diagrams: salt-binary solvent with salting out

  20. Physical Property Modeling of Concentrated Cesium Eluate Solutions, Part I - Derivation of Models

    Choi, A.S.; Pierce, R. A.; Edwards, T. B.; Calloway, T. B.


    Major analytes projected to be present in the Hanford Waste Treatment Plant cesium ion-exchange eluate solutions were identified from the available analytical data collected during radioactive bench-scale runs, and a test matrix of cesium eluate solutions was designed within the bounding concentrations of those analytes. A computer model simulating the semi-batch evaporation of cesium eluate solutions was run in conjunction with a multi-electrolyte aqueous system database to calculate the physical properties of each test matrix solution concentrated to the target endpoints of 80% and 100% saturation. The calculated physical properties were analyzed statistically and fitted into mathematical expressions for the bulk solubility, density, viscosity, heat capacity and volume reduction factor as a function of temperature and concentration of each major analyte in the eluate feed. The R{sup 2} of the resulting physical property models ranged from 0.89 to 0.99.

  1. Cesium Ion Exchange Program at the Hanford River Protection Project Waste Treatment Plant



    The River Protection Project - Hanford Tank Waste Treatment and Immobilization Plant will use cesium ion exchange to remove 137Cs from Low Activity Waste down to 0.3 Ci/m3 in the Immobilized LAW, ILAW product. The project baseline for cesium ion exchange is the elutable SuperLig, R, 644, SL-644, resin registered trademark of IBC Advanced Technologies, Inc., American Fork, UT or the Department of Energy approved equivalent. SL-644 is solely available through IBC Advanced Technologies. To provide an alternative to this sole-source resin supply, the RPP--WTP initiated a three-stage process for selection and qualification of an alternative ion exchange resin for cesium removal in the RPPWTP. It was recommended that resorcinol formaldehyde RF be pursued as a potential alternative to SL-644

  2. Characterization of pollucite as a material for the long term storage of cesium-137

    Strachan, D.M.; Schulz, W.W.


    Storage of nuclear waste requires materials which are thermodynamically stable. Pollucite (Cs 2 O . Al 2 O 3 . 4SiO 2 ) may be an acceptable material for the long-term storage of the purified 137 CsCl. Pollucite is made at near theoretical yields when CsCl (or any cesium salt) reacts at about 970 0 K with a montmorillonite-containing clay. Pollucite dissolves in deionized water at rates which are less than 2 x 10 -9 kg/(m 2 . s) based on cesium. Microstructural analyses show that cesium reacts with the montmorillonite clay to form ill-defined pollucite crystals which contain low concentrations of the impurities found in the clay. Although further work needs to be done, pollucite is considered to be an excellent material for the long-term storage of 137 Cs

  3. Ab Initio investigation of cesium monoxide of CsO and CsO+

    Zialenina, M.; Kelloe, V.; Cernusak, I.


    Cesium is material with a low work function and, accordingly, atomic Cs has a low value of ionization energy. Therefore cesium is regarded as a good source material for electrons in plasma heating module. One of plasma heating technologies using Cs grid is foreseen as a candidate for the tokamak within the framework of project ITER. Among the possible impurities that can coexist in this module are CsO or CsO + , due to presence of oxygen traces in the heating chamber. We conducted CCSD(T) energy calculations of the cesium oxide (X 2 Σ + ) and its cation (X 3 Σ - ). Here are presented the bond lengths and spectroscopic parameters of both species and ionization energy (IE). Our IE (6.88 eV) is in good agreement with previous theoretical results, experiment indicates substantially lower value (6.22 eV). (authors)

  4. Use of cesium-137 methodology in the evaluation of superficial erosive processes

    Andrello, Avacir Casanova; Appoloni, Carlos Roberto; Guimaraes, Maria de Fatima; Nascimento Filho, Virgilio Franco do


    Superficial erosion is one of the main soil degradation agents and erosion rates estimations for different edaphic climate conditions for the conventional models, as USLE and RUSLE, are expensive and time-consuming. The use of cesium- 137 anthropogenic radionuclide is a new methodology that has been much studied and its application in the erosion soil evaluation has grown in countries as USA, UK, Australia and others. A brief narration of this methodology is being presented, as the development of the equations utilized for the erosion rates quantification through the cesium- 137 measurements. Two watersheds studied in Brazil have shown that the cesium- 137 methodology was practicable and coherent with the survey in field for applications in erosion studies. (author)

  5. Determination of the cesium distribution coeficient in Goiania and Abadia de Goias cities soils

    Marumo, J.T.; Suarez, A.A.


    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias's city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57 th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficient for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author) [pt

  6. Determination of the cesium distribution coefficient in Goiania and Abadia de Goias cities soils

    Marumo, J.T.; Suarez, A.A.


    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57 th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficent for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author) [pt

  7. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116


    ... Guide 1.38, ``Quality Assurance Requirements for Packaging, Shipping, Receiving, Storage, and Handling....116, ``Quality Assurance Requirements for Installation, Inspection, and Testing of Mechanical... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research, U.S. Nuclear Regulatory...

  8. Cesium removal from liquid acidic wastes with the primary focus on ammonium molybdophosphate as an ion exchanger: A literature review

    Miller, C.J.


    Many articles have been written concerning the selective removal of cesium from both acidic and alkaline defense wastes. The majority of the work performed for cesium removal from defense wastes involves alkaline feed solutions. Several different techniques for cesium removal from acidic solutions have been evaluated such as precipitation, solvent extraction, and ion exchange. The purpose of this paper is to briefly review various techniques for cesium removal from acidic solutions. The main focus of the review will be on ion exchange techniques, particularly those involving ammonium molybdophosphate as the exchanger. The pertinent literature sources are condensed into a single document for quick reference. The information contained in this document was used as an aid in determining techniques to evaluate cesium removal from the acidic Idaho Chemical Processing Plant waste matrices. 47 refs., 2 tabs

  9. A distribution of adsorbed forms of cesium 137 and strontium 90 in flood-plain formations of Sozh river

    Kuznetsov, V.A.; Generalova, V.A.


    The distribution of strontium 90 and cesium 137 forms in flood-plain geochemical system 'alluvial deposits - flood-plain turf - humus horizon - soil-source rock', where sorption and colloidal processes play main role in the isotopes migration, was studied. The bulk amount of strontium 90 is presented in adsorbed form in all investigated objects, whereas only 6% of cesium 137 amount in alluvial deposits, flood-plain turf and humus horizon is in adsorbed form. The content of exchange forms of cesium 137 and strontium 90 increases with the depth of the layer. The race of this increase for strontium 90 is large than for cesium 137. The distribution of radionuclides through the different parts of flood-plain of Sozh river has some distinctions due to more lability of adsorbed strontium 90 forms in comparison with cesium 137 ones

  10. Effect of miR-138 on the antioxidant function of lens epithelial cells affected by age-related cataracts

    Bo Lu


    Full Text Available AIM: To investigate the effects and mechanism of miR-138 in mediating the antioxidant function of lens epithelial cells affected by age-related cataracts. METHODS: Real-time quantitative PCR(RT-qPCRwas used to detect miR-138 expression in the anterior lens capsules of healthy people, the anterior lens capsules of patients with age-related cataracts, and human epithelial cell line(SRA01/04cells exposed to oxidative stress. A 2', 7'-dichloro-fluorescein diacetate(DCFH-DAprobe was used to measure the levels of endogenous reactive oxygen species(ROSin human lens epithelial cells(hLECsexposed to 400μmol/L H2O2 for 1h. SRA01/04 cells were transfected with either miR-138 mimics, mimic controls, miR-138 inhibitors or inhibitor controls. After 72h, these cells were exposed to 400μmol/L H2O2 for 1h, then p53 and Bax mRNA expression were measured using RT-qPCR. Expression of p53 and Bax protein were also measured by western blotting analysis. Finally, cell viability was assessed using an MTS assay. RESULTS: Compared to the control group, expression of miR-138 in the anterior lens capsules of age-related cataract patients and in SRA01/04 cells exposed to oxidative stress significantly increased(PPPPCONCLUSION: The expression of miR-138 is upregulated in the anterior lens capsules of age-related cataract patients. MiR-138 decreases the anti-oxidative stress capacity of lens epithelial cells by upregulating p53 and Bax, while inhibiting cell proliferation and repair. This finding suggests that miR-138 may play a key role in the development of age-related cataracts.

  11. Metabolism of 137cesium, 137barium in the rat. Therapeutics of the contamination

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C.


    The authors carry out research into the distribution kinetics, the metabolism and the excretion of 137 Cs - 137 Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [fr

  12. Chernobyl cesium in the soil of Montenegro, eight years after the accident

    Borisov, G. I.; Kuzmic, V. V.; Vukotic, P.; Dapcevic, S.; Antovic, N.; Mirkovic, M.; Fustic, B.


    Radioactive cesium contamination of the territory of Montenegro is measured by in situ method of semiconductor gamma-spectrometry at the end of the end of the year 1994. On basis of geological and pedological characteristics of the region, 42 measurement sites are chosen, which are representative for large area and uniformly distributed over the territory of Republic. It is found that degree of contamination varies strongly from region to region. Surface activities of 137 Cs span 3700 to 74000 Bq/m 2 range. Radioactive cesium is mostly remained in the surface part of uncultivated soil. 14 refs.; 3 figs

  13. Recent advances of numerical simulation studies for radioactive cesium adsorption on soil materials

    Okumura, Masahiko; Nakamura, Hiroki; Machida, Masahiko


    Radiocesium (Cesium 134 and 137) emitted from destroyed Fukushima Daiichi Nuclear Power Production Station is known mostly to remain for a long time on earth's surfaces and to become sources of radiation exposure to habitants. Large scale decontamination work carried out by national and local governments inevitably produces tremendous amount of radioactive wastes of soils whose volume must be effectively and economically reduced based on a scientifically reliable technique. This paper employs the atomic and molecular simulation method applied to adsorption mechanism of soils and cesium ions and presents the examples of proposals with the results of this field. (S. Ohno)

  14. Transfer of radio-cesium from forest soil to woodchips using fungal activities

    Kaneko, Nobuhiro; Huang, Yao; Tanaka, Yoichiro; Fujiwara, Yoshihiro; Sasaki, Michiko; Toda, Hiroto; Takahashi, Terumasa; Kobayashi, Tatsuaki; Harada, Naoki; Nonaka, Masahiro


    Raido-cesium released to terrestrial ecosystems by nuclear accidents is know to accumulate forest soil and organic layer on the soil. Forests in Japan are not exceptions. Practically it is impossible to decontaminate large area of forests. However, there is a strong demand from local people, who has been using secondary forests (Satoyama) around croplands in hilly areas, to decontaminate radio-cesium, because those people used to collect wild mushrooms and edible plants, and there are active cultures of mushrooms using logs and sawdusts. These natural resource uses consist substantial part of their economical activities, Therefore it is needed to decontaminate some selected part of forests in Japan to local economy. Clear cutting and scraping surface soil and organic matter are common methods of decontamination. However the efficiency of decontamination is up to 30% reduction of aerial radiation, and the cost to preserve contaminated debris is not affordable. In this study we used wood chips as a growth media for saprotrophic fungi which are known to accumulate redio-cesium. There are many studies indicated that mushrooms accumulated redio-cesium from forest soil and organic layer. It is not practical to collect mushrooms to decontaminate redio-cesium, because biomass of mushrooms are not enough to collect total contaminants. Mushrooms are only minor part of saprotrophic fungi. Fungal biomass in forest soil is about 1% of dead organic matter on forest floor. Our previous study to observe Cs accumulation to decomposing leaf litter indicated 18% absorption of total soil radio-Cs to litter during one year field incubation (Kaneko et al., 2013), and Cs concentration was proportional to fungal biomass on litter. This result indicated that fungi transferred radio-cesium around newly supplied leaf litter free of contamination. Therefore effective decontamination will be possible if we can provide large amount of growth media for saprotrophic fungi, and the media can be

  15. Fallout cesium-137 and mineral-element distribution in food chains of granitic-outcrop ecosystems

    Crossley, D.A. Jr.; Duke, K.M.; Waide, J.B.


    Fallout 137 Cs movement is described for arthropod food chains on Panola and Arabia mountains, granite monadnocks in the Georgia Piedmont region. Food chains on mountain slopes had significant 137 Cs in herbivore and predator trophic levels. Food bases were identified from observation and from cesium to potassium ratios in vegetation and arthropods. Lichens are major accumulators of fallout 137 Cs but do not appear to be important food sources for arthropods. Cesium-137 concentrations decrease in the food chains; these decreases resemble those reported for other terrestrial arthropod chains. Aspects of 137 Cs movement and nutrient-element dynamics in granitic-outcrop ecosystems are discussed

  16. Behaviour of cesium in contaminated soils with and without agricultural practices

    Arapis, G.; Martinez, A.; Millan, R.; Gutierrez, J.


    The migration of cesium into affected agricultural soils, five years after the Chernobyl accident, is examined in this study. Samples of soil were taken from an undisturbed non-cultivated rural area in the north of Greece, where an important contamination has been detected. The migration of 137 Cs into these soils was measured by γ spectrometry. Slight movement of 137 Cs was observed during the five year period following the accident. The agricultural practices, used in this area from 1986 up to now, have diluted the contamination into the 0-40 cm horizon and thus only low concentration of cesium in the cultivated soils was detected. (orig.)

  17. Psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

    Ferreira, Celia Marly


    The presented work had as objective the accomplishment of a comparative study of cesium-137 radioactive element effects in the psychological and motor development of children which were going submitted the intra-uterus irradiation during the chronological age of three years. The comparison of the results of study is done through a group-control composed for five children without any involvement with the cesium-137 accident - occurred in 1987 in Goiania, Brazil - of same social, economic and cultural level and with the same age of the reached

  18. Results from annual testing of ARECO cesium capsules from 1990-1994

    Lundeen, J.E.


    The purpose of this report is to compile the results of the cesium capsule inspections and testing at the Applied Radiant Energy Corporation (ARECO) facility in Lynchburg, VA, performed in 1990, 1991, 1992, 1993, and 1994. The 25 cesium capsules at the ARECO facility were visually identified and clunk tested. A Go/No Go gauge test was required for capsules failing the clunk test. A visual inspection of capsules was required for the initial testing (1990). All 25 capsules passed the inspections and testing each year.

  19. Development of a solvent extraction process for cesium removal from SRS tank waste

    Leonard, R.A.; Conner, C.; Liberatore, M.W.; Sedlet, J.; Aase, S.B.; Vandegrift, G.F.; Delmau, L.H.; Bonnesen, P.V.; Moyer, B.A.


    An alkaline-side solvent extraction process was developed for cesium removal from Savannah River Site (SRS) tank waste. The process was invented at Oak Ridge National Laboratory and developed and tested at Argonne National Laboratory using singlestage and multistage tests in a laboratory-scale centrifugal contactor. The dispersion number, hydraulic performance, stage efficiency, and general operability of the process flowsheet were determined. Based on these tests, further solvent development work was done. The final solvent formulation appears to be an excellent candidate for removing cesium from SRS tank waste.

  20. Release of tellurium and cesium from UO2 in LWR fuel rods during irradiation

    Malen, K.A.


    In this paper the release of tellurium (Te-132) and cesium (Cs-134 and Cs-137) from UO 2 -fuel is analyzed. The basis for the analysis is the experimental results from the S176 series of experiments performed at Studsvik. It seems that the model developed earlier for release of iodine applies also to tellurium and cesium. This model assumes sweeping up of the species in question by moving grain boundaries and subsequent release through grain boundary porosity. An interesting extra feature is deposition of tellurium at temperatures in the range 1500-2000 K believed to be due to condensation. (author)

  1. Deviation from local thermodynamic equilibrium in a cesium-seeded argon plasma

    Stefanov, B.; Zarkova, L.


    The possibility of deviations from local thermodynamic equilibrium of a cesium seeded argon plasma has been analyzed. A four level model of cesium has been employed. Overpopulations of the ground state and the first excited state as well as the corresponding reduction of the electron density are calculated for cylindrical discharge structures by solving stationary rate equations. Numerical results are presented. These results indicate that in a large regime of plasma conditions the LTE assumption is valid for electron temperatures larger than 3000 K. (orig.)

  2. Separation of cesium from simulated active waste using zinc hexacyanoferrate supported composite

    Somida, H.H.; El Zahhar, A.A.; Shehata, M.K.; El Naggar, H.A.


    Potassium zinc hexacyanoferrate (KZnHCF) was prepared and supported on polyacrylonitrile (PAN) binding polymer. This composite was characterized and used to study the elimination of cesium from acidic radioactive waste containing Sr(II), Eu(II), Am(II), Zr(IV), Hf(IV) and Nb(V) using batch and column techniques. The sorption capacity of this composite for cesium was found to be 1.14 meq/g for column technique. The effect of presence of NH 4 SCN, NaNo 3 and other complexing agents in the aqueous solutions was studied

  3. Heat Transfer During Evaporation of Cesium From Graphite Surface in an Argon Environment

    Bespala Evgeny


    Full Text Available The article focuses on discussion of problem of graphite radioactive waste formation and accumulation. It is shown that irradiated nuclear graphite being inalienable part of uranium-graphite reactor may contain fission and activation products. Much attention is given to the process of formation of radioactive cesium on the graphite element surface. It is described a process of plasma decontamination of irradiated graphite in inert argon atmosphere. Quasi-one mathematical model is offered, it describes heat transfer process in graphite-cesium-argon system. Article shows results of calculation of temperature field inside the unit cell. Authors determined the factors which influence on temperature change.

  4. Distribution Coefficient Kd of Cesium in Soils from Areas in Perak

    Azian Hashim; Mohd Suhaimi Hamzah; Shamsiah Abdul Rahman; Nazaratul Ashifa Abdullah Salim; Md Suhaimi Elias; Shakirah Shukor; Muhd Azfar Azman; Siti Aminah Omar


    This is the paper reports on the study of distribution coefficient or Kd value in soil collected from the Western of Perak, which is Manjung, Setiawan, and Lahat with two different depths using lab batch method. Particle sizes were analyzed using the conventional technique known as pipette method. pH of the sample were 2-3. Determinations for cesium were performed using Inductively Coupled Plasma-Mass (ICP-MS). From the results, distribution factor for cesium, Kd value, was found to be influenced by the particle size of soil. (author)

  5. Sensitivity of cesium chemistry to the O/U radio in UO2+x

    McFarlane, J.; LeBlanc, J.C.; Owen, D.G.


    The effect of O/U ratio on chemical reactivity was investigated in a cesium-iodide/uranium/tungsten system at temperatures up to 2200 K. It was found that slight changes in the oxidation of the urania had a large effect on reactivity. Crushed fresh fuel samples showed little reaction with CsI; however, slightly hyperstoichiometric fuel showed considerable reaction. The tungsten participated in the reaction by removing excess oxygen from the urania, eventually leading to a cesium tungstate species that was analyzed by Fourier Transform Infrared (FTIR) and X-ray diffraction (XRD) techniques. (author)

  6. A preliminary deposit model for lithium-cesium-tantalum (LCT) pegmatites

    Bradley, Dwight; McCauley, Andrew


    This report is part of an effort by the U.S. Geological Survey to update existing mineral deposit models and to develop new ones. We emphasize practical aspects of pegmatite geology that might directly or indirectly help in exploration for lithium-cesium-tantalum (LCT) pegmatites, or for assessing regions for pegmatite-related mineral resource potential. These deposits are an important link in the world’s supply chain of rare and strategic elements, accounting for about one-third of world lithium production, most of the tantalum, and all of the cesium.

  7. Alkali-iodide/urania systems at high temperatures. 1. Cesium uranate chemistry

    McFarlane, J.; LeBlanc, J.C.


    Uranate compounds are likely to form in irradiated fuel from the reaction between UO 2 and fission products along UO 2 grain boundaries and in the fuel-cladding gap. Literature on the high-temperature chemistry of cesium and rubidium uranates was reviewed. Results from Knudsen cell experiments from 900 to 2600 K on cesium uranates are discussed. These studies indicate that the uranate phases formed depend on the oxygen potential of the system, which varies with the composition of the condensed phase. 62 refs., 12 figs., 6 tabs., 2 appendices

  8. Study of the removal of cesium from aqueous solutions by graphene oxide

    Bueno, Vanessa N.; Rodrigues, Debora F.; Vitta, Patricia B. Di


    Graphene oxide, used in this work, was synthesized from the oxidation of graphite by Hummer method. The experiments were performed in batch and analyzed for the following parameters: contact time, pH, cesium ion concentration in aqueous solution and removing capacity of the graphene oxide. After the experiments the samples were vacuum filtered and the remaining cesium in solution was quantified by Inductively Coupled Plasma Optical Emission Spectrometry (ICP-OES). The equilibrium was reached after 60 minutes of contact in neutral solution. The percentage of removal was around 80%

  9. Silencing of microRNA-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes by targeting FOXC1: miR-138 promotes cartilage degradation.

    Yuan, Y; Zhang, G Q; Chai, W; Ni, M; Xu, C; Chen, J Y


    Osteoarthritis (OA) is characterised by articular cartilage degradation. MicroRNAs (miRNAs) have been identified in the development of OA. The purpose of our study was to explore the functional role and underlying mechanism of miR-138-5p in interleukin-1 beta (IL-1β)-induced extracellular matrix (ECM) degradation of OA cartilage. Human articular cartilage was obtained from patients with and without OA, and chondrocytes were isolated and stimulated by IL-1β. The expression levels of miR-138-5p in cartilage and chondrocytes were both determined. After transfection with miR-138-5p mimics, allele-specific oligonucleotide (ASO)-miR-138-5p, or their negative controls, the messenger RNA (mRNA) levels of aggrecan (ACAN), collagen type II and alpha 1 (COL2A1), the protein levels of glycosaminoglycans (GAGs), and both the mRNA and protein levels of matrix metalloproteinase (MMP)-13 were evaluated. Luciferase reporter assay, quantitative real-time polymerase chain reaction (qRT-PCR), and Western blot were performed to explore whether Forkhead Box C1 (FOCX1) was a target of miR-138-5p. Further, we co-transfected OA chondrocytes with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 and then stimulated with IL-1β to determine whether miR-138-5p-mediated IL-1β-induced cartilage matrix degradation resulted from targeting FOXC1. MiR-138-5p was significantly increased in OA cartilage and in chondrocytes in response to IL-1β-stimulation. Overexpression of miR-138-5p significantly increased the IL-1β-induced downregulation of COL2A1, ACAN, and GAGs, and increased the IL-1β-induced over expression of MMP-13.We found that FOXC1 is directly regulated by miR-138-5p. Additionally, co-transfection with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 resulted in higher levels of COL2A1, ACAN, and GAGs, but lower levels of MMP-13. miR-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes, possibly by targeting FOXC1.Cite this article: Y. Yuan, G. Q. Zhang, W. Chai,M. Ni, C. Xu, J

  10. Crossing 138: two approaches to churn under the Affordable Care Act.

    Ravel, Gabriel; DeSantis, J Angelo


    A predicted side effect of the Medicaid expansion and state-based Exchanges under the Affordable Care Act is churn. Churn is the shifting into and out of eligibility for insurance affordability programs due to income changes. Because the line between Medicaid and Exchange eligibility is fine -138% of the federal poverty level -millions of Americans are expected to gain and lose eligibility. Frequently, this churning undermines continuity of care, raises costs, and frustrates those affected. This article explores two proposed programs to mitigate the effects of churn: the Basic Health Program and the Bridge Program. This article evaluates both programs' ability to mitigate the effects of churn, the likely side effects to states' implementing them, and legal and practical obstacles to their implementation. It concludes that the Bridge Program is the better approach.

  11. Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

    Marley, J.L.


    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs

  12. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie


    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all...... environmental matrixes including human adipose tissue, blood and milk. In most biological extracts PCB#138 (2,2',3,4,4',5-hexaCB), PCB#153 (2,2',4,4',5,5'-hexaCB), and PCB#180 (2,2',3,4,4',5,5'-heptaCB) are the dominating components. Depending on the position and number of chlorine substitutions, different...... classes of PCB congeners elicit a complex spectrum of biological and toxic responses in in vivo and in vitro models. Some PCBs exert dioxin-like activities mediated through the aryl hydrocarbon receptor (Ah receptor) giving rise to health risk such as organ toxicity and carcinogenesis. Although reports...

  13. Sh2-138: physical environment around a small cluster of massive stars

    Baug, T.; Ojha, D. K.; Dewangan, L. K.; Ninan, J. P.; Bhatt, B. C.; Ghosh, S. K.; Mallick, K. K.


    We present a multiwavelength study of the Sh2-138, a Galactic compact H II region. The data comprise of optical and near-infrared (NIR) photometric and spectroscopic observations from the 2-m Himalayan Chandra Telescope, radio observations from the Giant Metrewave Radio Telescope (GMRT), and archival data covering radio through NIR wavelengths. A total of 10 Class I and 54 Class II young stellar objects (YSOs) are identified in a 4.6 arcmin×4.6 arcmin area of the Sh2-138 region. Five compact ionized clumps, with four lacking of any optical or NIR counterparts, are identified using the 1280 MHz radio map, and correspond to sources with spectral type earlier than B0.5. Free-free emission spectral energy distribution fitting of the central compact H II region yields an electron density of ˜2250 ± 400 cm-3. With the aid of a wide range of spectra, from 0.5-15 μm, the central brightest source - previously hypothesized to be the main ionizing source - is characterized as a Herbig Be type star. At large scale (15 arcmin ×15 arcmin), the Herschel images (70-500 μm) and the nearest neighbour analysis of YSOs suggest the formation of an isolated cluster at the junction of filaments. Furthermore, using a greybody fit to the dust spectrum, the cluster is found to be associated with the highest column density (˜3 × 1022 cm-2) and high temperature (˜35 K) regime, as well as with the radio continuum emission. The mass of the central clump seen in the column density map is estimated to be ˜3770 M⊙.

  14. Assessment of bone marrow plasma cell infiltrates in multiple myeloma: the added value of CD138 immunohistochemistry

    Al-Quran, Samer Z.; Yang, Lijun; Magill, James M.; Braylan, Raul C.; Douglas-Nikitin, Vonda K.


    Summary Assessment of bone marrow involvement by malignant plasma cells is an important element in the diagnosis and follow-up of patients with multiple myeloma and other plasma cell dyscrasias. Microscope-based differential counts of bone marrow aspirates are used as the primary method to evaluate bone marrow plasma cell percentages. However, multiple myeloma is often a focal process, a fact that impacts the accuracy and reliability of the results of bone marrow plasma cell percentages obtained by differential counts of bone marrow aspirate smears. Moreover, the interobserver and intraobserver reproducibility of counting bone marrow plasma cells microscopically has not been adequately tested. CD138 allows excellent assessment of plasma cell numbers and distribution in bone marrow biopsies. We compared estimates of plasma cell percentages in bone marrow aspirates and in hematoxylin-eosin– and CD138-stained bone marrow biopsy sections (CD138 sections) in 79 bone marrows from patients with multiple myeloma. There was a notable discrepancy in bone marrow plasma cell percentages using the different methods of observation. In particular, there was a relatively poor concordance of plasma cell percentage estimation between aspirate smears and CD138 sections. Estimates of plasma cell percentage using CD138 sections demonstrated the highest interobserver concordance. This observation was supported by computer-assisted image analysis. In addition, CD138 expression highlighted patterns of plasma cell infiltration indicative of neoplasia even in the absence of plasmacytosis. We conclude that examination of CD138 sections should be considered for routine use in the estimation of plasma cell load in the bone marrow. PMID:17714757

  15. Strontium-90 and cesium-137 in sea fish (from Oct. 1981 to Jun. 1982)


    Strontium-90 and cesium-137 in sea fishes (from Oct. 1981 to Jun. 1982) were determined. Fish was collected from eight sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are shown in a table. (Namekawa, K.)

  16. Strontium-90 and cesium-137 in sea fish (from Jun. 1982 to Dec. 1982)


    Strontium-90 and cesium-137 in sea fish (from Jun. to Dec. 1982) were determined. Fish was collected from 22 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are sown in a table. (Namekawa, K.)

  17. Immobilization of aqueous radioactive cesium wastes by conversion to aluminosilicate minerals

    Barney, G.S.


    Radioactive cesium (primarily 137 Cs) is a major toxic constituent of liquid wastes from nuclear fuel processing plants. Because of the long half-life, highly penetrating radiation, and mobility of 137 Cs, it is necessary to convert wastes containing this radioisotope into a solid form which will prevent movement to the biosphere during long-term storage. A method for converting cesium wastes to solid, highly insoluble, thermally stable aluminosilicate minerals is described. Aluminum silicate clays (bentonite, kaolin, or pyrophyllite) or hydrous aluminosilicate gels are reacted with basic waste solutions to form pollucite, cesium zeolite (Cs-D), Cs-F, cancrinite, or nepheline. Cesium is trapped in the aluminosilicate crystal lattice of the mineral and is permanently immobilized. The identity of the mineral product is dependent on the waste composition and the SiO 2 /Al 2 O 3 ratio of the clay or gel. The stoichiometry and kinetics of mineral formation reactions are described. The products are evaluated with respect to leachability, thermal stability, and crystal morphology. (U.S.)

  18. Evaluation of distribution coefficients for the prediction of strontium and cesium migration in a uniform sand

    Reynolds, W.D.; Gillham, R.W.; Cherry, J.A.


    The validity of using a distribution coefficient (Ksub(d)) in the mathematical prediction of strontium and cesium transport through uniform saturated sand was investigated by comparing measured breakthrough curves with curves of simulations using the advection-dispersion and the advection equations. Values for Ksub(d) were determined by batch equilibration tests and, indirectly, by fitting the mathematical model to breakthrough data from column experiments. Although the advection-dispersion equation accurately represented the breakthrough curves for two nonreactive solutes (chloride and tritium), neither it nor the advection equation provided close representations of the strontium and cesium curves. The simulated breakthrough curves for strontium and cesium were nearly symmetrical, whereas the data curves were very asymmetrical, with long tails. Column experiments with different pore-water velocities indicated that the shape of the normalized breakthrough curves was not sensitive to velocity. This suggests that the asymmetry of the measured curves was the result of nonlinear partitioning of the cations between the solid and liquid phases, rather than nonequilibrium effects. The results indicate that the distribution coefficient, when used in advection-dispersion models for prediction of the migration of strontium and cesium in field situations, can result in significant error

  19. Strontium-90 and cesium-137 in freshwater (from September, 1982, to December, 1982)


    Strontium-90 and cesium-137 in fresh water measured at 4 locations across Japan from September to December, 1982, are given in pCi/l, respectively. The methods of the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, and the counting are also described. The sample was passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The sample solution prepared was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitate was counted for activity using a low background beta counter normally for 60 min. The radioactivity ranged 0.08 to 0.22 pCi/l for Sr-90 and 0.003 to 0.020 pCi/l for Cs-137 in the freshwater. (J.P.N.)

  20. Strontium-90 and cesium-137 in service water (from June, 1982, to December, 1982)


    Strontium-90 and cesium-137 in service water measured at 19 locations across Japan from June to December, 1982, are given in pCi/l, respectively. The methods of the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, and the counting are also described. Service water was collected at an intake of the water-treatment plant and at the tap. The sample was then passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The sample solution prepared was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitate was counted for activity using a low background beta counter normally for 60 min. The radioactivity ranged 0.01 to 0.10 pCi/l for Sr-90 and 0.001 to 0.010 pCi/l for Cs-137 in the service water. (J.P.N.)

  1. Evaluating water erosion prediction project model using Cesium-137-derived spatial soil redistribution data

    The lack of spatial soil erosion data has been a major constraint on the refinement and application of physically based erosion models. Spatially distributed models can only be thoroughly validated with distributed erosion data. The fallout cesium-137 has been widely used to generate spatial soil re...

  2. Therapeutic effects of cesium-137 radiation in head and neck malignancy

    Lee, J.W.


    In radiation therapy, many fundamental physical and biological facts and theories must be applied in order to establish a scientific level of practice. There is a voluminous amount of information pertaining to these matters. Cesium-137 is a radioactive nuclide available as a fission product from nuclear reactions. Cesium-137 emits gamma rays at 0.663 MeV. Its half life of about 30 years is an advantage over that of cobalt-60, but cesium-137 is lower, and the specific activity is much less. Author has clinically observed of 150 cases of cesium-137 therapy on head and neck malignancies from Jan. 1971 to Oct. 1978. The following results were observed: 1) Age distribution showed predilection in fifth and decades and sex ratio revealed higher in male than female about 4 times. 2) Laryngeal cancer (34%) maxillary cancer (20.7%) and tongue cancer (12%) occupied high incidence in classification of disease. 3) The cases of radiation only therapeutic group (5000-7000 rad) revealed 61 cases (41.2%) and pre and post operative radiation group (1000-3000 rad) revealed 36 cases (24.3%). 4) In combined therapy (60 cases) arterial infusion group revealed 29 cases and 10 cases of operative group, 11 cases of well prognostic group respectively. (author)

  3. Physical barrier effect of geopolymeric waste form on diffusivity of cesium and strontium.

    Jang, J G; Park, S M; Lee, H K


    The present study investigates the physical barrier effect of geopolymeric waste form on leaching behavior of cesium and strontium. Fly ash-based geopolymers and slag-blended geopolymers were used as solidification agents. The leaching behavior of cesium and strontium from geopolymers was evaluated in accordance with ANSI/ANS-16.1. The diffusivity of cesium and strontium in a fly ash-based geopolymer was lower than that in Portland cement by a factor of 10(3) and 10(4), respectively, showing significantly improved immobilization performance. The leaching resistance of fly ash-based geopolymer was relatively constant regardless of the type of fly ash. The diffusivity of water-soluble cesium and strontium ions were highly correlated with the critical pore diameter of the binder. The critical pore diameter of the fly ash-based geopolymer was remarkably smaller than those of Portland cement and slag-blended geopolymer; consequently, its ability physically to retard the diffusion of nuclides (physical barrier effect) was superior. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Physical barrier effect of geopolymeric waste form on diffusivity of cesium and strontium

    Jang, J.G.; Park, S.M.; Lee, H.K., E-mail:


    Highlights: • Physical immobilization of radionuclides in geopolymer was quantitatively assessed. • Fly ash-based geopolymer showed excellent immobilization performance. • Diffusivity of soluble Cs and Sr was highly correlated with critical pore diameter. - Abstract: The present study investigates the physical barrier effect of geopolymeric waste form on leaching behavior of cesium and strontium. Fly ash-based geopolymers and slag-blended geopolymers were used as solidification agents. The leaching behavior of cesium and strontium from geopolymers was evaluated in accordance with ANSI/ANS-16.1. The diffusivity of cesium and strontium in a fly ash-based geopolymer was lower than that in Portland cement by a factor of 10{sup 3} and 10{sup 4}, respectively, showing significantly improved immobilization performance. The leaching resistance of fly ash-based geopolymer was relatively constant regardless of the type of fly ash. The diffusivity of water-soluble cesium and strontium ions were highly correlated with the critical pore diameter of the binder. The critical pore diameter of the fly ash-based geopolymer was remarkably smaller than those of Portland cement and slag-blended geopolymer; consequently, its ability physically to retard the diffusion of nuclides (physical barrier effect) was superior.

  5. Thermodynamics of soluble fission products cesium and iodine in the Molten Salt Reactor

    Capelli, E.; Beneš, O.; Konings, R.J.M.


    The present study describes the full thermodynamic assessment of the Li,Cs,Th//F,I system. The existing database for the relevant fluoride salts considered as fuel for the Molten Salt Reactor (MSR) has been extended with two key fission products, cesium and iodine. A complete evaluation of all

  6. Removal of cesium and strontium from low active waste solutions by zeolites

    Jain, Savita; Ramaswamy, M.; Theyyunni, T.K.


    Ion exchange, crystallographic and thermal characteristics of sodium, cesium and strontium forms of locally available synthetic zeolites have been investigated. X-ray and differential thermal analyses have confirmed that the synthetic materials AR1 and 4A belonged to the mordenite and A type families of zeolites respectively. Equilibrium uptake of cesium and strontium ions by sodium forms of zeolite was studied as a function of time, pH and sodium concentration. It was found that the rate of sorption by AR1 was higher than that by 4A. In regard to pH, distribution of nuclides on zeolites was found to pass through maxima at a pH value of around 9. Sodium ion interfered with the sorption of cesium and strontium by zeolites. However, at sodium concentration ≤ 0.01 M, distribution coefficient values for these nuclides were sufficiently high to merit consideration of these zeolites for low level waste treatment. Lab-scale column runs using 5 ml beds of materials showed that the zeolites AR1 and 4A were very effective in removing cesium and strontium nuclides respectively from large volumes (a decontamination factor of 50 for a throughput of 6000 bed volumes) of actual low level waste solutions. Thus, the zeolite system has a potential future for large scale application in the treatment of low level wastes. (author). 6 refs., 5 figs., 6 tabs

  7. Strontium-90 and cesium-137 in sea fish (from Nov. 1982 to Jun. 1983)


    Strontium-90 and cesium-137 in sea fish (from Nov. 1982 to Jun. 1983) were determined. Fishes were collected from eight sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are shown in a table. (J.P.N.)

  8. Decontamination of radioactive cesium in soil using nano-size metallic calcium dispersing

    Mitoma, Yoshiharu; Fukuoka, Takezo; Matsue, Hideaki; Kobayashi, Hidemasa; Shiraishi, Hiroaki; Kajitani, Mikio


    In Japan, the major concern on radioactive cesium ( 134 Cs and 137 Cs) deposition and soil contamination due to the emission form the Fukushima Dai-ichi nuclear power plant showed up after a massive quake on March 11, 2011. Soil contamination with radioactive cesium has a long-term radiological impact due to its long half-life (30 years for 137 Cs) and its high biological hazard. Therefore, much attention has been paid to decontaminate Cs-contaminated soil with washing and/or extraction by adopting solvents. However, such wet methods have some disadvantages, i.e. forming of secondary effluents and additional cost for their treatment. We have recently shown that the nano-size metallic calcium/calcium oxide/iron dispersing mixture (Fe-nCa) is most effective for heavy metals immobilization and volume reduction method under dry condition. Thus, we applied this method to treat real radioactive cesium contaminated soils in dry condition. Simple stirring of the contaminated soil with Fe-nCa achieved about above 90% of radioactive Cs decontamination rate and the volume reduction level also reached around 50-60%. In this paper, we showed the effectiveness of a Fe-nCa method for the rapid remediation and volume reduction method of real radioactive cesium contaminated soils under dry conditions and our challenges for sophistication applying machine and reagents. (author)

  9. Cesium sorption from concentrated acidic tank wastes using ammonium molybdophosphate-polyacrylonitrile composite sorbents

    Todd, T.A.; Mann, N.R.; Tranter, T.J.; Sebesta, F.; John, J.; Motl, A.


    Ammonium molybdophosphate-polyacrylonitrile (AMP-PAN) composite sorbents have been evaluated for the removal of cesium from Idaho National Engineering and Environmental Laboratory (INEEL) concentrated acidic tank waste. Batch contacts were performed to qualitatively evaluate the effects of increased nitric acid, sodium and potassium. An equilibrium isotherm was generated with simulated concentrated tank waste solutions and fit to the Langmuir equation. Additional batch contact experiments were performed to determine if mercury, plutonium and americium would sorb onto AMP-PAN. Dynamic sorption was evaluated in column tests employing 1.5 cm 3 columns operating at 5, 10 and 20 bed volumes of flow per hour. Results indicate, as expected, that dynamic cesium sorption capacity is reduced as the flowrate is increased. Calculated dynamic capacities for cesium were 22.5, 19.8 and 19.6 mg Cs/g sorbent, for 5, 10 and 20 bed volume per hour flows, respectively. The thermal stability of loaded AMP-PAN was evaluated by performing thermogravimetric analysis (TGA) on samples of AMP, PAN (polymer), and AMP-PAN. Results indicate that AMP-PAN is stable to 400 deg C, with less than a 10% loss of weight, which is at least partially due to loss of water of hydration. The evaluation of AMP-PAN indicates that it will effectively remove cesium from concentrated acidic tank waste solutions. (author)

  10. Strontium-90 and cesium-137 in total diet (from Jun. 1982 to Dec. 1982)


    Strontium-90 and cesium-137 in total diet (from Jun. to Dec. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 22 sampling locations. The results are shown in a table. (Namekawa, K.)

  11. Strontium-90 and cesium-137 in total diet (from Nov. 1982 to Jun. 1983)


    Strontium-90 and cesium-137 in total diet (from Nov. 1982 to Jun. 1983) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 26 sampling locations. The results are shown in a table. (J.P.N.)

  12. Strontium-90 and cesium-137 in total diet (from Oct. 1981 to Jul. 1982)


    Strontium-90 and cesium-137 in total diet (from Oct. 1981 to Jul. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 26 sampling locations. The results are shown in a table. (Namekawa, K.)

  13. Transfer of radioactive cesium from soil to rape plants, rape blossoms and rape honey

    Molzahn, D.; Klepsch, A.; Assmann-Wertmueller, U.


    Due to the test of atomic weapons and the accident in the nuclear power plant at Chernobyl, the vegetation in Germany has been exposed to cesium contamination in the soil. It was to be expected that activity would migrate from soil to plants and to food products. In this work, the transfer of radioactive cesium from soil to rape plants (Brassica napus var. oleifera), rape blossoms and further to rape honey was investigated. By measuring the gamma activity of cesium using germanium detectors with measuring capacity up to 30 h per sample (limit of detection about 0.14 Bq/kg to 0.19 Bq/kg), we determined a mean transfer factor f cs = 0,116 ± 0,080 for the system soil-rape plant, f cs = 0.065 + 0.075 for the system soil-rape blossom and F!S = 0.098 + 0.044 for the system soil-rape honey (plants and honey wet mass, soil dry mass) (Table IV). Additionally, for the transfer of cesium from rape plants to rape honey, a factor of f cs = 2.04 ± 7.23 (both wet mass) was determined. Due to some environmental circumstances, which can hardly ever be taken into account, the results obtained sometimes differ considerably. Nevertheless, the mean transfer factors are within the range of values found in literature (Table V) [de

  14. Assessment of commercially available ion exchange materials for cesium removal from highly alkaline wastes

    Brooks, K.P.; Kim, A.Y.; Kurath, D.E.


    Approximately 61 million gallons of nuclear waste generated in plutonium production, radionuclide removal campaigns, and research and development activities is stored on the Department of Energy's Hanford Site, near Richland, Washington. Although the pretreatment process and disposal requirements are still being defined, most pretreatment scenarios include removal of cesium from the aqueous streams. In many cases, after cesium is removed, the dissolved salt cakes and supernates can be disposed of as LLW. Ion exchange has been a leading candidate for this separation. Ion exchange systems have the advantage of simplicity of equipment and operation and provide many theoretical stages in a small space. The organic ion exchange material Duolite trademark CS-100 has been selected as the baseline exchanger for conceptual design of the Initial Pretreatment Module (IPM). Use of CS-100 was chosen because it is considered a conservative, technologically feasible approach. During FY 96, final resin down-selection will occur for IPM Title 1 design. Alternate ion exchange materials for cesium exchange will be considered at that time. The purpose of this report is to conduct a search for commercially available ion exchange materials which could potentially replace CS-100. This report will provide where possible a comparison of these resin in their ability to remove low concentrations of cesium from highly alkaline solutions. Materials which show promise can be studied further, while less encouraging resins can be eliminated from consideration

  15. Aliphatic Hydrocarbons from Lignocellulose by Pyrolysis over Cesium-Modified Amorphous Silica Alumina Catalysts

    Zabeti, M.; Sai Sankar Gupta, Karthick Babu; Raman, G.; Lefferts, Leon; Schallmoser, Stefan; Lercher, Johannes A.; Seshan, K.


    Cesium-modified amorphous silica alumina (Cs/ASA) is a promising catalyst for the production of hydrocarbons through pyrolysis of biomass. Catalytic pyrolysis of pinewood over Cs/ASA in a pyrolyzer system in conjunction with a gas chromatograph and mass spectrometer resulted in a 22% yield of

  16. Separation of cesium-137 from uranium fission products via a NeoflonR column supporting tetraphenylboron

    Whitney, C.D.; Landsberger, S.


    Cesium is a member of the Group I alkali metals, very reactive earth metals that react vigorously with both air and water. The chemistry of cesium is much like the chemistry of neighboring elements on the periodic table, potassium and rubidium. This close relation creates many problems in plant-life exposed to cesium because it is so easily confused for potassium, an essential nutrient to plants. Radioactive 134 Cs and 137 Cs are also chemically akin to potassium and stable cesium. Uptake of these radioactive isotopes from groundwater by plant-life destroys the plant-life and can potentially expose humans to the radioactive affects of 134 Cs and 137 Cs. Much experimental work has been focused on the separation of 137 Cs from uranium fission products. In previous experimental work performed a column consisting of Kel-F supporting tetraphenylboron (TPB) was utilized to separate 137 Cs from uranium fission products. It is of interest at this time to attempt the separation of 134 Cs from 0.01M EDTA using the same method and Neoflon in the place of Kel-F as the inert support. The results of this experiment give a separation efficiency of 88% and show a linear relationship between the column bed length and the separation efficiency obtained. (author)

  17. Assessment of commercially available ion exchange materials for cesium removal from highly alkaline wastes

    Brooks, K.P.; Kim, A.Y.; Kurath, D.E.


    Approximately 61 million gallons of nuclear waste generated in plutonium production, radionuclide removal campaigns, and research and development activities is stored on the Department of Energy`s Hanford Site, near Richland, Washington. Although the pretreatment process and disposal requirements are still being defined, most pretreatment scenarios include removal of cesium from the aqueous streams. In many cases, after cesium is removed, the dissolved salt cakes and supernates can be disposed of as LLW. Ion exchange has been a leading candidate for this separation. Ion exchange systems have the advantage of simplicity of equipment and operation and provide many theoretical stages in a small space. The organic ion exchange material Duolite{trademark} CS-100 has been selected as the baseline exchanger for conceptual design of the Initial Pretreatment Module (IPM). Use of CS-100 was chosen because it is considered a conservative, technologically feasible approach. During FY 96, final resin down-selection will occur for IPM Title 1 design. Alternate ion exchange materials for cesium exchange will be considered at that time. The purpose of this report is to conduct a search for commercially available ion exchange materials which could potentially replace CS-100. This report will provide where possible a comparison of these resin in their ability to remove low concentrations of cesium from highly alkaline solutions. Materials which show promise can be studied further, while less encouraging resins can be eliminated from consideration.

  18. Cadmium, lead, mercury and 137cesium in fruticose lichens of northern Quebec

    Crete, M.; Zikovsky, L.


    Cadmium, lead and mercury concentration averaged 0.171, 4.09 and 0.09 μg·g -1 (dry wt.) in terrestrial lichens over a 640000-km 2 study area of northern Quebec; average cesium level reached 378 Bq·kg -1 (dry wt.). Cadmium and lead were the most closely related pollutants in lichens, while there was little relationship between 137 Cs and the 3 trace metals. Distribution of elements over the territory was not uniform and the altitude influenced 3 of them. The cesium concentration increased along with this variable, while lead levels were higher in the middle altitude class (200-400 m) than in the 2 other classes. There was a significant interaction between altitude and biome for mercury concentration, this element being almost twice more abundant in tundra below 400m than in forest tundra and boreal forest. Mercury level was related to percent ground cover by Alectoria ochroleuca, Cornicularia divergens and Cetraria nivalis, 3 lichen species typical of a wind-exposed habitat. Lead concentration was related only to Cornicularia divergens ground cover. In general concentration of cadmium, lead and mercury was higher in the northwest quarter of the study area than elsewhere, while cesium contamination was highest in the southeast quarter. It seems preferable that caribou should be harvested at low elevation when they are taken in winter in order to minimize the risk associated with cesium consumption by humans. (author). 37 refs.; 2 figs.; 5 tabs

  19. Immobilisation of radio cesium loaded ammonium molybdo phosphate in glass matrices

    Yalmali, Vrunda S.; Singh, I.J.; Sathi Sasidharan, N.; Deshingkar, D.S.


    Long half life and easy availability from high level wastes make 137 Cesium most economical radiation source. High level liquid waste processing for 137 Cesium removal has become easier due to development of Cesium specific granulated ammonium molybdophosphate (AMP) composite. In such applications, resulting spent composite AMP itself represents high active solid waste and immobilization of these materials in cement may not be acceptable. Studies on immobilization of 137 Cs loaded AMP were taken up in order to achieve twin goals of increasing safety and minimizing processing costs of the final matrix. Studies indicated that phosphate modified sodium borosilicate SPNM glasses prepared under usual oxidizing conditions are not suitable for immobilization of 137 Cs loaded on AMP .Phosphate glasses containing Na 2 O, P 2 O 5 , B 2 O 3 , Fe 2 O 3 , Al 2 O 3 and SiO 2 as major constituents are capable of incorporating 6 to 8 % AMP. The Normalized Leach rates of these glasses for sodium, cesium, boron and silica are 10 -4 to 10 -6 gm/cm 2 /day which are comparable to or better than those reported for NBS glasses incorporating HLW. Homogeneity of the final matrix was confirmed by x-ray diffraction analysis. Further studies on characterization of these glasses would establish their acceptability. (author)

  20. Thermodynamic properties of molten mixtures of lithium, rubidium, cesium and beryllium chlorides

    Zarubitskij, O.G.; Podafa, B.P.; Dubovoj, P.G.


    e. m. f. in binary systems of beryllium chloride with rubidium and cesium chlorides were measured. Concentration dependences of thermodynamic functions (mixing entropy Gibbs free energy) of beryllium chloride in the systems as well as with the participation of lithium chloride were analysed

  1. Measurements of cesium-137 in residents of Seascale and its environs

    Fry, F A; Sumerling, T J


    Measurements of the body content of cesium-137 have been made on almost 300 members of the public residing in or near Seascale, a community in west Cumbria close to the nuclear installation at Sellafield operated by British Nuclear Fuels plc. The major objective of this study was to compare the levels found in the population with those predicted from environmental measurements. No artificially-produced radionuclides were detected in the overwhelming majority of those measured. Cesium-137 was detected in about 7% of the measured population but, in general, the levels were much lower than those expected. The highest body content found was comparable with the average predicted from environmental measurements and estimates of food consumption rates; this body content corresponds to intake of cesium-137 at a rate of somewhat less than 2% of the appropriate annual limit on intake for members of the public. From this study, it is concluded that contamination of foodstuffs with cesium-137 leads to exposure of the local population at levels that are of low radiological significance, and that estimates of intake obtained from environmental monitoring data are cautious for most of the population.

  2. Collisional Dynamics of the Cesium D1 and D2 Transitions


    37 14. Comparison of Phase Changing Probability and Polarizability ...Phase Changing Probability and Polarizability for D2 Transition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 25...theoretically determined the values for broadening and shift rates for cesium with Argon , Krypton, and Xenon from the interatomic potentials [27]. The rates

  3. Interaction of the cesium cation with meso-octamethylcalix[4]pyrrole: Experimental and theoretical study

    Polášek, Miroslav; Makrlík, E.; Kvíčala, J.; Křížová, Věra; Vaňura, P.


    Roč. 670, FEB 2017 (2017), s. 22-26 ISSN 0009-2614 Grant - others:GA MŠk(CZ) 20/2015; GA MŠk(CZ) LM2010005 Institutional support: RVO:61388955 Keywords : Aromatic compounds * Cesium * Electrospray ionization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.815, year: 2016

  4. Evaluation of selected ion exchangers for the removal of cesium from MVST W-25 supernate

    Collins, J.L.; Egan, B.Z.; Anderson, K.K.; Chase, C.W.; Mrochek, J.E.; Bell, J.T.; Jernigan, G.E.


    The goal of this batch-test equilibration study was to evaluate the effectiveness of certain ion exchangers for removing cesium from supernate taken from tank W-25 of the Melton Valley Storage Tank (MVST) Facility located at the Oak Ridge National Laboratory (ORNL). These exchangers were selective for removing cesium from alkaline supernatant solutions with high salt concentrations. Since the supernates of evaporator concentrates stored in tanks at the MVST facility have compositions similar to some of those stored in tanks at Hanford, the data generated in this study should prove useful in the overall evaluation of the ion exchangers for applications to Hanford and other US Department of Energy (USDOE) sites. A goal of the waste processing effort at Hanford is to remove enough cesium to ensure that the resulting LLW will meet the Nuclear Regulatory Commission (NRC) 10 CFR 61 class A limit for 137 Cs (1 Ci/m 3 or 1 μCi/mL). The separated cesium may be concentrated and vitrified for disposal in the high-level waste repository. The decontaminated effluent would be solidified for near-surface disposal

  5. Adsorption of cesium on Czech smectite-rich clays - A comparative study

    Vejsada, J.; Hradil, D.; Řanda, Zdeněk; Jelínek, E.; Stulík, K.


    Roč. 30, č. 1 (2005), s. 53-66 ISSN 0169-1317 R&D Projects: GA ČR GA104/02/1464; GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z10480505 Keywords : cesium * adsorption * Freundlich isotherm Subject RIV: EF - Botanics Impact factor: 1.324, year: 2005

  6. Adsorption of cesium on Czech smectite-rich clays - A comparative study

    Vejsada, J.; Hradil, David; Řanda, Zdeněk; Jelínek, E.; Štulík, K.


    Roč. 30, č. 1 (2005), s. 53-66 ISSN 0169-1317 R&D Projects: GA ČR GA104/02/1464; GA AV ČR IAA3032401 Institutional research plan: CEZ:AV0Z40320502 Keywords : cesium * adsorption * batch method Subject RIV: CA - Inorganic Chemistry Impact factor: 1.324, year: 2005

  7. Extension of HPM Pulse Duration by Cesium Iodide Cathodes in Crossed Field Devices

    Benford, James


    .... The introduction of cathodes made from Cesium Iodide-coated (CsI) carbon fiber has shown plasma speeds reduced by factors of a few from uncoated carbon fiber, but previous work was at low diode fields of a few 10's of kV/cm...

  8. Release and transport of fission product cesium in the TMI-2 accident

    Lorenz, R.A.; Collins, J.L.


    Approximately 50% of the fission product cesium was released from the overheated UO 2 fuel in the TMI-2 accident. Steam that boiled away from a water pool in the bottom of the reactor vessel transported the released fission products throughout the reactor coolant system (RCS). Some fission products passed directly through a leaking valve with steam and water into the containment structure, but most deposited on dry surfaces inside of the RCS before being dissolved or resuspended when the RCS was refilled with water. A cesium transport model was developed that extended measured cesium in the RCS back to the first day of the accident. The model revealed that ∼62% of the released 137 Cs deposited on dry surfaces inside of the RCS before being slowly leached and transported out of the RCS in leaked or letdown water. The leach rates from the model agreed reasonably well with those measured in the laboratory. The chemical behavior of cesium in the TMI-2 accident agreed with that observed in fission product release tests at Oak Ridge National Laboratory (ORNL)

  9. Dual cesium and rubidium atomic fountain with a 10-16 level accuracy and applications

    Chapelet, F.


    Atomic fountains are the most accomplished development of the atomic clocks based on the cesium atom whose hyperfine resonance defines the SI second since 1967. Today these systems are among those which realize the second with the best accuracy. We present the last developments of the cold cesium and rubidium atom dual fountain experiment at LNE-SYRTE. This unique dual setup would allow to obtain an outstanding resolution in fundamental physics tests based on atomic transition frequency comparisons. In order to enable operation with both atomic species simultaneously, we designed, tested and implemented on the fountain new collimators which combine the laser lights corresponding to each atom. By comparing our rubidium fountain to another cesium fountain over a decade, we performed a test of the stability of the fine structure constant at the level of 5 * 10 -16 per year. We carried on the work on the clock accuracy and we focused on the phase gradients effects in the interrogation cavity and on the microwave leakage. The fountain accuracy has been evaluated to 4 * 10 -16 for the cesium clock and to 5 * 10 -16 for the refurbished rubidium clock. As a powerful instrument of metrology, our fountain was implicated in many clock comparisons and contributed many times to calibrate the International Atomic Time. Furthermore, we used the fountain to perform a new test of Lorentz local invariance. (author)

  10. Strontium-90 and cesium-137 in rice (consuming districts) (from Nov. 1982 to Jan. 1983)


    Strontium-90 and cesium-137 in rice (consuming districts from Nov. 1982 to Jan. 1983) were determined. Polished rice was collected in eight consuming areas when new crops were first put on sale. The results are shown in a table. (J.P.N.)

  11. The Effect of Pretreatment on the Cesium Adsorption Ability of IONSIV(C)IE-911

    Fondeur, F.F.


    The recovery of plutonium from reactor fuel elements at the Savannah River Site generated nearly 34 million gallons of high level waste. The Site stores the waste as a mixture of precipitated metal hydroxides and associated supernatant liquid with elevated concentrations of free hydroxide. The liquid fraction contains the majority of the radioactive cesium

  12. Complexation of the cesium cation with lithium ionophore VIII: extraction and DFT study

    Makrlík, E.; Novák, Vít; Vaňura, P.; Bouř, Petr


    Roč. 298, č. 3 (2013), s. 2065-2068 ISSN 0236-5731 Institutional support: RVO:61388963 Keywords : cesium cation * lithium ionophore VIII * complexation * extraction and stability constants * water-nitrobenzene system * DFT calculations * structures Subject RIV: CB - Analytical Chemistry , Separation Impact factor: 1.415, year: 2013

  13. Complexation of the cesium cation with nonactin: extraction and DFT study

    Makrlík, E.; Toman, Petr; Vaňura, P.


    Roč. 295, č. 1 (2013), s. 615-619 ISSN 0236-5731 R&D Projects: GA ČR(CZ) GAP205/10/2280 Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : cesium * nonactin * complexation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.415, year: 2013

  14. Recovery of palladium, cesium, and selenium from heavy metal alkali borosilicate glass by combination of heat treatment and leaching processes

    Xu, Zhanglian; Okada, Takashi, E-mail:; Nishimura, Fumihiro; Yonezawa, Susumu


    Highlights: • A separation technique of both noble and less noble metal from glass is studied. • Via reductive heat treatment, 80% of palladium is extracted in liquid bismuth. • Sodium–potassium-rich materials with cesium and selenium are phase separated. • From the materials, over 80% of cesium and selenium are extracted in water. - Abstract: Reductive heat-treatment and leaching process were applied to a simulated lead or bismuth soda-potash-borosilicate glass with palladium, cesium, and selenium to separate these elements. In the reductive heat treatment, palladium is extracted in liquid heavy metal phase generated by the reduction of the heavy metal oxides, whereas cesium and selenium are concentrated in phase separated Na–K-rich materials on the glass surface. From the materials, cesium and selenium can be extracted in water, and the selenium extraction was higher in the treatment of the bismuth containing glass. The chemical forms of palladium in the glass affected the extraction efficiencies of cesium and selenium. Among the examined conditions, in the bismuth glass treatment, the cesium and selenium extraction efficiencies in water were over 80%, and that of palladium in liquid bismuth was over 80%.

  15. Cesium-137 in biota from the Bothnian sea after the Chernobyl accident

    Notter, M.


    The Chernobyl fallout in April 1986 hit the Swedish Bothnian Sea coast to a relatively large extent. Extended sampling programs to follow uptake and mobilization of Cs-137 at different trophic levels in the aquatic environment started immediately after the accident. Water, sediment, algae, fish and food organisms for fish have regularly been sampled during 1986 and 1988. The highest cesium concentration (3400 Bq/m 3 ) in water from the Bothnian sea was detected in May-July 1986. Since September 1986 the cesium concentration has been decreasing and was about 500 Bq/m 3 in March-June 1987. During the same period, green algae (Cladophora), from early top values at 17000 Bq/kg d.w., have rapidly decreased to about 200 Bq/kg d.w. Of the investigated food organisms, fish-spawn rapidly got high values (3000 Bq/kg d.w.) of cesium. There is also reason to believe that this was the case for plankton. The cesium concentration on the other food organisms was lower, about (500-1200 Bq/kg d.w.). The decrease was fast and already during August 1986 they had relatively low concentrations (less than 500 Bq/kg d.w.). The cesium metabolism was rapid in species that feed on plankton and filtered material from the pelagial, such as mussles and herring. The maximum concentration was reached (1000-1500 Bq/kg d.w.) in September 1986. Fish species with algae in the nutrient chain (e.g. roach) reached concentrations of about 1000 Bq/kg d.w. and the decrease is slower. The accessible cesium for prey fish became relatively good depending on the high concentrations in fish-spawn. The maximum value for the cesium concentration in perch and pike was 2000-3000 Bq/kg d.w. and the decrease is slow. From the results from late 1988 the concentration factor (CF) has been calculated for several fish species in brackish water

  16. Radioactive cesium removal from seawater using adsorptive fibers prepared by radiation-induced graft polymerization

    Goto, Shota; Kawai-Noma, Shigeko; Umeno, Daisuke; Saito, Kyoichi; Fujiwara, Kunio; Sugo, Takanobu; Kikuchi, Takahiro; Morimoto, Yasutomi


    The meltdown of three reactors of the TEPCO Fukushima Daiichi nuclear power station (NPS) caused by the Great East Japan Earthquake on March 11th 2011 resulted in the emission of radionuclides such as cesium-137 and strontium-90 to the environment. For example, radioactive cesium exceeding the legal discharge limit (90 Bq/L, 2×10 -13 M) was detected in the seawater of the seawater-intake area of the NPS at the end of September 2014. Adsorbents with a high selectivity for cesium ions over other alkali metal ions such as sodium and potassium ions are required for cesium removal from seawater because sodium and potassium ions dissolve respectively at much higher concentrations of 5×10 -1 and 1×10 -2 M than cesium ions (2×10 -9 M). In addition, the simple operations of the immersion in seawater and the recovery of the adsorbents from seawater are desirable at decontamination sites. We prepared a cobalt-ferrocyanide-impregnated fiber capable of specifically capturing cesium ions in seawater by radiation-induced graft polymerization and chemical modifications. First, a commercially available 6-nylon fiber was irradiated with γ-rays. Second, an epoxy-group-containing vinyl monomer, glycidyl methacrylate, was graft-polymerized onto the γ-ray-irradiated nylon fiber. Third, the epoxy ring of the grafted polymer chain was reacted with triethylenediamine to obtain an anion-exchange fiber. Fourth, ferrocyanide ions, [Fe(CN) 6 ] 4 - , were bound to the anion-exchange group of the polymer chains. Finally, the ferrocyanide-ion-bound-fiber was placed in contact with cobalt chloride to precipitate insoluble cobalt ferrocyanide onto the polymer chains. Insoluble cobalt ferrocyanide was immobilized at the periphery of the fiber. However, the impregnation structure remains unclear. Here, we clarified the structure of insoluble cobalt ferrocyanide impregnated onto the polymer chain grafted onto the fiber to ensure the chemical and physical stability of the adsorptive fiber in

  17. Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

    Jalali-Rad, R.; Ghafourian, H.; Asef, Y.; Dalir, S.T.; Sahafipour, M.H.; Gharanjik, B.M.


    Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q max values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles

  18. Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

    Jalali-Rad, R. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of)]. E-mail:; Ghafourian, H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Asef, Y. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Dalir, S.T. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Sahafipour, M.H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Gharanjik, B.M. [Offshore Fisheries Research Center, Chabahar (Iran, Islamic Republic of)


    Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q{sub max} values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles.

  19. Extracellular proteases from Streptomyces phaeopurpureus ExPro138 inhibit spore adhesion, germination and appressorium formation in Colletotrichum coccodes.

    Palaniyandi, S A; Yang, S H; Suh, J-W


    To study the antifungal mechanism of proteases from Streptomyces phaeopurpureus strain ExPro138 towards Colletotrichum coccodes and to evaluate its utilization as biofungicide. We screened proteolytic Streptomyces strains from the yam rhizosphere with antifungal activity. Forty proteolytic Streptomyces were isolated, among which eleven isolates showed gelatinolytic activity and antagonistic activity on C. coccodes. Of the 11 isolates, protease preparation from an isolate designated ExPro138 showed antifungal activity. 16S rDNA sequence analysis of the strain showed 99% similarity with Streptomyces phaeopurepureus (EU841588.1). Zymography analysis of the ExPro138 culture filtrate revealed that the strain produced several extracellular proteases. The protease preparation inhibited spore germination, spore adhesion to polystyrene surface and appressorium formation. Microscopic study of the interaction between ExPro138 and C. coccodes revealed that ExPro138 was mycoparasitic on C. coccodes. The protease preparation also reduced anthracnose incidence on tomato fruits compared with untreated control. This study demonstrates possibility of utilizing antifungal proteases derived from antagonistic microbes as biofungicide. Microbial proteases having the ability to inhibit spore adhesion and appressorium formation could be used to suppress infection establishment by foliar fungal pathogens at the initial stages of the infection process. Journal of Applied Microbiology © 2013 The Society for Applied Microbiology.

  20. Strontium-90 and cesium-137 in soil (from Jun. 1983 to Sept. 1983)


    Results are presented for the determination of strontium-90 and cesium-137 in soils in Japan. Twenty-seven sampling points were selected all over Japan from Hokkaido to Okinawa by the criteria that the points were spacious and flat without past disturbance and those located in a forest, in a stony area or inside of river banks should be avoided. Soils were taken from two layers of depth, 0 to 5 cm and 5 to 20 cm. After drying, soils were passed through a 2 mm sieve and were employed for radiochemical leaching, separation, and purification of strontium-90 or cesium-137. Radioactivity of strontium-90 or cesium-137 was determined with a low background beta counter normally for 60 minutes. Determined values are presented as pCi/kg and mCi/km 2 for two different depth layers. As for strontium-90 contents, they were ranged from 13.0 +- 3.3 pCi/kg-dry (Aomori, 5 to 20 cm) to 1300 +- 20 pCi/kg-dry (Oota, Shimane Pref., 0 to 5 cm), or from 1.1 +- 0.14 mCi/km 2 (Tsuyama, Okayama Pref., 0 to 5 cm) to 50.0 +- 1.7 mCi/km 2 (Sapporo, 5 to 20 cm). As for cesium-137 contents, they were ranged from 0.5 +- 2.2 pCi/kg-dry (Saga, 5 to 20 cm) to 4700 +- 40 pCi/kg-dry (Oota, Shimane Pref., 0 to 5 cm) or from 0.1 +- 0.42 mCi/km 2 (Saga, 5 to 20 cm) to 120.0 +- 2.0 mCi/km 2 (Oota, Shimane Pref., 5 to 20 cm), and the variance for cesium-137 values were larger than those for strontium-90. Seasonal or local tendency for the contents of the two nuclides were not clarified. (Takagi, S.)

  1. Performance modeling of an integral, self-regulating cesium reservoir for the ATI-TFE

    Thayer, K.L.; Ramalingam, M.L.; Young, T.J.


    This work covers the performance modeling of an integral metal-matrix cesium-graphite reservoir for operation in the Advanced Thermionic Initiative-Thermionic Fuel Element (ATI-TFE) converter configuration. The objectives of this task were to incorporate an intercalated cesium-graphite reservoir for the 3C 24 Cs→2C 36 Cs+Cs (g) two phase equilibrium reaction into the emitter lead region of the ATI-TFE. A semi two-dimensional, cylindrical TFE computer model was used to obtain thermal and electrical converter output characteristics for various reservoir locations. The results of this study are distributions for the interelectrode voltage, output current density, and output power density as a function of axial position along the TFE emitter. This analysis was accomplished by identifying an optimum cesium pressure for three representative pins in the ATI ''driverless'' reactor core and determining the corresponding position of the graphite reservoir in the ATI-TFE lead region. The position for placement of the graphite reservoir was determined by performing a first-order heat transfer analysis of the TFE lead region to determine its temperature distribution. The results of this analysis indicate that for the graphite reservoirs investigated the 3C 24 Cs→2C 36 Cs+Cs (g) equilibrium reaction reservoir is ideal for placement in the TFE emitter lead region. This reservoir can be directly coupled to the emitter, through conduction, to provide the desired cesium pressure for optimum performance. The cesium pressure corresponding to the optimum converter output performance was found to be 2.18 torr for the ATI core least power TFE, 2.92 torr for the average power TFE, and 4.93 torr for the maximum power TFE

  2. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    Yang, Hee-Man; Jang, Sung-Chan; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon


    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe 3 O 4 nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired

  3. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    Yang, Hee-Man; Jang, Sung-Chan; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe{sub 3}O{sub 4} nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired.

  4. Web-Based Geospatial Visualization of GPM Data with CesiumJS

    Lammers, Matt


    Advancements in the capabilities of JavaScript frameworks and web browsing technology have made online visualization of large geospatial datasets such as those coming from precipitation satellites viable. These data benefit from being visualized on and above a three-dimensional surface. The open-source JavaScript framework CesiumJS (, developed by Analytical Graphics, Inc., leverages the WebGL protocol to do just that. This presentation will describe how CesiumJS has been used in three-dimensional visualization products developed as part of the NASA Precipitation Processing System (PPS) STORM data-order website. Existing methods of interacting with Global Precipitation Measurement (GPM) Mission data primarily focus on two-dimensional static images, whether displaying vertical slices or horizontal surface/height-level maps. These methods limit interactivity with the robust three-dimensional data coming from the GPM core satellite. Integrating the data with CesiumJS in a web-based user interface has allowed us to create the following products. We have linked with the data-order interface an on-the-fly visualization tool for any GPM/partner satellite orbit. A version of this tool also focuses on high-impact weather events. It enables viewing of combined radar and microwave-derived precipitation data on mobile devices and in a way that can be embedded into other websites. We also have used CesiumJS to visualize a method of integrating gridded precipitation data with modeled wind speeds that animates over time. Emphasis in the presentation will be placed on how a variety of technical methods were used to create these tools, and how the flexibility of the CesiumJS framework facilitates creative approaches to interact with the data.

  5. Tungstate-based glass-ceramics for the immobilization of radio cesium

    Drabarek, Elizabeth; McLeod, Terry I.; Hanna, John V.; Griffith, Christopher S.; Luca, Vittorio


    The preparation of tungstate-containing glass-ceramic composites (GCC) for the potential immobilization of radio cesium has been considered. The GCC materials were prepared by blending two oxide precursor compositions in various proportions. These included a preformed Cs-containing hexagonal tungsten bronze (HTB) phase (Cs 0.3Ti 0.2W 0.8O 3, P6 3/ mcm) and a blend of silica and other oxides. The use of the HTB phase was motivated on the assumption that a HTB-based adsorbent could be used to remove cesium directly from aqueous high level liquid waste feeds. In the absence of the HTB, glass-ceramics were relatively easily prepared from the Cs-containing glass-forming oxide blend. On melting the mixture a relative complex GCC phase assemblage formed. The principal components of this phase assemblage were determined using X-ray powder diffraction, 133Cs MAS-NMR, and cross-sectional SEM and included glass, various zeolites, scheelite (CaWO 4) and a range of other oxide phases and Cs-containing aluminosilicate. Importantly, under no circumstance was cesium partitioned into the glass phase irrespective of whether or not the composition included the preformed Cs-containing HTB compound. For compositions containing the HTB, cesium was partitioned into one of four major phases including zeolite; Cs-silica-tungstate bronze, pollucite (CsAlSi 2O 6), and an aluminosilicate with an Al/Si ratio close to one. The leach resistance of all materials was evaluated and related to the cesium distribution within the GCC phase assemblages. In general, the GCCs prepared from the HTB had superior durability compared with materials not containing tungsten. Indeed the compositions in many cases had leach resistances comparable to the best ceramics or glass materials.

  6. Removal of cesium from simulated liquid waste with countercurrent two-stage adsorption followed by microfiltration.

    Han, Fei; Zhang, Guang-Hui; Gu, Ping


    Copper ferrocyanide (CuFC) was used as an adsorbent to remove cesium. Jar test results showed that the adsorption capacity of CuFC was better than that of potassium zinc hexacyanoferrate. Lab-scale tests were performed by an adsorption-microfiltration process, and the mean decontamination factor (DF) was 463 when the initial cesium concentration was 101.3μg/L, the dosage of CuFC was 40mg/L and the adsorption time was 20min. The cesium concentration in the effluent continuously decreased with the operation time, which indicated that the used adsorbent retained its adsorption capacity. To use this capacity, experiments on a countercurrent two-stage adsorption (CTA)-microfiltration (MF) process were carried out with CuFC adsorption combined with membrane separation. A calculation method for determining the cesium concentration in the effluent was given, and batch tests in a pressure cup were performed to verify the calculated method. The results showed that the experimental values fitted well with the calculated values in the CTA-MF process. The mean DF was 1123 when the dilution factor was 0.4, the initial cesium concentration was 98.75μg/L and the dosage of CuFC and adsorption time were the same as those used in the lab-scale test. The DF obtained by CTA-MF process was more than three times higher than the single-stage adsorption in the jar test. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Intercomparison of numerical simulations on oceanic dispersion of the radioactive cesium released because of the Fukushima disaster

    Kawamura, H.; Kobayshi, T.; Furuno, A. [Japan Atomic Energy Agency, Ibaraki (Japan); Usui, N.; Kamachi, M. [Japan Meteorological Agency, Meteorological Research Inst., Ibaraki (Japan); Nishikawa, S.; Ishikawa, Y. [Japan Agency for Marine-Earth Science and Tech., Kanagawa (Japan)


    We conducted numerical simulations on oceanic dispersion of the radioactive cesium released because of the Fukushima disaster in the North Pacific. Two independent oceanic reanalysis data were used in the simulations. Both simulations suggested that the {sup 137}Cs concentration had been reduced to the pre-Fukushima level around 2.5 years after the disaster. The intercomparison revealed that meso-scale eddies accompanied by the Kuroshio Extension may have efficiently diluted the radioactive cesium at the sea surface. The meso-scale eddies also played an important role in transporting the surface radioactive cesium into the intermediate layer. (author)

  8. Development of an ion-exchange process for removing cesium from high-level radioactive liquid wastes

    Baumgarten, P.K.; Wallace, R.M.; Whitehurst, D.A.; Steed, J.M.


    Methods to determine resin characteristics, i.e., cesium equilibria and diffusion rates, were developed. These parameters can now guide resin selection and aid in interpreting column performance. The K/sub D/ cesium ion concentration relation gives evidence of three different types of ion exchange sites. The countercurrent load/elution/regeneration cycle for the removal of cesium by ion exchange repeatedly reached the goal decontamination factor (DF) of 10,000 at throughputs up to 60 column volumes. Resin backwashing appears feasible, but further development of column geometry will be required. The proposed ammonium elutriant is satisfactory. Regeneration end-point can be controlled by electrical conductivity monitoring

  9. Preparation and use of polymeric materials containing hydrophobic anions and plasticizers for separation of cesium and strontium

    Abney, K.D.; Kinkead, S.A.; Mason, C.F.V.; Rais, J.


    Preparation and use is described for polymeric materials containing hydrophobic anions and plasticizers for extraction of cesium and strontium. The use of polymeric materials containing plasticizers which are solvents for hydrophobic anions such as derivatives of cobalt dicarbollide or tetraphenylborate which are capable of extracting cesium and strontium ions from aqueous solutions in contact with the polymeric materials, is described. The polymeric material may also include a synergistic agent for a given ion like polyethylene glycol or a crown ether, for removal of radioactive isotopes of cesium and strontium from solutions of diverse composition and, in particular, for solutions containing large excess of sodium nitrate

  10. A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

    Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto


    of acyl protein thioesterase 1 (APT1), an enzyme regulating the palmitoylation status of proteins that are known to function at the synapse, including the alpha(13) subunits of G proteins (Galpha(13)). RNA-interference-mediated knockdown of APT1 and the expression of membrane-localized Galpha(13) both...... suppress spine enlargement caused by inhibition of miR-138, suggesting that APT1-regulated depalmitoylation of Galpha(13) might be an important downstream event of miR-138 function. Our results uncover a previously unknown miRNA-dependent mechanism in neurons and demonstrate a previously unrecognized...

  11. Isolation of Human CD138+ Microparticles from the Plasma of Patients with Multiple Myeloma

    Sabna Rajeev Krishnan


    Full Text Available The confinement of multiple myeloma (MM to the bone marrow microenvironment requires an invasive bone marrow biopsy to monitor the malignant compartment. The existing clinical tools used to determine treatment response and tumor relapse are limited in sensitivity mainly because they indirectly measure tumor burden inside the bone marrow and fail to capture the patchy, multisite tumor infiltrates associated with MM. Microparticles (MPs are 0.1- to 1.0-μm membrane vesicles, which contain the cellular content of their originating cell. MPs are functional mediators and convey prothrombotic, promalignant, proresistance, and proinflammatory messages, establishing intercellular cross talk and bypassing the need for direct cell-cell contact in many pathologies. In this study, we analyzed plasma cell–derived MPs (CD138+ from deidentified MM patients (n = 64 and normal subjects (n = 18 using flow cytometry. The morphology and size of the MPs were further analyzed using scanning electron microscopy. Our study shows the proof of a systemic signature of MPs in MM patients. We observed that the levels of MPs were significantly elevated in MM corresponding to the tumor burden. We provide the first evidence for the presence of MPs in the peripheral blood of MM patients with potential applications in personalized MM clinical monitoring.

  12. Analysis of cesium-137 vertical distribution in the profile of plowed chernozems at different schemes of their assaying

    Paramonova, T.A.; Komissarova, O.L.; Belyaev, V.R.; Ivanov, M.M.


    In 2011-2015 the assessment of profile cesium-137 distribution in agrocenosis of chernozem zone on the territory of the Plavsk radioactive spot in Tula region formed after the Chernobyl accident has been carried out. It is shown that up until now non-uniformity of cesium-137 vertical distribution over the plowed chernozems profile may be occurred, it should be taken into account at radioecological survey of post-Chernobyl landscapes. For correct evaluation of radioecological state of plowed soils their systematic monitoring on the base of preliminary analysis of cesium-137 distribution and also with the account of agrotechnical peculiarities of various crops cultivation is recommended. On the Plavsk radioactive spot territory the most adequate assessments of cesium-137 stores in plowed chernozems one can obtain on the base of assaying the upper 30-cm soil depth, including not only current topsoil, but also old-arable horizon formed by deep rehabilitation plowing [ru

  13. Electronic band structure, optical, dynamical and thermodynamic properties of cesium chloride (CsCl from first-principles

    Bingol Suat


    Full Text Available The geometric structural optimization, electronic band structure, total density of states for valence electrons, density of states for phonons, optical, dynamical, and thermodynamical features of cesium chloride have been investigated by linearized augmented plane wave method using the density functional theory under the generalized gradient approximation. Ground state properties of cesium chloride are studied. The calculated ground state properties are consistent with experimental results. Calculated band structure indicates that the cesium chloride structure has an indirect band gap value of 5.46 eV and is an insulator. From the obtained phonon spectra, the cesium chloride structure is dynamically stable along the various directions in the Brillouin zone. Temperature dependent thermodynamic properties are studied using the harmonic approximation model.

  14. Radiochemical determination of strontium-90 and cesium-137 in waters of the Pacific Ocean and its neighboring seas

    Borisenko, G.S.; Kandinskii, P.A.; Gedeonov, L.I.; Ivanova, L.M.; Petrov, A.A.


    Depending on the salinity of the water, two versions of strontium-90 and cesium-137 concentration from water samples are presented. Cesium-137 was concentrated by precipitating sparingly soluble mixed hexacyanoferrates (II), and strontium-90 by precipitating carbonates together with calcium. A scheme has been given for radiochemical analysis of the concentrates. Strontium-90 and cesium-137 contents in the waters of the Pacific Ocean and its neighboring seas have been determined by the radiochemical method described. The levels of radionuclide content in the water and atmospheric precipitations have been shown to be inter-related. Strontium-90 and cesium-137 contents in the surface water of the northwestern Pacific were found to be much lower in 1980 than in the early seventies. The area of technogenic radioactive pollution was found to persist in the region of the Columbia mouth into the Pacific Ocean

  15. Removal of cesium using coconut fiber in raw and modified forms for the treatment of radioactive liquid wastes

    Jesus, Nella N.M. de; Nobre, Vanessa B.; Potiens Junior, Ademar J.; Sakata, Solange K.; Di Vitta, Patricia B.


    Sorption is one of the most studied methods to reduce the volume of radioactive waste streams. Cesium-137 is a radioisotope formed by the fission of uranium and it can cause health problems due to its easy assimilation by cells. The aim of this study is to evaluate the potential of coconut fiber in removing cesium from radioactive liquid wastes; this process can help in disposing radioactive waste. The experiments were performed in batch and the particle size of the fiber ranged between 0.30 mm and 0.50 mm. The fiber was treated with hydrogen peroxide in alkaline medium. The following parameters were analyzed: contact time, pH and concentration of cesium ions in aqueous solution. After the experiments the samples were filtered and cesium remaining in solution was quantified by inductively coupled plasma optical emission spectrometry. (author)

  16. Removal of cesium using coconut fiber in raw and modified forms for the treatment of radioactive liquid wastes

    Jesus, Nella N.M. de; Nobre, Vanessa B.; Potiens Junior, Ademar J.; Sakata, Solange K., E-mail: [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Di Vitta, Patricia B. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Quimica


    Sorption is one of the most studied methods to reduce the volume of radioactive waste streams. Cesium-137 is a radioisotope formed by the fission of uranium and it can cause health problems due to its easy assimilation by cells. The aim of this study is to evaluate the potential of coconut fiber in removing cesium from radioactive liquid wastes; this process can help in disposing radioactive waste. The experiments were performed in batch and the particle size of the fiber ranged between 0.30 mm and 0.50 mm. The fiber was treated with hydrogen peroxide in alkaline medium. The following parameters were analyzed: contact time, pH and concentration of cesium ions in aqueous solution. After the experiments the samples were filtered and cesium remaining in solution was quantified by inductively coupled plasma optical emission spectrometry. (author)

  17. Strontium 90 and cesium 137 content in the daily diet of two groups of people in Plovdiv

    Babakova, I.; Trendafilov, I.; Todorov, D.


    The contents of strontium 90 and cesium 137 in the daily diet of children, 7-11 years old, and teenagers, 14-18 years old, living under boarding house conditions is determined. The daily strontium 90 intake in the organism of children and teenagers amounts to 9,78 pCi, respectively 17,96 pCi and the daily intake of cesium 137 - to 13,21 pCi, respectively 21,33 pCi. The bigger part of the strontium 90 and cesium 137 intake comes from the bread, accounting for 4,85 pCi stroncium 90 and 5,08 to 7,0 pCi cesium 137. (author)

  18. Cesium platinide hydride 4Cs{sub 2}Pt.CsH: an intermetallic double salt featuring metal anions

    Smetana, Volodymyr [Ames Laboratory, US Department of Energy, and Critical Materials Institute, Ames, Iowa, 50011-3020 (United States); Mudring, Anja-Verena [Ames Laboratory, US Department of Energy, and Critical Materials Institute, Ames, Iowa, 50011-3020 (United States); Department of Materials Sciences and Engineering, Iowa State University, Ames, Iowa, 50011-3111 (United States)


    With Cs{sub 9}Pt{sub 4}H a new representative of ionic compounds featuring metal anions can be added to this rare-membered family. Cs{sub 9}Pt{sub 4}H exhibits a complex crystal structure containing Cs{sup +} cations, Pt{sup 2-} and H{sup -} anions. Being a red, transparent compound its band gap is in the visible range of the electromagnetic spectrum and the ionic type of bonding is confirmed by quantum chemical calculations. This cesium platinide hydride can formally be considered as a double salt of the ''alloy'' cesium-platinum, or better cesium platinide, Cs{sub 2}Pt, and the salt cesium hydride CsH according to Cs{sub 9}Pt{sub 4}H≡4 Cs{sub 2}Pt.CsH. (copyright 2016 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. Cesium-137 in ash from combustion of biofuels. Application of regulations from the Swedish Radiation Safety Authority; Cesium-137 i aska fraan foerbraenning av biobraenslen. Tillaempning av Straalsaekerhetsmyndighetens regler

    Sjoeblom, Rolf (Tekedo AB, Nykoeping (SE))


    The Swedish Radiation Safety Authority, SSM, has issued an ordinance on ash contaminated with Cesium-137. It implies amongst other things that ash containing 0,5 - 10 kBq/kg Cesium-137 (so-called contaminated ash) can be used for geotechnical purposes provided that the content in a near-by well does not exceed 1 Bq/litre and that the increase in a near-by fish producing recipient does not exceed 0,1 Bq/litre. The initial plan with the presently reported work was to provide a compilation of how the ordinance for Cesium-137 can be applied in practical work. It became evident, however, in the course of the work that issues related to the co-variation between potassium and Cesium needed further investigation. As a result, the present report comprises also a compilation of this extended information search. Cesium-137 is present in ash as a result of the accident in a nuclear power reactor in Chernobyl in 1986 during which material having a very small grain size was spread to a high altitude. A few days later, Cesium-137 was deposited during rains over large parts of Sweden. This activity penetrated to a depth of one or a few decimetres during the course of the subsequent few days and weeks, after which it was partially taken up by plants and spread in the ecosystem. Section 2 has the character of a handbook. It provides basic information on radiation, and also about the ordinance and other material from the SSI. Section 3 comprises compilations of relevant international status of knowledge. This regards how potassium and Cesium behave in soil and ash, and also how spreading of Cesium can be modelled. Cesium behaves similarly to Potassium but with the difference that Cesium is bonded much more strongly to mineral soil and ash. Potassium and Cesium appears in soil in four different forms: dissolved in the pore water, exchangeable, non-exchangeable and as bonded to minerals. The amount dissolved in the pore water is the smallest and that bonded to minerals is the largest

  20. Effects of acute and chronic experimental contamination on direct cesium 137 uptake by the eel, Anguilla anguilla L

    Foulquier, Luc; Lambrechts, Alain.


    This study covers the effects of different types of contamination on direct cesium 137 uptake by the eel. In the first experiment (acute contamination), simulating a waste discharge, the fish were kept in water with a rapidly decreasing cesium 137 activity. In a second experiment (chronic contamination), the water activity increased constantly, simulating increasing waste frequency and activity levels. Irrespective of the type of contamination, radiocesium retention by eels is low ( [fr