WorldWideScience

Sample records for cesium 137

  1. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1997-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  2. Cesium-137, a drama recounted; Cesio-137, um drama recontado

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar

    2013-01-15

    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  3. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  4. Dating of mine waste in lacustrine sediments using cesium-137

    Science.gov (United States)

    Rember, W. C.; Erdman, T. W.; Hoffmann, M. L.; Chamberlain, V. E.; Sprenke, K. F.

    1993-11-01

    For over a century Medicine Lake in northern Idaho has received heavy-metal-laden tailings from the Coeur d'Alene mining district. Establishing the depositional chronology of the lake bottom sediments provides information on the source and rate of deposition of the tailings. Cesium-137, an isotope produced in the atmosphere by nuclear bomb tests, was virtually absent in the environment prior to 1951, but reached its apex in 1964. Our analysis of cesium-137 in the sediments of Medicine Lake revealed that 14 cm of fine-grained tailings were deposited in the lake from 1951 to 1964 and tailing deposition downstream was greatly reduced by the installation of tailings dams in the district in 1968. Cesium-137 analysis is accomplished by a fairly simple gamma-ray counting technique and should be a valuable tool for analyzing sedimentation in any lacustrine environment that was active during the 1950s and 1960s.

  5. Cesium-137 Levels Detected in Otters from Austria

    Directory of Open Access Journals (Sweden)

    Gutleb A.C.

    1991-02-01

    Full Text Available Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra. The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  6. Distribution of cesium-137 in reindeer

    Directory of Open Access Journals (Sweden)

    Kristina Rissanen

    1990-08-01

    Full Text Available The influence of the Chernobyl accident in 1986 on the Finnish reindeer herding area was much smaller than the effects of the nuclear bomb tests in the 1960s. Only in one small area somewhat more Cs-137 was deposited than in the rest of the reindeer herding area. From that area 20 reindeer were chosen for investigation of the distribution of Cs-137. All tissues, organs, the skeleton, digestive tract, hide, head and hooves were sampled quantitatively. Three reindeer were pregnant and also the foetuses were studied. The Cs-137 amounts were determined by gammaspectrometric measurements. The results showed that the differences in the Cs-137 concentrations between muscle tissue from different parts of an individual reindeer were not more than 10 percent. Thus it is not essential from which part of the reindeer meat samples for surveillance purposes are taken. The concentration of Cs-137 in edible tissues other than muscle was lower except in the kidneys and scapula cartilage.

  7. a Biokinetic Model for CESIUM-137 in the Fetus

    Science.gov (United States)

    Jones, Karen Lynn

    1995-01-01

    Previously, there was no method to determine the dose to the embryo, fetus, fetal organs or placenta from radionuclides within the embryo, fetus, or placenta. In the past, the dose to the fetus was assumed to be equivalent to the dose to the uterus. Watson estimated specific absorbed fractions from various maternal organs to the uterine contents which included the fetus, placenta, and amniotic fluid and Sikov estimated the absorbed dose to the embryo/fetus after assuming 1 uCi of radioactivity was made available to the maternal blood.^{1,2} However, this method did not allow for the calculation of a dose to individual fetal organs or the placenta. The radiation dose to the embryo or fetus from Cs-137 in the fetus and placenta due to a chronic ingestion by the mother was determined. The fraction of Cs-137 in the maternal plasma crossing the placenta to the fetal plasma was estimated. The absorbed dose from Cs-137 in each modelled fetal organ was estimated. Since there has been more research regarding potassium in the human body, and particularly in the pregnant woman, a biokinetic model for potassium was developed first and used as a basis and confirmation of the cesium model. Available pertinent information in physiology, embryology, biokinetics, and radiation dosimetry was utilized. Due to the rapid growth of the fetus and placenta, the pregnancy was divided into four gestational periods. The numerous physiological changes that occurred during pregnancy were considered and an appropriate biokinetic model was developed for each of the gestational periods. The amount of cesium in the placenta, embryo, and fetus was estimated for each period. The dose to the fetus from cesium deposited in the embryo or fetus and in the placenta was determined for each period using Medical Internal Radiation Dosimetry (MIRD) methodology. An uncertainty analysis was also performed to account for the variability of the parameters in the biokinetic model based on the experimental data

  8. Mercury and cesium-137 in urban gray squirrels

    Energy Technology Data Exchange (ETDEWEB)

    Jenkins, J.H. (Univ. of Georgia, Athens); Davis, A.H.; Bigler, W.J.; Hoff, G.L.

    1980-08-01

    Recent emphasis upon the revitalization of major cities has underscored a need for urban wildlife management. Intensive management of the wildlife populations indigenous to metropolitan areas will enhance our quality of life in many ways. One important benefit is that certain species can serve as sensitive indicators of environmental change. The gray squirrel (Sciurus carolinensis) is usually abundant in cities and they are often subject to a variety of destructive environmental factors. In an attempt to evaluate the gray squirrel as an indicator of zoonoses and pollutants, the Health Program Office of the Department of Health and Rehabilitative Services conducted a multifaceted study in Jacksonvlle, Florida during 1974. This report presents baseline measurements of body burdens of mercury and cesium-137.

  9. Biological effects of cesium-137 injected in beagle dogs of different ages

    Energy Technology Data Exchange (ETDEWEB)

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others

    1995-12-01

    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.

  10. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Energy Technology Data Exchange (ETDEWEB)

    Geer, L.E. De; Vintersved, I.; Arntsing, R. [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)

    1997-12-31

    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  11. The effects of using Cesium-137 teletherapy sources as a radiological weapon (dirty bomb)

    CERN Document Server

    Liolios, Theodore

    2009-01-01

    While radioactive sources used in medical diagnosis do not pose a great security risk due to their low level of radioactivity, therapeutic sources are extremely radioactive and can presumably be used as a radiological weapon. Cobalt-60 and Cesium-137 sources are the most common ones used in radiotherapy with over 10,000 of such sources currently in use worldwide, especially in the developing world, which cannot afford modern accelerators. The present study uses computer simulations to investigate the effects of using Cesium-137 sources from teletherapy devices as a radiological weapon. Assuming a worst-case terrorist attack scenario, we estimate the ensuing cancer mortality, land contamination, evacuation area, as well as the relevant evacuation, decontamination, and health costs in the framework of the linear risk model. The results indicate that an attack with a Cesium-137 dirty bomb in a large metropolitan city (especially one that would involve several teletherapy sources) although would not cause any sta...

  12. Dosimetry of a Cesium 137 source; Dosimetria de una fuente de Cesio 137

    Energy Technology Data Exchange (ETDEWEB)

    Torres R, J.G.; Manzanares A, E.; Vega C, H.R. [Unidades Academicas de Estudios Nucleares, Universidad de Zacatecas (Mexico)

    2005-07-01

    It was carried out a dosimetric study of a source of Cesium 137 used in investigations of Radiobiology. This radionuclide has a half life of 30.07 years and it emits photons of 661.657 keV with a probability of 85.2%. The source has been used in a series of experiments trending to observe the cellular response before the gamma rays, as well as for the calibration of equipment of radiological protection. For such reason it is important to determine the dosimetric properties. In this work it was determined the absorbed dose that this source takes when being placed in the center from a methylmethacrylate badge to three distances, 5, 10 and 15 cm. The dose was measured with thermoluminescent dosemeters and it was calculated by means of Monte Carlo method, also was derived an expression that allows to determine the dose starting from the information of the activity of the source and of the distance regarding the same one. (Author)

  13. The burden of cesium 137 in forest clerks; Die Belastung mit Caesium 137 bei Beschaeftigten der Forstverwaltung

    Energy Technology Data Exchange (ETDEWEB)

    Piechotowski, I.; Jaroni, J. [Landesgesundheitsamt Baden-Wuerttemberg, Stuttgart (Germany); Link, B. [Arbeits- und Sozialministerium des Landes Baden-Wuerttemberg, Stuttgart (Germany); Groezinger, O. [Ministerium fuer Umwelt und Verkehr des Landes Baden-Wuerttemberg, Stuttgart (Germany)

    2000-07-01

    In 47 forest clerks from the regions Ortenau and Oberschwaben in south-west Germany the incorporation of cesium 137 and potassium 40 was measured in autumn 1994. Soil burden as well as burden of nutrition with cesium 137 are different in these regions for geological reasons and as a result of the nuclear accident of Chernobyl. Caused by low content of clay in Oberschwaben, the transfer of cesium to plants is assisted. Heavy rainfall after the nuclear accident led to an additional increase of burden. The median of the concentration of cesium 137 was 1.4 Bq/kg body weight. The median for potassium 40 was 58 Bq/kg body weight. For cesium 137 regional differences were observed. For persons from Oberschwaben the median for cesium 137 was with 2.8 Bq/kg body weight clearly higher than for persons from Ortenau with 0,6 Bq/kg body weight. Concerning nutrition habits, the clearest difference was found comparing persons who had ate a minimum of four portions of deer from the surroundings within the last four weeks with persons who had ate less than four portions of deer from the surroundings within the last four weeks. The difference was greater in Oberschwaben than in Ortenau. The effective dose of cesium 137 calculated on the basis of the incorporation is very low compared to natural radiation. This is also valid for persons from Oberschwaben. (orig.) [German] Im Herbst 1994 wurde bei insgesamt 47 Bediensteten der Forstverwaltung aus den Regionen Ortenaukreis und Oberschwaben die Inkorportation an Caesium 137 und Kalium 40 gemessen. Sowohl die Bodenbelastung als auch die Belastung von Nahrungsmitteln mit Caesium 137 unterscheiden sich in diesen Gebieten bedingt durch geologische Besonderheiten und in Folge des Reaktorunfalls von Tschernobyl. Aufgrund eines geringen Anteils an Tonerden wird in Oberschwaben der Caesiumtransfer in Pflanzen beguenstigt, eine zusaetzliche Erhoehung der Belastung erfolgte durch starke Niederschlaege nach dem Reaktorunfall. Die Konzentration fuer

  14. Different cesium-137 transfers to forest and stream ecosystems.

    Science.gov (United States)

    Sakai, Masaru; Gomi, Takashi; Negishi, Junjiro N; Iwamoto, Aimu; Okada, Kengo

    2016-02-01

    Understanding the mechanisms of (137)Cs movement across different ecosystems is crucial for projecting the environmental impact and management of nuclear contamination events. Here, we report differential movement of (137)Cs in adjacent forest and stream ecosystems. The food webs of the forest and stream ecosystems in our study were similar, in that they were both dominated by detrital-based food webs and the basal energy source was terrestrial litter. However, the concentration of (137)Cs in stream litter was significantly lower than in forest litter, the result of (137)Cs leaching from litter in stream water. The difference in (137)Cs concentrations between the two types of litter was reflected in the (137)Cs concentrations in the animal community. While the importance of (137)Cs fallout and the associated transfer to food webs has been well studied, research has been primarily limited to cases in a single ecosystem. Our results indicate that there are differences in the flow of (137)Cs through terrestrial and aquatic ecosystems, and that (137)Cs concentrations are reduced in both basal food resources and higher trophic animals in aquatic systems, where primary production is subsidized by a neighboring terrestrial ecosystem.

  15. Experimental contamination of pink shrimps by caesium 137; Contamination experimentale de crevettes roses par le cesium 137

    Energy Technology Data Exchange (ETDEWEB)

    Ancellin, J.; Michon, G.; Vilquin, A. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1965-07-01

    The authors describe first of all the technique used for the determination of cesium 137 concentration factors in the pink shrimp (Leander Serratus Pennant). Experiments over three months have shown that the specific activity of the shrimps becomes stable between the thirtieth and the fortieth day. The concentration factors then have values between 30 and 40. These results are similar to those obtained by other authors. (authors) [French] Les auteurs decrivent tout d'abord la technique utilisee pour la determination des facteurs de concentration du Cesium 137 chez la crevette rose (Leander Serratus Pennant). Le resultat des experimentations menees pendant trois mois montre que l'activite specifique des crevettes se stabilise entre le trentieme et le quarantieme jour. Les facteurs de concentration se situent alors entre 30 et 40, Ces donnees sont comparables a celles obtenues par d'autres auteurs. (auteur)

  16. Deciphering the measured ratios of Iodine-131 to Cesium-137 at the Fukushima reactors

    CERN Document Server

    Matsui, T

    2011-01-01

    We calculate the relative abundance of the radioactive isotopes Iodine-131 and Cesium-137 produced by nuclear fission in reactors and compare it with data taken at the troubled Fukushima Dai-ichi nuclear power plant. The ratio of radioactivities of these two isotopes can be used to obtain information about when the nuclear reactions terminated.

  17. Distribution of global fallouts cesium-137 in taiga and tundra catenae at the Ob River basin

    Science.gov (United States)

    Semenkov, I. N.; Usacheva, A. A.; Miroshnikov, A. Yu.

    2015-03-01

    The classification of soil catenae at the Ob River basin is developed and applied. This classification reflects the diverse geochemical conditions that led to the formation of certain soil bodies, their combinations and the migration fields of chemical elements. The soil and geochemical diversity of the Ob River basin catenae was analyzed. The vertical and lateral distribution of global fallouts cesium-137 was studied using the example of the four most common catenae types in Western Siberia tundra and taiga. In landscapes of dwarf birches and dark coniferous forests on gleysols, cryosols, podzols, and cryic-stagnosols, the highest 137Cs activity density and specific activity are characteristic of the upper soil layer of over 30% ash, while the moss-grass-shrub cover is characterized by low 137Cs activity density and specific activity. In landscapes of dwarf birches and pine woods on podzols, the maximum specific activity of cesium-137 is typical for moss-grass-shrub cover, while the maximum reserves are concentrated in the upper soil layer of over 30% ash. Bog landscapes and moss-grass-shrub cover are characterized by a minimum activity of 137Cs, and its reserves in soil generally decrease exponentially with depth. The cesium-137 penetration depth increases in oligotrophic histosols from northern to middle taiga landscapes from 10-15 to 40 cm. 137Cs is accumulated in oligotrophic histosols for increases in pH from 3.3 to 4.0 and in concretionary interlayers of pisoplinthic-cryic-histic-stagnosols. Cryogenic movement, on the one hand, leads to burying organic layers enriched in 137Cs and, on the other hand, to deducing specific activity when mixed with low-active material from lower soil layers.

  18. Fabrication of cesium-137 brachytherapy sources using vitrification technology.

    Science.gov (United States)

    Dash, Ashutosh; Varma, R N; Ram, Ramu; Saxena, S K; Mathakar, A R; Avhad, B G; Sastry, K V S; Sangurdekar, P R; Venkatesh, Meera

    2009-08-01

    137Cs source in solid matrix encapsulated in stainless-steel at MBq (mCi) levels are widely used as brachytherapy sources for the treatment of carcinoma of cervix uteri. This article describes the large-scale preparation of such sources. The process of fabrication includes vitrification of 137Cs-sodium borosilicate glass, its transformation into spheres of 5-6 mm diameter, casting of glass spheres into a cylinder of 1.5 mm (varphi) x 80 mm (l) in a platinum mould, cutting of the moulds into 5-mm-long pieces, silver coating on the sources, and finally, encapsulation in stainless steel capsules. Development of safety precautions used to trap 137Cs escaping during borosilicate glass preparation is also described. The leach rates of the radioactive sources prepared by the above technology were within permissible limits, and the sources could be used for encapsulation in stainless steel capsules and supplied for brachytherapy applications. This development was aimed at promoting the potential utility of 137Cs-brachytherapy sources in the country and reducing the user's reliance on imported sources. Since its development, more than 1000 such sources have been made by using 4.66 TBq(126 Ci) of 137Cs.

  19. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    Energy Technology Data Exchange (ETDEWEB)

    Schultz, F.J.; Tompkins, J.A.; Haff, K.W.; Case, F.N.

    1981-07-01

    Twenty-seven fully loaded /sup 137/Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 1500/sup 0/C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of /sup 137/Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded /sup 137/Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10/sup -10/ kg m/sup -2/s/sup -1/, while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10/sup -12/ kg m/sup -2/s/sup -1/. The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level /sup 137/Cs aluminosilicate pellets were 1.29 x 10/sup -16/m/sup 2/s/sup -1/, 6.88 x 10/sup -17/m/sup 2/s/sup -1/, and 1.35 x 10/sup -17/m/sup 2/s/sup -1

  20. Metabolism of {sup 137}cesium, {sup 137}barium in the rat. Therapeutics of the contamination; Metabolisme du {sup 137}cesium, {sup 137}baryum chez le rat. Therapeutique de la contamination

    Energy Technology Data Exchange (ETDEWEB)

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires. Departement de la Protection Sanitaire, Laboratoire de Radiopathologie

    1967-07-01

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of {sup 137}Cs - {sup 137}Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [French] Les auteurs etudient experimentalement la cinetique de distribution, le metabolisme et l

  1. Use of cesium-137 methodology in the evaluation of superficial erosive processes

    Directory of Open Access Journals (Sweden)

    Avacir Casanova Andrello

    2003-06-01

    Full Text Available Superficial erosion is one of the main soil degradation agents and erosion rates estimations for different edaphicclimate conditions for the conventional models, as USLE and RUSLE, are expensive and time-consuming. The use of cesium-137 antrophogenic radionuclide is a new methodology that has been much studied and its application in the erosion soil evaluation has grown in countries as USA, UK, Australia and others. A brief narration of this methodology is being presented, as the development of the equations utilized for the erosion rates quantification through the cesium-137 measurements. Two watersheds studied in Brazil have shown that the cesium-137 methodology was practicable and coherent with the survey in field for applications in erosion studies.A erosão superficial é um dos principais agentes de degradação dos solos e estimativas das taxas de erosão para diferentes condições edafoclimáticas pelos modelos tradicionais como USLE, RUSLE, são onerosos e demorados. Uma metodologia que tem sido muito estudada e sua aplicação no estudo da erosão vem crescendo em países como EUA, Reino Unido, Austrália, e outros, é a do uso do radionuclídeo antropogênico césio-137. Um resumo da história desta metodologia é apresentado, assim como a evolução das equações utilizadas para quantificar as taxas de erosão através da medida do césio-137. Duas bacias estudadas no Brasil mostraram que a metodologia do césio-137 é viável e coerente com as observações em campo para aplicação no estudo da erosão.

  2. The effects of using Cesium-137 teletherapy sources as a radiological weapon (dirty bomb)

    OpenAIRE

    Liolios, Theodore

    2009-01-01

    While radioactive sources used in medical diagnosis do not pose a great security risk due to their low level of radioactivity, therapeutic sources are extremely radioactive and can presumably be used as a radiological weapon. Cobalt-60 and Cesium-137 sources are the most common ones used in radiotherapy with over 10,000 of such sources currently in use worldwide, especially in the developing world, which cannot afford modern accelerators. The present study uses computer simulations to investi...

  3. Derivation of cesium-137 residual radioactive material guidelines for the Peek Street site, Schenectady, New York

    Energy Technology Data Exchange (ETDEWEB)

    Jones, L.; Nimmagadda, M.; Yu, C.

    1992-01-01

    Residual radioactive material guidelines for cesium-137 were derived for the Peek rk. The derivation was based on the requirement that the Street site in Schenectady, New York. The derivation was based on the requirement that the 50-year committed effective dose equivalent to a hypothetical individual who lives or works in the immediate vicinity of the Peek Street site should not exceed a dose of 100 mrem/yr following remedial action. The US Department of Energy (DOE) residual radioactive material guideline computer code, RESRAD was used in this evaluation. Three potential scenarios were considered for the site on the assumption that for a period of 1,000 years following remedial action, the site wig be utilized without radiological restrictions. The scenarios vary with regard to use of the site, time spent at the site, and sources of food consumed. Results indicate that the basic dose limit of 100 mrem/yr will not be exceeded for cesium-137 within 1,000 years, provided that the soil concentration of cesium-137 at the Peek Street site does not exceed the following levels: 98 pCi/g for Scenario A (industrial worker: the expected scenario), 240 pCi/g for Scenario B (recreationist: a plausible scenario), and 34 pCi/g for Scenario C (resident farmer ingesting food produced in the decontaminated area: a plausible scenario).

  4. Dosimetry of IRIDIUM-192 and CESIUM-137 Seed Sources.

    Science.gov (United States)

    Thomason, Cynthia

    The use of ^{192}Ir in brachytherapy implants both alone and in conjunction with other modalities for the treatment of various types of cancer has greatly increased in recent years. This increased usage has led to a greater need for detailed information concerning the dose distribution surrounding commerically available ^{192} Ir seed sources. This is especially truce since improvements in computer technology along with their increased availability and utilization have enabled more precise calculation of dose distributions. The radiation does distribution in water was measured using LiF thermoluminescent dosimeters for an ^{192}Ir seed source with platinum encapsulation, for an ^{192}Ir seed source with stainless steel encapsulation and for a ^{137}Cs seed source intended as a substitute for ^{192 }Ir. The Electron-Gamma-Shower (EGS) computer code, which is a package for doing Monte Carlo simulation of the transport of photons and electrons in any medium or geometry specified by the user, also was used to study the dose distribution around these seed sources. In addition, the exposure rate constant, exposure rate at 1 meter, transmission through the source capsule, f-factor, and energy distribution exiting the source capsule were evaluated by Monte Carlo simulation of these three sources. Good agreement was seen between the measured data and the Monte Carlo generated data. In addition to producing valuable dosimetric data, this study has demonstrated that Monte Carlo modeling of ^{192} Ir and ^{137}Cs seed sources using the EGS Monte Carlo code can provide an accurate means of evaluating these data.

  5. Estimation of radioactive 137-cesium transportation by litterfall, stemflow and throughfall in the forests of Fukushima.

    Science.gov (United States)

    Endo, Izuki; Ohte, Nobuhito; Iseda, Kohei; Tanoi, Keitaro; Hirose, Atsushi; Kobayashi, Natsuko I; Murakami, Masashi; Tokuchi, Naoko; Ohashi, Mizue

    2015-11-01

    Since the Fukushima Dai-ichi Nuclear Power Plant accident in March 2011, large areas of the forests around Fukushima have become highly contaminated by radioactive nuclides. To predict the future dynamics of radioactive cesium ((137)Cs) in the forest catchment, it is important to measure each component of its movement within the forest. Two years after the accident, we estimated the annual transportation of (137)Cs from the forest canopy to the floor by litterfall, throughfall and stemflow. Seasonal variations in (137)Cs transportation and differences between forests types were also determined. The total amount of (137)Cs transported from the canopy to the floor in two deciduous and cedar plantation forests ranged between 3.9 and 11.0 kBq m(-2) year(-1). We also observed that (137)Cs transportation with litterfall increased in the defoliation period, simply because of the increased amount of litterfall. (137)Cs transportation with throughfall and stemflow increased in the rainy season, and (137)Cs flux by litterfall was higher in cedar plantation compared with that of mixed deciduous forest, while the opposite result was obtained for stemflow.

  6. Introduce lichen Lepraria incana as biomonitor of Cesium-137 from Ramsar, northern Iran.

    Science.gov (United States)

    Dalvand, Amin; Jahangiri, Ahmad; Iranmanesh, Jalil

    2016-08-01

    Lichens have been used as biomonitors of airborne radionuclides released in conjunction with nuclear bomb testing as well as nuclear power plant accidents. The potential of lichens for monitoringof radionuclides has been well documented. However, there are no studies that determine natural and artificial radionuclide monitoring by lichens, in Iran. Thus, as a first step, we have conducted a comparison of (137)Csactivity concentration capacity of three epiphytic lichen species including Lepraria incana, Xanthoria parietina and Ramalina farinacea from Ramsar Northern Iran. In this work, accumulation capacity of (137)Cs was determined in 36 lichen samples using a gamma spectrometer equipped with a high purity germanium (HPGe) detector. The results showed that highest accumulation capacity of (137)Cs in the lichen species was found in Lepraria incana and Xanthoria parietina, 30.2, 9.8 Bq/kg respectively, and lowest average accumulation capacity were found in Ramalina farinacea 2.7 Bq/kg (dry weight). This study showed that activity concentration (137)Cs is in crustose > foliose > fruticose lichens in the same biotope. Thus, crustose lichens are capable to accumulate higher (137)Cs than foliose and fruticose species because of different factors such as special morphological characteristics in these species and large surface/volume ratio or longer biological half-life of (137)Cs in lichen Lepraria incana. Therefore, Lepraria incana due to high concentration capability of (137)Cs (approximately 3 and 11 time higher than Xanthoria parietina and Ramalina farinacea, respectively), is introduced as biomonitor of Cesium-137 from Ramsar, North of Iran.

  7. In vivo effects of chronic contamination with 137 cesium on testicular and adrenal steroidogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Grignard, Elise; Gueguen, Yann; Grison, Stephane; Gourmelon, Patrick; Souidi, Maamar [Institute for Radiological Protection and Nuclear Safety, Radiological Protection and Human Health Division, Radiobiology and Epidemiology Department, Laboratory of Experimental Toxicology, BP no 17, Fontenay-aux-Roses Cedex (France); Lobaccaro, Jean-Marc A. [UMR Universite Blaise Pascal-CNRS 6547, Physiologie Comparee et Endocrinologie Moleculaire, Centre de Recherche en Nutrition Humaine d' Auvergne, Aubiere Cedex (France)

    2008-09-15

    More than 20 years after Chernobyl nuclear power plant explosion, radionuclids are still mainly bound to the organic soil layers. The radiation exposure is dominated by the external exposure to gamma-radiation following the decay of {sup 137}Cs and by soil-to-plant-to-human transfer of {sup 137}Cs into the food chain. Because of this persistence of contamination with {sup 137}Cs, questions regarding public health for people living in contaminated areas were raised. We investigated the biological effects of chronic exposure to {sup 137}Cs on testicular and adrenal steroidogenesis metabolisms in rat. Animals were exposed to radionuclide in their drinking water for 9 months at a dose of 6,500 Bq/l (610 Bq/kg/day). Cesium contamination decreases the level of circulating 17{beta}-estradiol, and increases corticosterone level. In testis, several nuclear receptors messenger expression is disrupted; levels of mRNA encoding Liver X receptor {alpha} (LXR{alpha}) and LXR{beta} are increased, whereas farnesoid X receptor mRNA presents a lower level. Adrenal metabolism presents a paradoxical decrease in cyp11a1 gene expression. In conclusion, our results show for the first time molecular and hormonal modifications in testicular and adrenal steroidogenic metabolism, induced by chronic contamination with low doses of {sup 137}Cs. (orig.)

  8. Multi-decadal projections of surface and interior pathways of the Fukushima Cesium-137 radioactive plume

    Science.gov (United States)

    Rossi, Vincent; Van Sebille, Erik; Sen Gupta, Alexander; Garçon, Véronique; England, Matthew H.

    2013-10-01

    Following the March 2011 Fukushima disaster, large amounts of water contaminated with radionuclides, including Cesium-137, were released into the Pacific Ocean. With a half-life of 30.1 years, Cs-137 has the potential to travel large distances within the ocean. Using an ensemble of regional eddy-resolving simulations, this study investigates the long-term ventilation pathways of the leaked Cs-137 in the North Pacific Ocean. The simulations suggest that the contaminated plume would have been rapidly diluted below 10,000 Bq/m3 by the energetic Kuroshio Current and Kurushio Extension by July 2011. Based on our source function of 22 Bq/m3, which sits at the upper range of the published estimates, waters with Cs-137 concentrations >10 Bq/m3 are projected to reach the northwestern American coast and the Hawaiian archipelago by early 2014. Driven by quasi-zonal oceanic jets, shelf waters north of 45°N experience Cs-137 levels of 10-30 Bq/m3 between 2014 and 2020, while the Californian coast is projected to see lower concentrations (10-20 Bq/m3) slightly later (2016-2025). This late but prolonged exposure is related to subsurface pathways of mode waters, where Cs-137 is subducted toward the subtropics before being upwelled from deeper sources along the southern Californian coast. The model suggests that Fukushima-derived Cs-137 will penetrate the interior ocean and spread to other oceanic basins over the next two decades and beyond. The sensitivity of our results to uncertainties in the source function and to inter-annual to multi-decadal variability is discussed.

  9. Cesium-137 as a tracer of soil turbation: example of the taiga landscapes of the Western Siberia, Russia

    Energy Technology Data Exchange (ETDEWEB)

    Usacheva, Anna A.; Semenkov, Ivan N. [The Organization of Russian Academy of Sciences Institute of geology of ore deposits, petrography, mineralogy and geochemistry Russian Academy of Sciences, 119017, Moscow (Russian Federation)

    2014-07-01

    Cesium-137 is artificial radionuclide with 30.17 years half-life. However, this element can be found anywhere due to global atmospheric fallout. Its background storage is detected in landscapes: water, bottom sediments, plants and soils. Almost no one has studied the concentration of {sup 137}Cs in the landscapes of the North, because of its negligible storage. Cesium-137 is slightly mobile in the soils of the North. The cryogenic and other material movement is a typical feature of soils of the North. However, the dating of the soil turbations less than 100 years of age, using existing methods, is possible via long-term stationary observations. To determine the age of soil turbations quicker, one can use slightly mobile artificial radionuclides with medium or long half-life. Cesium-137 satisfies all the criteria. The aim of the work is to estimate suitable of cesium-137 as geo-tracer of soil turbation. According to our evaluation, the activity of the buried layers is less than 10 Bq*kg{sup -1} at the current {sup 137}Cs contamination of surface organic horizons (60-90 Bq*kg{sup -1}). A research has been conducted to study distribution of cesium-137 in the north and middle taiga landscapes of Western Siberia (Russia). Field research was carried out in 2012 in two study areas. The first study area 'Purpe' is located in the middle part of the Pur river basin, near Gubkinsky town (Yamalo-Nenets Autonomous Okrug). The second study area 'Noyabrsk' is located in the Ob and the Pur river watersheds, near Noyabrsk-city (Yamalo-Nenets Autonomous Okrug). Moss-grass-underwood layer (n=13) contains 22±20% of {sup 137}Cs total storage in the landscapes of oligo-trophic bogs with cryohistosols and pine forests on cryopodzols. The main reservoir of cesium-137 is soils (n=24) that accumulate 78±20% of its total landscape storage. The upper 10-cm soil layer contains 90% of {sup 137}Cs soil storage. Cesium-137 activity declines from shrubs and polytric layers

  10. Cobalt-60 and cesium-137 for the sterilization of food. Radiation treatment of food. Mit Kobalt 60 und Caesium 137 gegen Keime in Lebensmitteln. Strahlenbehandlung von Lebensmitteln

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1990-11-01

    The brief article discusses the reasons justifying in the eyes of the authors the irradiation of food with ionizing readiation, the irradiation technique applied using cobalt-60 and cesium-137 as a radiation source, and the possible secondary effects of the method. (VHE).

  11. Cesium-137 in deer: Savannah River Plant vs. southeastern coastal plain herds

    Energy Technology Data Exchange (ETDEWEB)

    Watts, J.R.; Rabon, E.W.; Dicks, A.S.

    1979-01-01

    The /sup 137/Cs content in deer killed during programmed hunts at the Savannah River Plant (SRP) has averaged 9.0 pCi/g. This value, based on measurements of 13,907 deer taken over 14 years (1965 to 1978), similar to the value obtained for 552 deer from other southeastern Coastal Plain locations, indicating the /sup 137/Cs content is due to fallout from the atmospheric testing of nuclear weapons rather than from SRP operations. The computerized SRP data base for each harvested deer includes age, sex, weight, cesium content, kill location, date, and the hunter's name. Analysis of these data enables the estimation of population dose from ingestion of the edible meat. Consumption of all edible meat from deer killed at SRP from 1965 to 1978 gives a whole body population dose of 196 man-rem from /sup 137/Cs. Assuming an annual consumption rate of 20 kg gives an average individual whole body dose of 13 mrem, about 10% of local annual background level. The radiation dose from /sup 40/K of natural potassium content of deer is comparable to the radiation dose from /sup 137/Cs.

  12. Development of urinary biomarkers for internal exposure by cesium-137 using a metabolomics approach in mice.

    Science.gov (United States)

    Goudarzi, Maryam; Weber, Waylon; Mak, Tytus D; Chung, Juijung; Doyle-Eisele, Melanie; Melo, Dunstana; Brenner, David J; Guilmette, Raymond A; Fornace, Albert J

    2014-01-01

    Cesium-137 is a fission product of uranium and plutonium in nuclear reactors and is released in large quantities during nuclear explosions or detonation of an improvised device containing this isotope. This environmentally persistent radionuclide undergoes radioactive decay with the emission of beta particles as well as gamma radiation. Exposure to (137)Cs at high doses can cause acute radiation sickness and increase risk for cancer and death. The serious health risks associated with (137)Cs exposure makes it critical to understand how it affects human metabolism and whether minimally invasive and easily accessible samples such as urine and serum can be used to triage patients in case of a nuclear disaster or a radiologic event. In this study, we have focused on establishing a time-dependent metabolomic profile for urine collected from mice injected with (137)CsCl. The samples were collected from control and exposed mice on days 2, 5, 20 and 30 after injection. The samples were then analyzed by ultra-performance liquid chromatography coupled to time-of-flight mass spectrometry (UPLC/TOFMS) and processed by an array of informatics and statistical tools. A total of 1,412 features were identified in ESI(+) and ESI(-) modes from which 200 were determined to contribute significantly to the separation of metabolomic profiles of controls from those of the different treatment time points. The results of this study highlight the ease of use of the UPLC/TOFMS platform in finding urinary biomarkers for (137)Cs exposure. Pathway analysis of the statistically significant metabolites suggests perturbations in several amino acid and fatty acid metabolism pathways. The results also indicate that (137)Cs exposure causes: similar changes in the urinary excretion levels of taurine and citrate as seen with external-beam gamma radiation; causes no attenuation in the levels of hexanoylglycine and N-acetylspermidine; and has unique effects on the levels of isovalerylglycine and

  13. An Integrated Hydrologic Modeling Approach to Cesium-137 Transport in Forested Fukushima Watersheds

    Science.gov (United States)

    Siirila-Woodburn, E. R.; Steefel, C. I.; Williams, K. H.; Birkholzer, J. T.

    2015-12-01

    The 2011 Fukushima Daiichi Nuclear Power Plant (FDNPP) accident in Japan resulted in a significant dissemination of cesium-137 (Cs-137) over a wide area west of the plant, including the contamination of many watersheds and the subsequent evacuation of many communities. Today approximately 90% of on-land Cs-137 fallout following the accident resides in the upper 5 cm of forest soils. While this can be partially attributed to the forested composition of the prefecture (70%), there is also difficulty in cleanup efforts in these regions due to a lack of understanding and predictive capability of radioisotopes transport at the catchment to watershed scale. Subsequently, there is an uncertain, but likely long-term impact on local communities with implications for the use of nuclear energy use worldwide. Due to the complex nature of forest eco-hydrology, sophisticated modeling tools to accurately predict Cs-137 fluxes across different spatial and temporal scales are required. High fidelity, high resolution numerical modeling techniques in conjunction with parallel high performance computing is required to accurately determine transport and feedbacks in these complex systems. To better understand the fundamental transport of Cs-137, a watershed near the FDNPP is modeled with an integrated hydrologic model that includes variably saturated groundwater and overland flow in addition to atmospheric and vegetative processes via a coupled land surface model. Of specific interest is the impact of land cover type on hydrologic flow in the area, which will likely play an important role in erosion patterns and the consequent transport of Cs-137 strongly sorbed to surface soils. Risk management practices (for example, passive remediation versus active remediation such as targeted logging) for two principal tree types (evergreen and deciduous) are informed given the simulated responses to flow patterns assuming different quantities and spatial distribution patterns of each tree type.

  14. Selecting and applying cesium-137 conversion models to estimate soil erosion rates in cultivated fields.

    Science.gov (United States)

    Li, Sheng; Lobb, David A; Tiessen, Kevin H D; McConkey, Brian G

    2010-01-01

    The fallout radionuclide cesium-137 ((137)Cs) has been successfully used in soil erosion studies worldwide. However, discrepancies often exist between the erosion rates estimated using various conversion models. As a result, there is often confusion in the use of the various models and in the interpretation of the data. Therefore, the objective of this study was to test the structural and parametrical uncertainties associated with four conversion models typically used in cultivated agricultural landscapes. For the structural uncertainties, the Soil Constituent Redistribution by Erosion Model (SCREM) was developed and used to simulate the redistribution of fallout (137)Cs due to tillage and water erosion along a simple two-dimensional (horizontal and vertical) transect. The SCREM-predicted (137)Cs inventories were then imported into the conversion models to estimate the erosion rates. The structural uncertainties of the conversion models were assessed based on the comparisons between the conversion-model-estimated erosion rates and the erosion rates determined or used in the SCREM. For the parametrical uncertainties, test runs were conducted by varying the values of the parameters used in the model, and the parametrical uncertainties were assessed based on the responsive changes of the estimated erosion rates. Our results suggest that: (i) the performance/accuracy of the conversion models was largely dependent on the relative contributions of water vs. tillage erosion; and (ii) the estimated erosion rates were highly sensitive to the input values of the reference (137)Cs level, particle size correction factors and tillage depth. Guidelines were proposed to aid researchers in selecting and applying the conversion models under various situations common to agricultural landscapes.

  15. [Characteristics of mitochondria and myocardium ultrastructure of rats following chronic incorporation of cesium radionuclides 137 Cs].

    Science.gov (United States)

    Gritsuk, A I; Matiukhina, T G; Koval', A N; Sergeenko, S M; Svergun, V T; Verner, A I; Gritsuk, N A

    2002-01-01

    Ultrastructure, tissue respiration and oxidative phosphorilation were studies in the myocardium of animals after chronic natural irradiation by 137Cs in quantities that can in reality threaten population of radionuclide-polluted regions. Decline in the respiratory activity of the myocardium and ultrastructural disorders can be attributed to the effects of ions of radioactive Cs which is also a potassium antagonist. A hypothesis has been put forward according to which cesium blocks potassium channels in mitochondria and thus changes the volume and configuration of internal mitochondrial membranes, and impacts the respiratory processes. In the opinion of the authors, these changes characterize the mitochondrial phase of apoptosis which, in the event of chronic exposure to radionuclides, is a compensatory-adaptive mechanism eliminating the least immutable subpopulation of cardiomyocites.

  16. [Improvement of gynecologic radium therapy through the afterloading method using cesium 137].

    Science.gov (United States)

    Fournier, D V; Senf, W; Kuttig, H; Kubli, F

    1976-03-01

    For all centers performing gynecological contact irradiation the use of afterloading techniques is urgently required, since they eliminate any radiation exposure to the personnel. The radio-therapist may position and control the empty applicators still free from radiation withoug haste. This procedure diminishes the occurrence of overdosages and underdosages. The care for the patients is possible without radiation exposure, and the morbidity of contact therapy can be reduced by occasional mobilization of the patient, the applicator without sources remaining at its place. The fully automatic apparatus "Curietron" using cesium-137 sources (0.662 MeV gamma emission, half-life period 26.6 years) with an equivalent source activity (factor 2.6) yields the dose distribution demanded in the gynecologic field which in practice is identical to that of Ra-226 (medium gamma emission 1 MeV, half-life period 1620 years). With similar dose distribution, a biological and therapeutical effect alike to Ra-226 may be expected from Cs-137. In comparison with Ra-226, the following advantages of Cs-137 may be mentioned: Lower half-value thickness of 5.5 mm lead (low expenses for radioprotection), less danger with handling (no emanation of radioactive gases), and lower contamination risks in case of breaking. The measured dose distributions at equivalent source activity and similar geometry of the applicators revealed the possibility with regard of all techniques of gynecologic irradiation utilized in our field of arriving at similar relative and absolute dose distributions by means of the Cs-137 afterloading technique. Whilst short-term afterloading irradiation with highly active sources, their radiobiological effectiveness being not yet ascertained, has to be tested at appropriate scientific centers, it is necessary to demand afterloading techniques with dosages and duration of irradiations approved over decades for all centers of gynecological contact therapy because of radiation

  17. The Transfer and diffusion of Cesium 137 within forest ecosystem in Fukushima after the nuclear power plant accident

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Takahiro; Murakami, Masashi [Community Ecology Lab., Biology Course, Faculty of Science, Chiba University, Chiba, 263-8522 (Japan); Ishii, Nobuyoshi [National Institute of Radiological Sciences, Chiba, 263-8555 (Japan); Tanoi, Keitaro; Hirose, Atsushi; Ohte, Nobuhito [Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo, 113-8657 (Japan)

    2014-07-01

    A large amount of radionuclides was released from the Fukushima Daiichi Nuclear Power Plant (FDNPP) accident after the disastrous earthquake and subsequent tsunami of March 2011. Among the variety of radionuclides released from FDNPP, cesium 137 ({sup 137}Cs) is the most worrying radionuclide in the environment, with a half-life of 30 years. Since most of the Japanese land area is covered by forest, the distribution and transportation of radioactive materials within forest ecosystems should be conscientiously monitored. In Europe, many studies reported that the {sup 137}Cs deposition caused by the Chernobyl accident has still been distributed in the litter and soil layers and has become a source for the soil-to-plant transfer. Most of these studies emphasize the 'stability' of {sup 137}Cs within forest ecosystems, because {sup 137}Cs are considered to be strongly and immediately fixed in clay minerals. Even though there are many studies of the soil-to-plant transfer of {sup 137}Cs in forest after several years of Chernobyl accident, very initial distribution and transfer of {sup 137}Cs in food web within one to two years after the deposition in forest ecosystems have never been examined. The evaluation of the initial dynamics of {sup 137}Cs in forest ecosystems should be quite important because of the increasing stability of {sup 137}Cs after the deposition. The accumulation and transfer of {sup 137}Cs through food web within forest ecosystems were examined by collecting various organisms at forests in Fukushima. The {sup 137}Cs concentrations, natural Cs and K concentrations, and delta {sup 15}N of the specimens were measured to evaluate the occurrence of bioaccumulation or bio-diffusion of {sup 137}Cs through tropic interaction within forest ecosystem. {sup 137}Cs was highly concentrated on leaf litters which had been deposited in autumn 2010, before the accident. This accumulated {sup 137}Cs had transferred to higher trophic organisms mainly through

  18. Interaction of radiation-generated free radicals with collagen and metalloproteins using cesium-137 gamma source

    Science.gov (United States)

    Shieh, James J.; Wierbicki, Eugen

    The interaction of collagen and metalloproteins with radiation-generated radicals has been studied using spectrophotometric, chromatographic, and ESR techniques. The hydroxyl radical (·OH) reacted with and caused polymerization of acid soluble collagen. Similar reactions were also observed in a ferrimyoglobin and cytochrome C system. Insoluble collagen from bovine muscle subjected to radiation is followed by a first-order process for the decay of free radicals, depending on relative humidity of the system. When the samples were irradiated with 3 kGy at 25°C by a Cesium-137 Irradiator, the observed half life (hr) of free radicals in the samples decreased with increase of relative humidity RH: 31% > 69% > 100%. When collagen, previously kept dry or under 31% RH, was irradiated with 3 kGy at 77°K (-196°C), the decay of free radicals reached a plateau with annealing at -120°C or higher. The decay kept decreasing with annealing at -100°C or higher temperature when collagen maintained at 69 and 100% RH was used. It is concluded that the free radicals in moistened collagen from bovine muscle decreased at a higher rate than in dried collagen. This suggests that free radicals may persist for a longer period of time in irradiated dry proteins of food or animal feed than in foods of higher moisture extent.

  19. The determination of Fukushima-derived cesium-134 and cesium-137 in Japanese green tea samples and their distribution subsequent to simulated beverage preparation.

    Science.gov (United States)

    Cook, Matthew C; Stukel, Matthew J; Zhang, Weihua; Mercier, Jean-Francois; Cooke, Michael W

    2016-03-01

    Health Canada's Radiation Protection Bureau has identified trace quantities of (134)Cs and (137)Cs in commercially available green tea products of Japanese origin. Referenced to March 11, 2011, the activity ratio ((134)Cs/(137)Cs) has been determined to be 1:1, which supports an origin from the Fukushima Dai-ichi Nuclear Power Plant accident. The upper limits of typical tea beverage preparation conditions were applied to the most contaminated of these green tea samples to determine the proportion of radiocesium contamination that would be available for human consumption. The distribution of radiocesium among the components of the extraction experiments (water, residual tea solid, and filter media) was determined by both conventional and Compton-suppressed gamma spectroscopy. The latter aided tremendously in providing a more complete radiocesium distribution profile, particularly for the shorter-lived (134)Cs. Cesium extraction efficiencies of 64 ± 7% and 64 ± 5% were determined based on (134)Cs and (137)Cs, respectively. Annual, effective dose estimates from ingestion of (137)Cs and (134)Cs (1.8-3.7 μSv), arising from the consumption of tea beverages prepared from the most contaminated of these samples, are insignificant relative to both total (∼ 2.4 mSv) and ingested (∼ 0.28 mSv) annual effective doses received from naturally occurring radioactive sources. As such, there is no health concern arising from the consumption of green tea beverages contaminated with radiocesium at the levels encountered in this study.

  20. Contribution of Asian dust to atmospheric deposition of radioactive cesium ((137)Cs).

    Science.gov (United States)

    Fukuyama, Taijiro; Fujiwara, Hideshi

    2008-11-01

    Both Asian dust (kosa) transported from the East Asian continent and locally suspended dust near monitoring sites contribute to the observed atmospheric deposition of (137)Cs in Japan. To estimate the relative contribution of these dust phenomena to the total (137)Cs deposition, we monitored weekly deposition of mineral particles and (137)Cs in spring. Deposition of (137)Cs from a single Asian dust event was 62.3 mBq m(-2) and accounted for 67% of the total (137)Cs deposition during the entire monitoring period. Furthermore, we found high (137)Cs specific activity in the Asian dust deposition sample. Although local dust events contributed to (137)Cs deposition, their contribution was considerably smaller than that of Asian dust. We conclude that the primary source of atmospheric (137)Cs in Japan is dust transported from the East Asian continent.

  1. Assessing relationships between forest structure and soil erosion in mountainous forest using a Cesium-137 tracer technique

    Science.gov (United States)

    Choi, Kwanghun; Reineking, Björn

    2016-04-01

    The fallout radionuclides (FRNs) particularly Cesium-137 are known as a quantitatively reliable means of estimating sediment redistribution rates within agricultural landscapes and forested area. However, fewer studies have done using FRNs in forested areas even though understanding soil redistribution patterns in mountainous forest areas is one of the important issues for forest management. The objective of this study is to figure out key forest structures affecting soil redistribution rate. In this study, we estimated soil loss and gain rate at 50 points with various forest types and topography in steep mountainous forest area in the Experimental Forest of Kangwon National University in Kangwon Province, South Korea by the Cesium-137 tracing technique. The results show the factors related to the topography such as slope and water accumulation have little effect on soil redistribution rate. The shrub and small tree layer affect more on soil redistribution rate. Additionally, the data shows relatively higher erosion rate in Korean Pine tree plantation area (Pinus koraiensis Sieb. et Zucc.) than semi-natural deciduous and Quercus forests where shrubs and small trees are more prevalent.

  2. Chronic exposure of adult, postnatal and in utero rat models to low-dose 137Cesium: impact on circulating biomarkers

    Science.gov (United States)

    Manens, Line; Grison, Stéphane; Bertho, Jean-Marc; Lestaevel, Philippe; Guéguen, Yann; Benderitter, Marc; Aigueperse, Jocelyne; Souidi, Maâmar

    2016-01-01

    The presence of 137Cesium (137Cs) in the environment after nuclear accidents at Chernobyl and more recently Fukushima Daiichi raises many health issues for the surrounding populations chronically exposed through the food chain. To mimic different exposure situations, we set up a male rat model of exposure by chronic ingestion of a 137Cs concentration likely to be ingested daily by residents of contaminated areas (6500 Bq.l−1) and tested contaminations lasting 9 months for adult, neonatal and fetal rats. We tested plasma and serum biochemistry to identify disturbances in general indicators (lipids, proteins, carbohydrates and electrolytes) and in biomarkers of thyroid, heart, brain, bone, kidney, liver and testis functions. Analysis of the general indicators showed increased levels of cholesterol (+26%), HDL cholesterol (+31%), phospholipids B (+15%) and phosphorus (+100%) in the postnatal group only. Thyroid, heart, brain, bone and kidney functions showed no blood changes in any model. The liver function evaluation showed changes in total bilirubin (+67%) and alkaline phosphatase (–11%) levels, but only for the rats exposed to 137Cs intake in adulthood. Large changes in 17β-estradiol (–69%) and corticosterone (+36%) levels affected steroidogenesis, but only in the adult model. This study showed that response profiles differed according to age at exposure: lipid metabolism was most radiosensitive in the postnatal model, and steroid hormone metabolism was most radiosensitive in rats exposed in adulthood. There was no evidence of deleterious effects suggesting a potential impact on fertility or procreation. PMID:27466399

  3. Bioaccumulation of cesium-137 in yellow bullhead catfish (Ameiurus natalis) inhabiting an abandoned nuclear reactor reservoir

    Energy Technology Data Exchange (ETDEWEB)

    McCreedy, C.D.; Glickman, L.T. [Purdue Univ., West Lafayette, IN (United States). Dept. of Veterinary Pathobiology; Jagoe, C.H.; Brisbin, I.L. Jr. [Univ. of Georgia, Aiken, SC (United States). Savannah River Ecology Lab.

    1997-02-01

    Bioaccumulation of {sup 137}Cs was investigated in yellow bullhead catfish (Ameiurus natalis) inhabiting an abandoned reactor reservoir, Pond B, Savannah River Site, Barnwell Co., South Carolina. The authors collected fish by trap-netting, and determined ages from pectoral spines. Muscle and other tissues were assayed for {sup 137}Cs by NaI-scintillation. Music {sup 137}Cs was unrelated to sex or mass of fish, but was related to age. Examination of least-squares means suggested that {sup 137}Cs in muscle increased up to about age 3, but did not increase with greater age. A modified Richards model showed equilibrium {sup 137}Cs concentration in muscle was acquired in approximately 2.4 years. Growth differed between sexes and the time to asymptotic body mass was longer than the time to attain equilibrium {sup 137}Cs concentration. Males attained an asymptotic mass of 577 g in approximately 6.3 years; females attained an asymptotic mass of 438 g in approximately 5.9 years. The cumulative {sup 137}Cs burden of the population was 4.9 {times} 10{sup 6} Bq, representing <0.001% of the {sup 137}Cs inventory of the reservoir. Concentration of {sup 137}Cs varied among tissues with gill and muscle the lowest and highest. Concentration of {sup 137}Cs in ovaries declined with increasing ovary mass. Until equilibrium is attained in these fish, {sup 137}Cs concentration is directly related to increasing age rather than size.

  4. 137 CS content in coconut water and copra in French Polynesia: contribution to the dose for population; Le cesium 137 dans la noix de coco en polynesie francaise : contribution a l'exposition de la population

    Energy Technology Data Exchange (ETDEWEB)

    Poletiko, C.; Arnould, C.; Sarbach, J. [Laboratoire d' etude et de surveillance de l' environnement, Papeete, Polynesie francaise, Tahiti (France); Bablet, J.P.; Ducousso, R. [Service mixte de controle biologique, Monthlery cedex (France)

    1992-07-01

    Coconut tree has the peculiarity to be a good integrator for alkaline metals. The isotope 137 of cesium, which was generated during previous atmospheric nuclear tests, has a high fission yield and a half-life of about 30 years; this nuclide is supposed to be still present in food chain in French Polynesia. In this food chain coconut water and coconut copra are ingested depending upon diet customs and areas of French Polynesia. For some islands, among local foodstuffs, cesium 137 content in coconut highly contributes to the dose. Spectrometry gamma results and annual doses calculation since 1966 are displayed. (author)

  5. Germline mutations in people descendants occupationally exposed to ionizing radiation from Cesium 137; Mutacoes germinativas na prole de pessoas expostas ocupacionalmente a radiacao ionizante de Cesio 137

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Juliana Ferreira da

    2016-07-01

    The radiological accident in Goiania in 1987, resulted in a serious episode of human contamination, animal, plant and environmental were exposed to Cesium 137 chloride ({sup 137}CsCl) that caused contamination and accidental and occupational exposure to ionizing radiation. Ionizing radiation is one of the environmental components that causes most cellular stress in complex organisms. Exposure to ionizing radiation induces breaks in nucleic acids, especially, DNA double and single strand breaks. Chromosomal microarray analysis is an important tool for the detection and microdeletion and microduplications in the genomes. In this study we proposed to analyze the effect of exposure to RI on the formation of CNVs in an exposed human population occupationally to ionizing radiation from Cesium 137 during the accident in Goiania. The exposed group consisted of 07 families, of which at least one parent was occupationally exposed to ionizing radiation from Cesium 137, including a total of 25 individuals, do not know the absorbed dose of the military who were occupationally exposed to ionizing radiation. 11 families with a group of individuals not exposed to IR was used as control were used including a total of 33 individuals with no history of exposure to RI. The genotyping microarray was conducted in CytoScan HD system (Affymetrix®) without then analyzes was performed in ChAS® software. The statistical tests used were: Shapiro-Wilk, Mann- Whitney U, Spearman correlation, discriminant function analysis, binomial test, χ{sup 2} test. All analyzes were performed using the statistical package SPSS 21.0, with a significance level of 5% (p <0.05). The frequency of CNVs were estimated loss / generation, gain / generation and burden / generation, representing 3,9 x 10{sup -5}, 6,8 x 10{sup -6} and 4,6 x 10{sup -5} respectively for the exposed group. For the control group, the frequencies were 2,1 x 10{sup -5}, 5,9 x 10{sup -6} and 3,1 x 10{sup -5} respectively. Thus, the

  6. Individual Radiological Protection Monitoring of Utrok Atoll Residents Based on Whole Body Counting of Cesium-137 (137Cs) and Plutonium Bioassay

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T; Kehl, S; Brown, T; Martinelli, R; Hickman, D; Jue, T; Tumey, S; Langston, R

    2007-06-08

    This report contains individual radiological protection surveillance data developed during 2006 for adult members of a select group of families living on Utrok Atoll. These Group I volunteers all underwent a whole-body count to determine levels of internally deposited cesium-137 ({sup 137}Cs) and supplied a bioassay sample for analysis of plutonium isotopes. Measurement data were obtained and the results compared with an equivalent set of measurement data for {sup 137}Cs and plutonium isotopes from a second group of adult volunteers (Group II) who were long-term residents of Utrok Atoll. For the purposes of this comparison, Group II volunteers were considered representative of the general population on Utrok Atoll. The general aim of the study was to determine residual systemic burdens of fallout radionuclides in each volunteer group, develop data in response to addressing some specific concerns about the preferential uptake and potential health consequences of residual fallout radionuclides in Group I volunteers, and generally provide some perspective on the significance of radiation doses delivered to volunteers (and the general Utrok Atoll resident population) in terms of radiological protection standards and health risks. Based on dose estimates from measurements of internally deposited {sup 137}Cs and plutonium isotopes, the data and information developed in this report clearly show that neither volunteer group has acquired levels of internally deposited fallout radionuclides specific to nuclear weapons testing in the Marshall Islands that are likely to have any consequence on human health. Moreover, the dose estimates are well below radiological protection standards as prescribed by U.S. regulators and international agencies, and are very small when compared to doses from natural sources of radiation in the Marshall Islands and the threshold where radiation health effects could be either medically diagnosed in an individual or epidemiologically discerned in a

  7. The migration of cesium-137 through cement formulations applicable to radioactive waste management

    Energy Technology Data Exchange (ETDEWEB)

    Rudin, M.J.

    1989-01-01

    Eighteen portland cement formulations containing three levels of cement/fly ash content (100%/0%, 85%/15%, and 60%/40%), two levels of water to cementitious solids ratio (0.33 and 0.43) and three levels of additive (none, silica fume, and latex polymer) were tested. Each formulation was molded into a solid cement specimen containing a centered well space which served as a reservoir for a {sup 137}Cs solution. After a predetermined time period, the {sup 137}Cs solution was removed and a 2-cm long by 1.27-cm diameter cement core was extracted from the monolith well bottom using a diamond core drill. Each cement core was then cut into successive horizontal slices with a diamond saw blade. The net activity of {sup 137}Cs in each slice was determined with a NaI(T1) detector connected to a single-channel analyzer. Analysis of variance (ANOVA) and regression models were used to examine the statistical relationship between different formulations in terms of the {sup 137}Cs activity in the cement slices versus the migration distance as indicated by the respective slice depths. Results indicated that mixes incorporating 5% silica fume at a low w/s ratio are relatively effective in retarding {sup 137}Cs migration when compared to the other formulations tested. Formulations with a w/s ratio of 0.33 consistently demonstrated better containment of the {sup 137}Cs solution compared to those formulations with a w/s ratio of 0.43. However, it was possible to obtain comparable {sup 137}Cs retardation at a higher w/s ratio if large amounts of fly ash were added to 5% EMSAC mixes at w/s = 0.43. The addition of 5% latex polymer did not improve the ability of cements to retard {sup 137}Cs ion migration under the curing conditions used.

  8. Distribution of cesium-137 in Japanese forest soils. Correlation with the contents of organic carbon

    Energy Technology Data Exchange (ETDEWEB)

    Takenaka, Chisato; Onda, Yuichi [School of Agricultural Science, Nagoya University, Chikusa-ku, Nagoya (Japan); Hamajima, Yasunori [Department of Chemistry, Kanazawa University, Kakuma, Kanazawa (Japan)

    1998-10-27

    The spatial and vertical distributions of {sup 137}Cs in surface soils were surveyed and analyzed then correlated with the contents of organic carbon in the hinoki (Chamaecyparis obtusa Sieb. et Zucc.) plantation forest and secondary forest dominated by red pine (Pinus densiflora Sieb. et Zucc.) in Japan. The spatial variation of {sup 137}Cs activity was observed in the surface soil around the red pine. The average activity of 16 samples around the tree is 42.4 Bq/kg and the standard deviation is 25.9 Bq/kg. This finding indicates the importance in the selection of a sampling site and the number of samples from the surface soils especially around a tree. For the vertical distribution of {sup 137}Cs activity, it was found that the concentration in the surface soil is highest, 149 Bq/kg in the hinoki stand and 101 Bq/kg in the red pine stand, and decreases with depth. The relationship between {sup 137}Cs activity and carbon content in the forest soil was investigated in two undisturbed forest stands. The relations were more precisely expressed using an exponential equation than by a linear equation. From the same forest, similar regression equations were obtained. This indicates that the distribution of {sup 137}Cs could be characterized by the organic carbon content in an undisturbed forest. It is also suggested that the coefficient values in the regression equation help to define the movement of {sup 137}Cs accompanying the decomposition of organic matter

  9. Depth distribution of cesium-137 in paddy fields across the Fukushima pollution plume in 2013.

    Science.gov (United States)

    Lepage, Hugo; Evrard, Olivier; Onda, Yuichi; Lefèvre, Irène; Laceby, J Patrick; Ayrault, Sophie

    2015-09-01

    Large quantities of radiocesium were deposited across a 3000 km(2) area northwest of the Fukushima Dai-ichi nuclear power plant after the March 2011 accident. Although many studies have investigated the fate of (137)Cs in soil in the months following the accident, the depth distribution of this radioactive contaminant in rice paddy fields requires further examination after the typhoons that occurred in this region. Such investigations will help minimize potential human exposure in rice paddy fields. Radionuclide activity concentrations, organic content and particle size were analysed in 10 soil cores sampled from paddy fields in November 2013, 20 km north of the Fukushima power plant. Our results demonstrate limited depth migration of (137)Cs with the majority concentrated in the uppermost layers of soils (accident, between 46.8 and 98.7% of the total (137)Cs inventories was found within the top 5 cm of the soil surface, despite cumulative rainfall totalling 3300 mm. Furthermore, there were no significant correlations between (137)Cs depth distribution and the other parameters. We attributed the maximum depth penetration of (137)Cs to grass cutting (73.6-98.5% of (137)Cs in the upper 5 cm) and farming operations (tillage - 46.8-51.6% of (137)Cs in the upper 5 cm). As this area is exposed to erosive events, ongoing decontamination works may increase soil erodibility. We therefore recommend the rapid removal of the uppermost - contaminated - layer of the soil after removing the vegetation to avoid erosion of contaminated material during the subsequent rainfall events. Further analysis is required to thoroughly understand the impacts of erosion on the redistribution of radiocesium throughout the Fukushima Prefecture.

  10. Ruthenium-103, iodine-131, tellurium-132, and cesium-137 in air after the Chernobyl event

    Energy Technology Data Exchange (ETDEWEB)

    Liu, C.K.; Faller, S.H.; Kuroda, P.K. (Environmental Protection Agency, Las Vegas, NV (USA). Environmental Monitoring Systems Lab.)

    1990-01-01

    Concentrations of airborne fission products during the month following the Chernobyl event, were analyzed by gamma-ray counting of 283 air filter samples that were collected at 20 different locations in the western United States. While the presence of {sup 103}Ru, {sup 131}I, {sup 134}Cs and {sup 137}Cs was detected in many of the air filter samples, 78.2-hour {sup 132}Te was detected in only 19 samples all from the sampling stations located in the State of Nevada. The results obtained in this study indicate that the release of {sup 131}I from the Chernobyl reactor was roughly 50 percent greater than that of {sup 137}Cs, while the release of {sup 137}Cs was about 8 times that of {sup 103}Ru and 25 percent greater than that of {sup 132}Te. (orig.).

  11. Predicting Sediment and Cesium-137 Transported to Offsite During Extreme Floods

    Energy Technology Data Exchange (ETDEWEB)

    Bao, Y.

    1999-04-12

    This paper presents the methods and results of a research project for predicting contaminated sediment transport from Oak Ridge Reservation to offside under potential extreme flood conditions. A computer model, Hydrologic Simulation Program--FORTRANE (HSPF), was calibrated and validated for White Oak Creek watershed using a five-year data. The model was then used to quantify the effects of a potential 100-year flood event in terms of the sediment transport and {sup 137}Cs movement. Results from computer simulation showed that during a 100-year flood event the watershed and channel bed became the major sources of the {sup 137}Cs. A 100-year flood event may result in 3.2 Ci of the total annual release of {sup 137}Cs which is six times of the averaged annual release observed during a five-year time period.

  12. EFFECTIVE HALF-LIFE OF CESIUM-137 IN VARIOUS ENVIRONMENTAL MEDIA AT THE SAVANNAH RIVER SITE

    Energy Technology Data Exchange (ETDEWEB)

    Jannik, T.; Paller, M.; Baker, R.

    2013-12-12

    During the operational history of the Savannah River Site (SRS), many different radionuclides have been released from site facilities into the SRS environment. However, only a relatively small number of pathways, most importantly {sup 137}Cs in fish and deer, have contributed significantly to doses and risks to the public. The “effective” half-lives (T{sub e}) of {sup 137}Cs (which include both physical decay and environmental dispersion) in Savannah River floodplain soil and vegetation and in fish and white-tailed deer from the SRS were estimated using long-term monitoring data. For 1974–2011, the T{sub e}s of {sup 137}Cs in Savannah River floodplain soil and vegetation were 17.0 years (95% CI = 14.2–19.9) and 13.4 years (95% CI = 10.8–16.0), respectively. These T{sub e}s were greater than in a previous study that used data collected only through 2005 as a likely result of changes in the flood regime of the Savannah River. Field analyses of {sup 137}Cs concentrations in deer collected during yearly controlled hunts at the SRS indicated an overall T{sub e} of 15.9 years (95% CI = 12.3–19.6) for 1965–2011; however, the T{sub e} for 1990–2011 was significantly shorter (11.8 years, 95% CI = 4.8–18.8) due to an increase in the rate of {sup 137}Cs removal. The shortest T{sub e}s were for fish in SRS streams and the Savannah River (3.5–9.0 years), where dilution and dispersal resulted in rapid {sup 137}Cs removal. Long-term data show that T{sub e}s are significantly shorter than the physical half-life of {sup 137}Cs in the SRS environment but that they can change over time. Therefore, it is desirable have a long period of record for calculating Tes and risky to extrapolate T{sub e}s beyond this period unless the processes governing {sup 137}Cs removal are clearly understood.

  13. Wide Area Recovery and Resiliency Program (WARRP) Interim Clearance Strategy for Environments Contaminated with Cesium-137

    Science.gov (United States)

    2012-07-01

    Goiania ) and those containing 137Cs and other radionuclides (Chernobyl). Another group contains documents relevant to site survey 3 procedures...immediate and effective recovery (as was done in Goiania , Brazil). It is possible to graphically display the spectrum of clearance levels from

  14. Pulsed redistribution of a contaminant following forest fire: cesium-137 in runoff.

    Science.gov (United States)

    Johansen, Mathew P; Hakonson, Thomas E; Whicker, F Ward; Breshears, David D

    2003-01-01

    Of the natural processes that concentrate dispersed environmental contaminants, landscape fire stands out as having potential to rapidly concentrate contaminants and accelerate their redistribution. This study used rainfall simulation methods to quantify changes in concentration of a widely dispersed environmental contaminant (global fallout 137Cs) in soils and surface water runoff following a major forest fire at Los Alamos, New Mexico, USA. The 137Cs concentrations at the ground surface increased up to 40 times higher in ash deposits and three times higher for the topmost 50 mm of soil compared with pre-fire soils. Average redistribution rates were about one order of magnitude greater for burned plots, 5.96 KBq ha(-1) mm(-1) rainfall, compared with unburned plots, 0.55 KBq ha(-1) mm(-1) rainfall. The greatest surface water transport of 137Cs, 11.6 KBq ha(-1) mm(-1), occurred at the plot with the greatest amount of ground cover removal (80% bare soil) following fire. Concentration increases of 137Cs occurred during surface water erosion, resulting in enrichment of 137Cs levels in sediments by factors of 1.4 to 2.9 compared with parent soils. The elevated concentrations in runoff declined rapidly with time and cumulative precipitation occurrence and approached pre-fire levels after approximately 240 mm of rainfall. Our results provide evidence of order-of-magnitude concentration increases of a fallout radionuclide as a result of forest fire and rapid transport of radionuclides following fire that may have important implications for a wide range of geophysical, ecosystem, fire management, and risk-based issues.

  15. AN OVERVIEW OF CESIUM-137 CONTAMINATION IN A SOUTHEASTERN SWAMP ENVIRONMENT

    Energy Technology Data Exchange (ETDEWEB)

    Fledderman, P; Tim Jannik, T; Michael Paller, M

    2006-10-09

    In the early 1960s, an area of privately owned swamp adjacent to the Savannah River Site (SRS) was contaminated by site operations. Studies conducted in 1974 estimated that approximately 925 GBq of {sup 137}Cs and 37 GBq of {sup 60}Co were deposited in the swamp. Subsequently, a series of surveys was initiated to characterize the contaminated environment. These surveys--composed of 52 monitoring locations--allow for continued monitoring at a consistent set of locations. Initial survey results indicated maximum {sup 137}Cs concentrations of 19.5 Bq g{sup -1} in soil and 8.7 Bq g{sup -1} in vegetation. By the 2004-2005 surveys, maximum concentrations had declined to 1-2 Bq g{sup -1} in soil and 0.4 Bq g{sup -1} in vegetation.

  16. AN OVERVIEW OF CESIUM-137 CONTAMINATION IN A SOUTHEASTERN SWAMP ENVIRONMENT

    Energy Technology Data Exchange (ETDEWEB)

    Fledderman, P; Tim Jannik, T; Michael Paller, M

    2007-04-04

    In the early 1960s, an area of privately owned swamp adjacent to the Savannah River Site (SRS) was contaminated by site operations. Studies conducted in 1974 estimated that approximately 925 GBq of {sup 137}Cs and 37 GBq of {sup 60}Co were deposited in the swamp. Subsequently, a series of surveys was initiated to characterize the contaminated environment. These surveys--composed of 52 monitoring locations--allow for continued monitoring at a consistent set of locations. Initial survey results indicated maximum {sup 137}Cs concentrations of 19.5 Bq g{sup -1} in soil and 8.7 Bq g{sup -1} in vegetation. By the 2004-2005 surveys, maximum concentrations had declined to 1-2 Bq g{sup -1} in soil and 0.4 Bq g{sup -1} in vegetation.

  17. Reconstruction and analysis of cesium-137 fallout deposition patterns in the Marshall Islands

    Science.gov (United States)

    Whitcomb, Robert Cleckley, Jr.

    Estimates of 137Cs deposition due to fallout originating from nuclear weapons testing in the Marshall Islands have been made for several locations in the Marshall Islands. These retrospective estimates were based primarily on historical exposure rate and gummed film measurements. The methods used to reconstruct these deposition estimates are specific for six of the Pacific tests. These methods are also similar to those used in the National Cancer Institute study for reconstructing 131I deposition from the Nevada Test Site. Reconstructed cumulative deposition estimates are validated against contemporary measurements of 137Cs concentration in soil. This validation work also includes an accounting for estimated global fallout contributions. These validations show that the overall geometric bias in predicted-to-observed (P/O) ratios is 1.0 (indicating excellent agreement). The 5th and 95th percentile range of this distribution is 0.35--2.95. The P/O ratios for estimates using historical gummed film measurements tend to slightly over-predict more than estimates using exposure rate measurements. The methods produce reasonable estimates of deposition confirming that radioactive fallout occurred at atolls further south of the four northern atolls recognized by the Department of Energy as being affected by fallout. The deposition estimate methods, supported by the very good agreement between estimates and measurements, suggest that these methods can be used for other weapons testing fallout radionuclides with confidence.

  18. Cytogenetic evaluation of persons exposed to Cesium-137 radiation accident in Goiania (Brazil); Avaliacao citogenetica de individuos expostos acidentalmente a radiacao ionizante de Cesio-137 em Goiania (Brasil)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Claudio Carlos da

    2000-07-01

    This dissertation describes a cytogenetic evaluation of individuals exposed to cesium-137 gamma radiation during the radioactive accident of Goiania in 1987. The study group is comprised of 14 individuals who had absorbed doses varying from 1 to 7 Gy. In order to obtain metaphase spreads,peripheral blood collected from exposed individuals 1-1,5 year after ionizing radiation exposure, was cultured following basic protocols for PHA-Lymphocyte stimulation. Individual slides were kept for 12 years at room temperature and in the dark. A control group of unexposed individuals was chosen from the Goiania population. Both groups donated blood voluntarily and the unexposed population had no history of exposure to genotoxic agents. The ordinary methodology, consisting of staining chromosomes with Giemsa 4%, was used to determine the biological half-life of unstable chromosomes aberrations. Using Buckston's model (1967) we predicted the half-life of T-cells carrying unstable chromosome aberrations to be between 204-312 days, which is in agreement with the results of Ramalho (1993) who reported a half-life of 140 days a similar for population. Additionally, we used fluorescence in situ hybridization (FISH) as the chosen method to evaluate 12-year old metaphase spreads. To date, we have no knowledge of the use of FISH methodology applied to samples as old as our. Prior to hybridization, chromosomes showed intense dehydration and signs of severe degradation. A pretreatment of aged slides in Carnoy's fixative for 16 hours, followed by exposing the slides to water vapour at 60 deg C for 4 hours improved the fluorescent signal of whole chromosomes probes, making it possible to evaluate old metaphase spreads. Our results suggest that is possible to validate FISH as a viable tool for retrospective biodosimetric studies, even in those cases when chromosome preparations were dehydrated and showed signs of chromosome degradation. (author)

  19. Adaptation and security validation of an irradiator suitable for use of cesium-137 sources

    Directory of Open Access Journals (Sweden)

    Silva Rogério M.V.

    2014-03-01

    Full Text Available With the aim of offering a new application for 137Cs sources that were previously used in brachytherapy, we developed an irradiator for TL and OSL dosimeters by adapting a shielded storage container; this irradiator was named SOPHIA. It was assembled from a cubic iron casing, filled with lead, with external dimensions of 25 × 25 × 25 cm3. It has three different drawers with two sample holders suitable for samples or dosimeters with dimensions of up to 2 cm. Dose distribution of the surface of sample holder was obtained with EBT-3 radiochromic film and detectors thermoluminescent CaSO4: Dy. Regarding the security conditions of irradiation, the whole routine procedure for placement and removal of samples was simulated using Monte Carlo code. The equipment presented proper security conditions and the doses received by users during procedures for placement and extraction of the samples are in accordance with international standards.

  20. Identification of environmentally derived cesium-137 burdens in a worker population

    Energy Technology Data Exchange (ETDEWEB)

    MacLellan, J.A.; Lynch, T.P.; Rieksts, G.A.; Brodzinski, R.L.

    1993-01-01

    During 1990, whole body measurements of a number of workers with little probability of onsite occupational exposure showed positive evidence of {sup 137}Cs. Further investigation revealed that many of these workers supplemented their diet with a significant portion of wild game, mainly deer and elk. To validate the assumption of an environmental source, donated samples of venison and other game were analyzed by gamma spectroscopy. Results ranged from less than 0.1 to almost 100 Bq kg{sup {minus}l} (0.003 to 2.7 nCi kg{sup {minus}1}) and showed a correlation with the habitat from which the game was taken. Venison samples obtained from the two workers with the highest body burdens showed the highest activity. A questionnaire is now used to identify workers with an elevated potential for environmental-intakes.

  1. Identification of environmentally derived cesium-137 burdens in a worker population

    Energy Technology Data Exchange (ETDEWEB)

    MacLellan, J.A.; Lynch, T.P.; Rieksts, G.A.; Brodzinski, R.L.

    1993-01-01

    During 1990, whole body measurements of a number of workers with little probability of onsite occupational exposure showed positive evidence of [sup 137]Cs. Further investigation revealed that many of these workers supplemented their diet with a significant portion of wild game, mainly deer and elk. To validate the assumption of an environmental source, donated samples of venison and other game were analyzed by gamma spectroscopy. Results ranged from less than 0.1 to almost 100 Bq kg[sup [minus]l] (0.003 to 2.7 nCi kg[sup [minus]1]) and showed a correlation with the habitat from which the game was taken. Venison samples obtained from the two workers with the highest body burdens showed the highest activity. A questionnaire is now used to identify workers with an elevated potential for environmental-intakes.

  2. Waste area Grouping 2 Phase I remedial investigation: Sediment and Cesium-137 transport modeling report

    Energy Technology Data Exchange (ETDEWEB)

    Clapp, R.B.; Bao, Y.S.; Moore, T.D.; Brenkert, A.L.; Purucker, S.T.; Reece, D.K.; Burgoa, B.B.

    1996-06-01

    This report is one of five reports issued in 1996 that provide follow-up information to the Phase I Remedial Investigation (RI) Report for Waste Area Grouping (WAG) 2 at Oak Ridge National Laboratory (ORNL). The five reports address areas of concern that may present immediate risk to public health at the Clinch River and ecological risk within WAG 2 at ORNL. A sixth report, on groundwater, in the series documenting WAG 2 RI Phase I results were part of project activities conducted in FY 1996. The five reports that complete activities conducted as part of Phase I of the Remedial Investigation (RI) for WAG 2 are as follows: (1) Waste Area Grouping 2, Phase I Task Data Report: Seep Data Assessment, (2) Waste Area Grouping 2, Phase I Task Data Report: Tributaries Data Assessment, (3) Waste Area Grouping 2, Phase I Task Data Report: Ecological Risk Assessment, (4) Waste Area Grouping 2, Phase I Task Data Report: Human Health Risk Assessment, (5) Waste Area Grouping 2, Phase I Task Data Report: Sediment and {sup 137}Cs Transport Modeling In December 1990, the Remedial Investigation Plan for Waste Area Grouping 2 at Oak Ridge National Laboratory was issued (ORNL 1990). The WAG 2 RI Plan was structured with a short-term component to be conducted while upgradient WAGs are investigated and remediated, and a long-term component that will complete the RI process for WAG 2 following remediation of upgradient WAGs. RI activities for the short-term component were initiated with the approval of the Environmental Protection Agency, Region IV (EPA), and the Tennessee Department of Environment and Conservation (TDEC). This report presents the results of an investigation of the risk associated with possible future releases of {sup 137}Cs due to an extreme flood. The results are based on field measurements made during storms and computer model simulations.

  3. The Natural Enrichment of Stable Cesium in Weathered Micaceous Materials and Its Implications for 137Cs Sorption.

    Energy Technology Data Exchange (ETDEWEB)

    Elliott, W. Crawford [Georgia State Univ., Atlanta, GA (United States); Kahn, Bernd [Georgia State Univ., Atlanta, GA (United States); Rosson, Robert [Georgia State Univ., Atlanta, GA (United States); Wampler, J. Marion [Georgia State Univ., Atlanta, GA (United States); Rose, Seth E. [Georgia State Univ., Atlanta, GA (United States); Krogstad, Eirik J. [Georgia State Univ., Atlanta, GA (United States); Kaplan, Daniel [Georgia State Univ., Atlanta, GA (United States)

    2011-11-14

    In this exploratory project, we are testing two interrelated hypotheses about the sorption of Cs within weathered micaceous materials in subsurface regolith materials from the Savannah River Site (SRS) located on the Atlantic Coastal Plain: 1) that stable cesium has become significantly enriched relative to potassium in subsurface micaceous particles as a result of chemical weathering processes; and 2) that the Cs so present is sufficient to be a major factor determining the ability of the subsurface materials to take up and hold 137Cs. To test these hypotheses, we collected by hand augur soil samples corresponding to soils representative at the SRS: upland regolith (Fuquay series); soils formed on Tobacco Road Sandstone; and, soils formed on Quaternary Alluvium. From our data, the quantification of the amounts of stable cesium concentrated in various sites within 2:1 phyllosilicates by natural processes is highly relevant toward understanding the future sorption of 137Cs by the mica, illite, vermiculite, and hydroxyl interstratified vermiculite (HIV) phases present in the subsurface at and in proximity to SRS. Studying sorption and fixation of Cs in these micaceous phases interlayers potentially leads to increased knowledge to the extent that stable Cs resists exchange with ion exchange cations (Mg, NH4, or even alkyl ammonium compounds) and to the extent that Cs can become fixed over the long term. Such knowledge will help in the development of 137Cs remediation strategies for the long-term, which is a critical aspect of the SBR goals. We characterized the mineralogy, K-Ar ages of the soil and soil clay fractions (before and after acid treatment), and alkali element chemistry (K, Rb, Cs) of the clay fractions of soils collected from these three different types of soils. The clay fractions of the Fuquay soils are composed of kaolinite, and hydroxy interstratified vermiculite (HIV). Kaolinite, HIV, quartz, gibbsite and illite are

  4. The Natural Enrichment of Stable Cesium in Weathered Micaceous Materials and Its Implications for 137Cs Sorption.

    Energy Technology Data Exchange (ETDEWEB)

    ELLIOTT, W CRAWFORD; KAHN, BERND; ROSSON, ROBERT; WAMPLER, J MARION; ROSE, SETH E; KROGSTAD, EIRIK J; KAPLAN, DANIEL; ZAUNBRECHER, LAURA

    2011-11-14

    In this exploratory project, we are testing two interrelated hypotheses about the sorption of Cs within weathered micaceous materials in subsurface regolith materials from the Savannah River Site (SRS) located on the Atlantic Coastal Plain: 1) that stable cesium has become significantly enriched relative to potassium in subsurface micaceous particles as a result of chemical weathering processes; and 2) that the Cs so present is sufficient to be a major factor determining the ability of the subsurface materials to take up and hold 137Cs. To test these hypotheses, we collected by hand augur soil samples corresponding to soils representative at the SRS: upland regolith (Fuquay series); soils formed on Tobacco Road Sandstone; and, soils formed on Quaternary Alluvium. From our data, the quantification of the amounts of stable cesium concentrated in various sites within 2:1 phyllosilicates by natural processes is highly relevant toward understanding the future sorption of 137Cs by the mica, illite, vermiculite, and hydroxyl interstratified vermiculite (HIV) phases present in the subsurface at and in proximity to SRS. Studying sorption and fixation of Cs in these micaceous phases interlayers potentially leads to increased knowledge to the extent that stable Cs resists exchange with ion exchange cations (Mg, NH4, or even alkyl ammonium compounds) and to the extent that Cs can become fixed over the long term. Such knowledge will help in the development of 137Cs remediation strategies for the long-term, which is a critical aspect of the SBR goals. We characterized the mineralogy, K-Ar ages of the soil and soil clay fractions (before and after acid treatment), and alkali element chemistry (K, Rb, Cs) of the clay fractions of soils collected from these three different types of soils. The clay fractions of the Fuquay soils are composed of kaolinite, and hydroxy interstratified vermiculite (HIV). Kaolinite, HIV, quartz, gibbsite and illite are found in the quaternary soils

  5. Non cancerous diseases following a chronic intern contamination by caesium 137: cataracts and cardiac arrhythmias; Pathologies non cancereuses potentiellement consecutives a une contamination interne chronique par le cesium 137: cataractes et arythmies cardiaques

    Energy Technology Data Exchange (ETDEWEB)

    Landon, G

    2008-07-15

    This work of thesis joins within the framework of an analysis of the sanitary consequences of the nuclear accident of Chernobylsk. Since 2005, the I.R.S.N. is interested in the not cancerous pathologies (cataracts, and cardiac arrhythmias) observed among the children living on the contaminated territories after the fallout of Chernobylsk and has in this aim implemented a research programme called E.P.I.C.E. (Evaluation of the pathologies induced by a chronicle contamination by cesium) whom objective is to show an eventual link between the chronicle ingestion of contaminated food and these pathologies emergence. An exploitation of the results of the pilot study,first phase of the E.P.I.C.E. program was realized. The analysis was completed by two bibliographical reviews relative to the knowledge available on these diseases. The results of this pilot study suggest: on one hand, an absence of link between the activity in cesium 137 at the level of the heart, of the whole body and the emergence of disorder of the heart rhythm; on the other hand, for the cases of cataract, a link between the load in cesium 137 at the neck level and the emergence of the disease in 40 % of the cases. However, these results must be considered with caution because several limits and, in particular, a way of selection affect this study. concerning the scientific literature, this one stays rather poor because only thee articles make reference to a relationship between cesium 137 and the emergence of these non cancerous pathologies. After having exposed the context, this thesis draws up the situation of knowledge relative to cataracts and to cardiac arrhythmias and their possible relationship with ionizing radiations, collect the results stemming from the analysis of the pilot study and envisages future epidemiological studies. (N.C.)

  6. Estimation of Radiation Doses in the Marshall Islands Based on Whole Body Counting of Cesium-137 (137Cs) and Plutonium Urinalysis

    Energy Technology Data Exchange (ETDEWEB)

    Daniels, J; Hickman, D; Kehl, S; Hamilton, T

    2007-06-11

    Under the auspices of the U.S. Department of Energy (USDOE), researchers from the Lawrence Livermore National Laboratory (LLNL) have recently implemented a series of initiatives to address long-term radiological surveillance needs at former nuclear test sites in the Republic of the Marshall Islands (RMI). The aim of this radiological surveillance monitoring program (RSMP) is to provide timely radiation protection for individuals in the Marshall Islands with respect to two of the most important internally deposited fallout radionuclides-cesium-137 ({sup 137}Cs) and long-lived isotopes 239 and 240 of plutonium ({sup 239+240}Pu) (Robison et al., 1997 and references therein). Therefore, whole-body counting for {sup 137}Cs and a sensitive bioassay for the presence of {sup 239+240}Pu excreted in urine were adopted as the two most applicable in vivo analytical methods to assess radiation doses for individuals in the RMI from internally deposited fallout radionuclides (see Hamilton et al., 2006a-c; Bell et al., 2002). Through 2005, the USDOE has established three permanent whole-body counting facilities in the Marshall Islands: the Enewetak Radiological Laboratory on Enewetak Atoll, the Utrok Whole-Body Counting Facility on Majuro Atoll, and the Rongelap Whole-Body Counting Facility on Rongelap Atoll. These whole-body counting facilities are operated and maintained by trained Marshallese technicians. Scientists from LLNL provide the technical support and training necessary for maintaining quality assurance for data acquisition and dose reporting. This technical basis document summarizes the methodologies used to calculate the annual total effective dose equivalent (TEDE; or dose for the calendar year of measurement) based on whole-body counting of internally deposited {sup 137}Cs and the measurement of {sup 239+240}Pu excreted in urine. Whole-body counting provides a direct measure of the total amount (or burden) of {sup 137}Cs present in the human body at the time of

  7. Estimation of Radiation Doses in the Marshall Islands Based on Whole Body Counting of Cesium-137 (137Cs) and Plutonium Urinalysis

    Energy Technology Data Exchange (ETDEWEB)

    Daniels, J; Hickman, D; Kehl, S; Hamilton, T

    2007-06-11

    Under the auspices of the U.S. Department of Energy (USDOE), researchers from the Lawrence Livermore National Laboratory (LLNL) have recently implemented a series of initiatives to address long-term radiological surveillance needs at former nuclear test sites in the Republic of the Marshall Islands (RMI). The aim of this radiological surveillance monitoring program (RSMP) is to provide timely radiation protection for individuals in the Marshall Islands with respect to two of the most important internally deposited fallout radionuclides-cesium-137 ({sup 137}Cs) and long-lived isotopes 239 and 240 of plutonium ({sup 239+240}Pu) (Robison et al., 1997 and references therein). Therefore, whole-body counting for {sup 137}Cs and a sensitive bioassay for the presence of {sup 239+240}Pu excreted in urine were adopted as the two most applicable in vivo analytical methods to assess radiation doses for individuals in the RMI from internally deposited fallout radionuclides (see Hamilton et al., 2006a-c; Bell et al., 2002). Through 2005, the USDOE has established three permanent whole-body counting facilities in the Marshall Islands: the Enewetak Radiological Laboratory on Enewetak Atoll, the Utrok Whole-Body Counting Facility on Majuro Atoll, and the Rongelap Whole-Body Counting Facility on Rongelap Atoll. These whole-body counting facilities are operated and maintained by trained Marshallese technicians. Scientists from LLNL provide the technical support and training necessary for maintaining quality assurance for data acquisition and dose reporting. This technical basis document summarizes the methodologies used to calculate the annual total effective dose equivalent (TEDE; or dose for the calendar year of measurement) based on whole-body counting of internally deposited {sup 137}Cs and the measurement of {sup 239+240}Pu excreted in urine. Whole-body counting provides a direct measure of the total amount (or burden) of {sup 137}Cs present in the human body at the time of

  8. Cesium 137 and cesium 134 in roe deer from the north and central Hessen area: Measurement of the contamination in muscle tissue after the Chernobyl accident. Caesium 137 und Caesium 134 in Rehwild aus Nord- und Mittelhessen: Untersuchungen zur Kontamination von Muskelgewebe nach dem Reaktorunfall in Tschernobyl

    Energy Technology Data Exchange (ETDEWEB)

    Georgii, S.; Brunn, H.; Eskens, U. (Staatliches Medizinal-, Lebensmittel- und Veterinaeruntersuchungsamt Mittelhessen, Giessen (Germany, F.R.))

    1989-06-01

    The present report describes the amount of incorporated 134 and 137 cesium in the muscle tissue of 330 roe deer, which were referred for routine necropsy between 1986 and 1988. The amount of incorporated radiocesium was markedly decreased in 1987 and 1988 compared with 1986. However, a seasonal fluctuation with increase of the measured incorporated radioactivity during the autumn months was observed in 1987 and 1988. (orig.).

  9. Standard test method for determining the content of cesium-137 in irradiated nuclear fuels by high-resolution gamma-ray spectral analysis

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers the determination of the number of atoms of 137Cs in aqueous solutions of irradiated uranium and plutonium nuclear fuel. When combined with a method for determining the initial number of fissile atoms in the fuel, the results of this analysis allows atom percent fission (burn-up) to be calculated (1). The determination of atom percent fission, uranium and plutonium concentrations, and isotopic abundances are covered in Test Methods E 267 and E 321. 1.2 137Cs is not suitable as a fission monitor for samples that may have lost cesium during reactor operation. For example, a large temperature gradient enhances 137Cs migration from the fuel region to cooler regions such as the radial fuel-clad gap, or, to a lesser extent, towards the axial fuel end. 1.3 A nonuniform 137Cs distribution should alert the analyst to the potential loss of the fission product nuclide. The 137Cs distribution may be ascertained by an axial gamma-ray scan of the fuel element to be assayed. In a mixed-oxide fu...

  10. Cesium-137 Decorporation Model

    Science.gov (United States)

    2014-10-01

    thermochemical) 4.184 000 joule (J) cal (thermochemical)/cm2 4.184 000 x E-2 mega joule/m2 (MJ/m2) curie 3.7000 000 x E + 1 giga becquerel (GBq)* degree...for blood irradiation or for use in research. Irradiators using Cs sources are common in hospitals, blood banks , universities and other research

  11. Correlations between potassium, rubidium and cesium ({sup 133}Cs and {sup 137}Cs) in sporocarps of Suillus variegatus in a Swedish boreal forest

    Energy Technology Data Exchange (ETDEWEB)

    Vinichuk, M., E-mail: Mykhailo.Vinichuk@slu.s [Department of Soil and Environment, Swedish University of Agricultural Sciences, P.O. Box 7014, SE-750 07 Uppsala (Sweden); Department of Ecology, Zhytomyr State Technological University, 103 Cherniakhovsky Str., 10005 Zhytomyr (Ukraine); Rosen, K.; Johanson, K.J. [Department of Soil and Environment, Swedish University of Agricultural Sciences, P.O. Box 7014, SE-750 07 Uppsala (Sweden); Dahlberg, A. [Department of Forest Mycology and Pathology, Swedish University of Agricultural Sciences, P.O. Box 7026, 750 07 Uppsala (Sweden)

    2011-04-15

    An analysis of sporocarps of ectomycorrhizal fungi Suillus variegatus assessed whether cesium ({sup 133}Cs and {sup 137}Cs) uptake was correlated with potassium (K) or rubidium (Rb) uptake. The question was whether intraspecific correlations of Rb, K and {sup 133}Cs mass concentrations with {sup 137}Cs activity concentrations in sporocarps were higher within, rather than among, different fungal species, and if genotypic origin of sporocarps within a population affected uptake and correlation. Sporocarps (n = 51) from a Swedish forest population affected by the fallout after the Chernobyl accident were studied. The concentrations were 31.9 {+-} 6.79 g kg{sup -1} for K (mean {+-} SD, dwt), 0.40 {+-} 0.09 g kg{sup -1} for Rb, 8.7 {+-} 4.36 mg kg{sup -1} for {sup 133}Cs and 63.7 {+-} 24.2 kBq kg{sup -1} for {sup 137}Cs. The mass concentrations of {sup 133}Cs correlated with {sup 137}Cs activity concentrations (r = 0.61). There was correlation between both {sup 133}Cs concentrations (r = 0.75) and {sup 137}Cs activity concentrations (r = 0.44) and Rb, but the {sup 137}Cs/{sup 133}Cs isotopic ratio negatively correlated with Rb concentration. Concentrations of K and Rb were weakly correlated (r = 0.51). The {sup 133}Cs mass concentrations, {sup 137}Cs activity concentrations and {sup 137}Cs/{sup 133}Cs isotopic ratios did not correlate with K concentrations. No differences between, within or, among genotypes in S. variegatus were found. This suggested the relationships between K, Rb, {sup 133}Cs and {sup 137}Cs in sporocarps of S. variegatus is similar to other fungal species. - Highlights: {yields} We studied uptake of Cs ({sup 133}Cs and {sup 137}Cs), K and Rb by Suillus variegates sporocarps. {yields} Genotypic origin of fungus did not affect uptake of studied elements (isotopes). {yields} Genotypic origin did not affect correlation between Cs ({sup 133}Cs and {sup 137}Cs), K and Rb.

  12. Caesium 137: Properties and biological effects resulting of an internal contamination;Cesium 137: proprietes et effets biologiques apres contamination interne

    Energy Technology Data Exchange (ETDEWEB)

    Lestaevel, P.; Racine, R.; Bensoussan, H.; Rouas, C.; Gueguen, Y.; Dublineau, I.; Bertho, J.M.; Gourmelon, P.; Jourdain, J.R.; Souidi, M. [Institut de Radioprotection et de Surete Nucleaire, IRSN, laboratoire de radiotoxicologie experimentale, direction de la radioprotection de l' homme, 92 - Fontenay-aux-Roses (France)

    2010-02-15

    Caesium-137 ({sup 137}Cs) is a radionuclide present in the environment mainly as the result of the atmospheric nuclear weapons testing and accidents arising in nuclear power plants like the Chernobyl accident in 1986. Nowadays, the health consequences resulting from a chronic exposure to this radionuclide remain unknown. After absorption, the caesium is distributed relatively homogeneously within the body, with a more important load in children than in adults. The toxicity of {sup 137}Cs is mainly due to its radiological properties. A high dose of {sup 137}Cs is responsible for a medullar dystrophy, disorders of the reproductive function, and effects on liver and renal functions. Disorders of bone mineralization and brain damages were also described in human beings. At lowest dose, {sup 137}Cs induces disturbances of wakefulness-sleep cycle, but not accompanied with behavioural disorders. The cardiovascular system was also perturbed. Biological effects of {sup 137}Cs on the metabolisms of the vitamin D, cholesterol and steroid hormones were described, but do not lead to clinical symptoms. In human beings, {sup 137}Cs leads to an immune deficiency, congenital and foetal deformations, an increased of thyroid cancer, as well as neurological disorders. It seems that children are more sensitive to the toxic effects of caesium than the adults. At present, the only effective treatment for the decorporation of the ingested {sup 137}Cs is the Prussian Blue (Radiogardase). The use of pectin to de-corporate the ingested {sup 137}Cs, in children notably, is sometimes proposed, but its administration still remains an open question. To conclude, the available scientific data suggest that {sup 137}Cs could affect a number of physiological and metabolic functions and consequently, could participate in the health risks associated to the presence of other contaminants in the environment. (authors)

  13. Cesium-137 global fallout into the Ob river basin and its influence on the Kara sea contamination - Weapons fallout cesium-137 in the Ob' catchment landscapes and its influence on radioactive contamination of the Kara sea: Western Siberia, Russia

    Energy Technology Data Exchange (ETDEWEB)

    Semenkov, Ivan N.; Miroshnikov, Alexey Yu. [The Organization of Russian Academy of Sciences Institute of geology of ore deposits, petrography, mineralogy and geochemistry Russian Academy of Sciences (Russian Federation)

    2014-07-01

    There are several high level {sup 137}Cs anomaly zones detected in the deposits of the SW part of the Kara Sea. These anomaly zones were formed in the Ob' and the Enisey river estuaries due to the geochemical 'river-sea' boarder barrier. Level of radiocaesium specific activity reaches 120 Bq*kg{sup -1} in the deposits from these zones. Radiochemical enterprises occur in the both river basins. Their activity results in caesium-137 transfer into the river net. Vast area is contaminated by {sup 137}Cs after nuclear weapons in Semipalatinsk test-site and Kyshtym disaster in the Ob' river basin. Moreover, caesium comes to the Ob' and the Enisey river basins with global atmospheric fallout. The inflow of global fallout caesium-137 to the catchments is 660 kCi (320 kCi including radioactive decay) that is 4 times higher than {sup 137}Cs emission due to Fukushima disaster. Therefore, these river basins as any other huge catchment are an important sources of radioactive contamination of the Arctic Ocean. The aim of our research is to study behavior of global fallout caesium-137 in the landscapes of the Ob and the Enisey river basins. We studied caesium-137 behavior on the example of first order catchments in taiga, wetland, forest-steppe, steppe, and semi-arid landscapes. Geographic information system (GIS) was made. The tenth-order catchments (n=154, Horton coding system) shape 20-groups due to topsoil properties controlling cesium mobility. Eleven first-order basins, characterized 7 groups of tenth order catchments, were studied. And 700 bulk-core soil samples were collected in 2011-2013. Cesium runoff is calculated for 3 first-order river basins in taiga and forest-steppe landscapes. Storage of global fallout caesium-137 declines from undisturbing taiga first-order river basin (90% of cumulative fallout including radioactive decay)> arable steppe and fores-steppe (70 - 75%)> undisturbing wetland (60%). Caesium-137 transfer is high in arable lands

  14. Exposure to low doses of (137)cesium and nicotine during postnatal development modifies anxiety levels, learning, and spatial memory performance in mice.

    Science.gov (United States)

    Bellés, Montserrat; Heredia, Luis; Serra, Noemí; Domingo, José L; Linares, Victoria

    2016-11-01

    Radiation therapy is a major cause of long-term complications observed in survivors of pediatric brain tumors. However, the effects of low-doses of ionizing radiation (IR) to the brain are less studied. On the other hand, tobacco is one of the most heavily abused drugs in the world. Tobacco is not only a health concern for adults. It has also shown to exert deleterious effects on fetuses, newborns, children and adolescents. Exposure to nicotine (Nic) from smoking may potentiate the toxic effects induced by IR on brain development. In this study, we evaluated in mice the cognitive effects of concomitant exposure to low doses of internal radiation ((137)Cs) and Nic during neonatal brain development. On postnatal day 10 (PND10), two groups of C57BL/6J mice were subcutaneously exposed to 137-Cesium ((137)Cs) (4000 and 8000 Bq/kg) and/or Nic (100 μg/ml). At the age of two months, neurobehavior of mice was assessed. Results showed that exposure to IR-alone or in combination with Nic-increased the anxiety-like of the animals without changing the activity levels. Moreover, exposure to IR impaired learning and spatial memory. However, Nic administration was able to reverse this effect, but only at the low dose of (137)Cs.

  15. The utilization of caesium 137 in studying soil degradation; L`utilisation du cesium 137 pour la connaissance de la degradation des sols

    Energy Technology Data Exchange (ETDEWEB)

    Wicherek, S.; Veyret, Y. [Centre de Biogeographie-Ecologie, 92 - Saint -Cloud (France); Bernard, C. [Ministere de l`Agriculture, des Pecheries et de l`Alimentation, Quebec (Canada)

    1994-12-31

    The caesium 137 isotope is distributed in the atmosphere during nuclear explosions, and is absorbed in the upper horizons of the soil on reaching the ground. When it is incorporated in the fine fraction of the soil, caesium 137 measurement allows movements affecting cultivated lands (mass movements, runoff effects, wind action) and rate of soil degradation over half a century to be evaluated. Vegetal cover and techniques of soil utilization must be considered; this method has been tested on a watershed in the Parisian Basin. 5 figs., 26 refs.

  16. Phytoremediation of 137cesium and 90strontium from solutions and low-level nuclear waste by Vetiveria zizanoides.

    Science.gov (United States)

    Singh, Shraddha; Eapen, Susan; Thorat, Vidya; Kaushik, C P; Raj, Kanwar; D'Souza, S F

    2008-02-01

    Vetiver grass (Vetiveria zizanoides) L. Nash plantlets when tested for their potential to remove (90)Sr and (137)Cs (5 x 10(3) k Bq l(-1)) from solutions spiked with individual radionuclide showed that 94% of (90)Sr and 61% of (137)Cs could be removed from solutions after 168 h. When both (90)Sr and (137)Cs were supplemented together to the solution, 91% of (90)Sr and 59% of (137)Cs were removed at the end of 168 h. In case of (137)Cs, accumulation occurred more in roots than shoots, while (90)Sr accumulated more in shoots than roots. When experiments were performed to study the effect of analogous elements, K(+) ions reduced the uptake of (137)Cs, while (90)Sr accumulation was found to decrease in the presence of Ca(2+) ions. Plants of V. zizanoides could also effectively remove radioactive elements from low-level nuclear waste and the level of radioactivity was reduced below detection limit at the end of 15 days of exposure. The results of the present study indicate that V. zizanoides may be a potential candidate plant for phytoremediation of (90)Sr and (137)Cs.

  17. Mechanistic interpretation of the varying selectivity of Cesium-137 and potassium uptake by radish (Raphanus sativus L.) under field conditions near Chernobyl.

    Science.gov (United States)

    Prorok, V V; Dacenko, O I; Bulavin, L A; Poperenko, L V; White, P J

    2016-02-01

    The selectivity of cation uptake by radish (Raphanus sativus L.) growing in the field near Chernobyl varies during the growth season. It is hypothesised that this is a consequence of variation in (137)Cs (Csss) and potassium (Kss) concentrations in the soil solution or the amount of dissolved potassium available to the plants. In the experiments reported here, it was observed that (1) Csss and Kss were positively correlated, (2) the selectivity for uptake of (137)Cs versus potassium (r) increased exponentially with decreasing Csss and Kss, and (3) the (137)Cs concentration, but not the potassium concentration, in plant material, increased abruptly upon the simultaneous reduction of Kss and Csss below about 10 μg ml(-1) and 6.7 Bq l(-1), respectively. It is thought that potassium enters root cells from the soil solution through constitutively-expressed, inward rectifying K(+) channels (KIRC) and K(+)/H(+)-symporters, whose abundance increases when plants become potassium-deficient. Cesium is thought to enter root cells through non-specific cation channels (NSCC) and, in plants lacking sufficient potassium, through K(+)/H(+)-symporters. It is argued that the increase in r, together with the abrupt increase (137)Cs concentration in plant tissues, when Kss and Csss decrease simultaneously cannot be attributed to competition between Cs(+) and K(+) for transport though KIRC, NSCC or K(+)/H(+)-symporters and that the most plausible explanation of these phenomena is an increase in the abundance of K(+)/H(+)-symporters in plants exhibiting incipient potassium deficiency.

  18. Literature study of the radiobiological parameters of Caesium-137 required for evaluating internal irradiation doses as a function of age; Etude bibliographique des parametres radiobiologiques du cesium-137 necessaires a l'evaluation des doses d'irradiation interne en fonction de l'age

    Energy Technology Data Exchange (ETDEWEB)

    Garnier, A. [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1968-07-01

    This document reassembles information published in scientific literature on radiobiological parameters of Cs-137, necessary for the estimate of the internal irradiation dose of man according to his age (during growth). The data are completed by a commented review of the mathematical models, proposed in order to value the irradiation doses from ingested cesium and the biological parameters. (author) [French] Ce document rassemble les informations publiees dans la litterature scientifique, concernant les parametres radiobiologiqueo du cesium-137, necessaires a l'evaluation des doses d'irradiation interne de l'homme en fonction de l'age. Ces donnees sont completees par une revue commentee des modeles mathematiques proposes en vue de l'evaluation des doses d'irradiation a partir des quantites de cesium ingerees et des parametres biologiques. (auteur)

  19. 76 FR 44378 - Policy Statement of the U.S. Nuclear Regulatory Commission on the Protection of Cesium-137...

    Science.gov (United States)

    2011-07-25

    ... of instrumentation and dosimetry, especially for critical reactor and first responder equipment. The... Commission encourages research to develop alternative chemical forms for large activity Cs-137 sources. Given... working with its domestic and international partners to assess, integrate, and improve its...

  20. Phenomenological and analytical interpretation of the rain-deposit relationship used for the reconstitution of the cesium 137 deposit in France consecutive to the accident of Chernobylsk; Interpretation phenomenologique et analytique de la relation pluie-depot utilisee pour la reconstitution des depots de {sup 137}Cs en France consecutifs a l'accident de Tchernobyl

    Energy Technology Data Exchange (ETDEWEB)

    Champion, D.; Renaud, Ph.; Metivier, J.M.; Garcia-Sanchez, L.; Pourcelot, L. [Institut de Radioprotection et de Surete Nucleaire, Dir. de l' environnement et de l' intervention 92 - Fontenay-aux-Roses (France)

    2005-11-15

    The works presented in this report allow to give two conclusions: the first one bears on the reconstitution of the cesium 137 deposits induced by the Chernobylsk accident; the second one bears on the methods improvement of post accident consequences evaluation induced by the radioactive atmosphere fallout. (N.C.)

  1. Seasonal concentrations of cesium-137 in rumen content, skeletal muscles and feces of caribou from the Porcupine herd: lichen ingestion rates and implications for human consumption

    Directory of Open Access Journals (Sweden)

    A. C. Allaye-Chan

    1990-09-01

    Full Text Available The Porcupine caribou herd was monitored for cesium-137 during 1987 to address human health concerns over potential meat contamination by radioactive fallout from the Chernobyl accident, and to determine lichen intake rates based on body burdens of radiocesium. A total of 36 caribou were collected from northwestern Alaska and the Yukon Territories in March, June, September, and November. Mean radiocesium concentrations in skeletal muscle peaked in March at 133 Bq/kg fresh weight. This value should not prove hazardous to human health. Radiocesium concentrations in skeletal muscle (wet weight ranged from approximately 22 to 50% of radiocesium concentrations in rumen contents (dry weight, and from approximately 15 to 37% of radiocesium concentrations in feces (dry weight. Radioactivity in feces was significantly correlated with radioactivity in rumen contents. Computer simulations relating lichen intake rates to radiocesium body burdens are presented for 3 scenarios: (1 when seasonal intakes were adjusted to provide the optimum fit between simulated and observed radiocesium body burdens (2 when seasonal intakes were based on empirical data, and (3 when seasonal intakes were adjusted to yield a "conventional" radiocesium curve of a slow fall build-up prior to a late winter plateau.

  2. 137Cesium-induced chromosome aberrations analyzed by fluorescence in situ hybridization: eight years follow up of the Goiânia radiation accident victims.

    Science.gov (United States)

    Natarajan, A T; Santos, S J; Darroudi, F; Hadjidikova, V; Vermeulen, S; Chatterjee, S; Berg, M; Grigorova, M; Sakamoto-Hojo, E T; Granath, F; Ramalho, A T; Curado, M P

    1998-05-25

    The radiation accident in focus here occurred in a section of Goiânia (Brazil) where more than a hundred individuals were contaminated with 137Cesium on September 1987. In order to estimate the absorbed radiation doses, initial frequencies of dicentrics and rings were determined in 129 victims [A.T. Ramalho, PhD Thesis, Subsidios a tecnica de dosimetria citogenetica gerados a partir da analise de resultados obtidos com o acidente radiologico de Goiânia, Universidade Federal do Rio de Janeiro, Rio de Janeiro, Brazil, 1992]. We have followed some of these victims cytogenetically over the years seeking for parameters that could be used as basis for retrospective radiation dosimetry. Our data on translocation frequencies obtained by fluorescence in situ hybridization (FISH) could be directly compared to the baseline frequencies of dicentrics available for those same victims. Our results provided valuable information on how precise these estimates are. The frequencies of translocations observed years after the radiation exposure were two to three times lower than the initial dicentrics frequencies, the differences being larger at higher doses (>1 Gy). The accuracy of such dose estimates might be increased by scoring sufficient amount of cells. However, factors such as the persistence of translocation carrying lymphocytes, translocation levels not proportional to chromosome size, and inter-individual variation reduce the precision of these estimates.

  3. The blue drama: narratives of the victim's suffering of Cesium-137 radiological event; O drama azul: narrativas sobre o sofrimento das vitimas do evento radiologico do Cesio-137

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar

    2014-07-01

    This research presents a dramatic approach to the Cesium-137 Radiological Event. The event, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The ethnography’s output follows a theoretical experiment with the notions of drama and event. In order to better understand the pattern of this event, I analyzed narratives such as romances, arts, photographs, news, documentaries, films, academic bibliography and stories that emerged from the research field. I argue that the narratives politicize the discourses of victimization and the suffering experience. The dramatic form of narratives and symbols concentrates on emotions and promotes the emotional commitment of the subjects on the trial. The drama articulates the relationship between the narratives and the event and creates a tactful space that arouses the recognition of victims through the narrative form and the suffering language. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. (author)

  4. Radiometric evaluation of graves of victims of the accident with Cesium 137 in Goiania, GO, Brazil: 25 years after; Avaliacao radiometrica das sepulturas das vitimas do acidente com o Cesio 137 em Goiania: 25 anos apos

    Energy Technology Data Exchange (ETDEWEB)

    Lage, Leonardo B.; Correa, Rosangela da S.; Santos, Eliane E. dos, E-mail: leonardobl@cnen.gov.br, E-mail: rcorrea@cnen.gov.br, E-mail: esantos@cnen.gov.br [Centro Regional de Ciencias Nucleares do Centro-Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil); Freitas-Junior, Ruffo, E-mail: uffojr@terra.com.br [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Faculdade de Medicina. Programa de Mastologia

    2013-07-01

    Twenty-five years after the radiation accident in Goiania, this study aims to evaluate the radiological situation in the area demarcated by the graves of the victims of the accident with cesium-137. Radiometric survey was carried out on the surface that encompasses the four graves and vicinity, from a pre-established mesh. Dose rate measurements were carried out, using the IdentFINDER equipment, positioned at 1 m height from the ground. The values of dose rates at the points measured ranged from 0.03 to 0.07 μSv/h. This variation of dose rate is less than those obtained in the local graveyard and are in the range of background radiation observed in Goiania. Considering the results obtained 25 years after the accident, it was concluded that engineering barriers adopted at that time are effective, stating the place absolutely safe from a radiological point of view, both for the individual from the public as to the environment.

  5. γ-H2AX Kinetic Profile in Mouse Lymphocytes Exposed to the Internal Emitters Cesium-137 and Strontium-90.

    Directory of Open Access Journals (Sweden)

    Helen C Turner

    Full Text Available In the event of a dirty bomb scenario or an industrial nuclear accident, a significant dose of volatile radionuclides such as 137Cs and 90Sr may be dispersed into the atmosphere as a component of fallout and inhaled or ingested by hundreds and thousands of people. To study the effects of prolonged exposure to ingested radionuclides, we have performed long-term (30 day internal-emitter mouse irradiations using soluble-injected 137CsCl and 90SrCl2 radioisotopes. The effect of ionizing radiation on the induction and repair of DNA double strand breaks (DSBs in peripheral mouse lymphocytes in vivo was determined using the γ-H2AX biodosimetry marker. Using a serial sacrifice experimental design, whole-body radiation absorbed doses for 137Cs (0 to 10 Gy and 90Sr (0 to 49 Gy were delivered over 30 days following exposure to each radionuclide. The committed absorbed doses of the two internal emitters as a function of time post exposure were calculated based on their retention parameters and their derived dose coefficients for each specific sacrifice time. In order to measure the kinetic profile for γ-H2AX, peripheral blood samples were drawn at 5 specific timed dose points over the 30-day study period and the total γ-H2AX nuclear fluorescence per lymphocyte was determined using image analysis software. A key finding was that a significant γ-H2AX signal was observed in vivo several weeks after a single radionuclide exposure. A mechanistically-motivated model was used to analyze the temporal kinetics of γ-H2AX fluorescence. Exposure to either radionuclide showed two peaks of γ-H2AX: one within the first week, which may represent the death of mature, differentiated lymphocytes, and the second at approximately three weeks, which may represent the production of new lymphocytes from damaged progenitor cells. The complexity of the observed responses to internal irradiation is likely caused by the interplay between continual production and repair of DNA

  6. The influence of a whole-lake addition of stable cesium on the remobilization of aged 137Cs in a contaminated reservoir.

    Science.gov (United States)

    Pinder, J E; Hinton, T G; Whicker, F W

    2005-01-01

    To document the short-term dynamics of Cs, 4 kg of (133)Cs were introduced into an 11.4-ha, 157 000 m(3) reservoir previously contaminated with (137)Cs from past reactor operations at the US Department of Energy's Savannah River Site near Aiken, South Carolina, USA. The (133)Cs addition resulted in an increase of 6.1 MBq of (137)Cs (1.9 mug (137)Cs) in the water column over the following 260 days. Possible sources for the increased (137)Cs included (1) release from the sediments, (2) release from the approximately 26 000 kg of aquatic macrophytes that occupied 80% of the reservoir, and (3) wash-in from the pond's watershed. Data are presented to indicate that release from the sediments was the principal source of the (137)Cs increase. The fraction of (137)Cs released from the sediments (0.7%) is consistent with laboratory measurements of (137)Cs desorption from neighboring ponds on the Savannah River Site.

  7. The influence of a whole-lake addition of stable cesium on the remobilization of aged {sup 137}Cs in a contaminated reservoir

    Energy Technology Data Exchange (ETDEWEB)

    Pinder, J.E. [Savannah River Ecology Laboratory, Drawer E, Aiken, SC 29801 (United States)]. E-mail: john.pinder@colostate.edu; Hinton, T.G. [Savannah River Ecology Laboratory, Drawer E, Aiken, SC 29801 (United States)]. E-mail: thinton@srel.edu; Whicker, F.W. [Department of Environmental and Radiological Health Sciences, 1618 Campus Delivery, Colorado State University, Fort Collins, CO 80523-1618 (United States)

    2005-07-01

    To document the short-term dynamics of Cs, 4 kg of {sup 133}Cs were introduced into an 11.4-ha, 157000 m{sup 3} reservoir previously contaminated with {sup 137}Cs from past reactor operations at the US Department of Energy's Savannah River Site near Aiken, South Carolina, USA. The {sup 133}Cs addition resulted in an increase of 6.1 MBq of {sup 137}Cs (1.9 {mu}g {sup 137}Cs) in the water column over the following 260 days. Possible sources for the increased {sup 137}Cs included (1) release from the sediments, (2) release from the approximately 26000 kg of aquatic macrophytes that occupied 80% of the reservoir, and (3) wash-in from the pond's watershed. Data are presented to indicate that release from the sediments was the principal source of the {sup 137}Cs increase. The fraction of {sup 137}Cs released from the sediments (0.7%) is consistent with laboratory measurements of {sup 137}Cs desorption from neighboring ponds on the Savannah River Site.

  8. Evolution of caesium 137 levels in coconut water and copra in french Polynesia, since 1967. Evolution de la teneur en cesium 137 depuis 1967 dans l'eau de coco et le coprah en Polynesie francaise

    Energy Technology Data Exchange (ETDEWEB)

    Kabis de Saint-Chamas, L.; Bablet, J.P.; Ducousso, R. (Service mixte de controle biologique, 91 - Montlhery (FR)); Arnould, C. (Laboratoire d' etude et de surveillance de l' environnement, Papeete (FR))

    1991-01-01

    Nuclear experiments have been carried out by France in french Polynesia since 1966. The tests were first atmospheric, they have been underground since 1975. The experiment monitoring programme includes monitoring of {sup 137}Cs contents in coconuts from the whole french polynesian territory. The methodology is described and the results of the 2 589 samples collected for 1967 to 1988 are presented. The maximum content found since 1967 is 52 Bq.kg{sup -1} for coconut water and 289 Bq.kg{sup -1} for coconut copra. The decrease of {sup 137}Cs content is constant without discontinuity, whatever the distance from the explosion sites. The committed dose equivalent from {sup 137}Cs delivered by coconut water and copra consumption represents only a few microsieverts a year.

  9. The history of Cesium-137 liquid emissions by Mühleberg Nuclear Power Plant (Switzerland) is recorded in Lake Biel sediments

    Science.gov (United States)

    Girardclos, Stéphanie; Faessler, Jérôme; Loizeau, Jean-Luc; Zehringer, Markus

    2014-05-01

    Lake sediments record changes happening in their upstream river catchment and regional environment which includes traces of artificial radionuclides emissions deriving from human activities. 137Cs emissions started worldwide in the early 1950's and peaked in 1963-64 due to nuclear bomb tests in the high atmosphere. A second 137Cs activity peak, due to the 1986 Chernobyl catastrophe is recorded in sediment archives from central Europe. These two events (1963/64 and 1986) serve routinely as time markers for recent lake records. Nuclear Power Plants (NPPs) are often constructed along river course for cooling purposes. Since 1972, Mühleberg NPP (central Switzerland) lies 18 km upstream Lake Biel and releases radioactive liquid emissions into the Aare river which adds to the diffuse - above mentioned - radioactive pollution, as revealed by Albrecht et al. (1995; 1998) and recently confirmed by Thevenon et al. (2013) from Lake Biel sediments. The water of Lake Biel is used as drinking water for ca. 60'000 inhabitants and its outflowing water is further used by downstream cities lying on the Aare-Rhine course such as Basel (200'000 inhab.) In this study, the 137Cs activity curve of a 90-cm-long sediment core (BIE10-8), retrieved in April 2010 from the central Lake Biel basin at ca. 50 m depth, and measured by gamma ray spectrometry using high resolution germanium detectors, confirms previous work and reveals a new peak for the year 1998-2000, as observed by Thevenon et al. (2013). This peak is most certainly due to Mühleberg NPP as shown by the good correlation with declared 137Cs liquid emissions indicating a significant increase in 1998-99. Decay corrected activity data, converted into 137Cs fluxes, point to water pollution by Mühleberg NPP in 1975-1985 as being similar to those linked to the catastrophic events in 1963-64 and 1986 (about 75%). As former study showed that Lake Biel sediments scavenge only a portion of the total radionuclide in water, i.e. 30-55% for

  10. Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi nuclear power plant accident

    Directory of Open Access Journals (Sweden)

    J. Kameník

    2013-03-01

    Full Text Available Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 1.5 yr after the Fukushima Dai-ichi nuclear power plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life only those parts of the Pacific Ocean would have detectable 134Cs that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2–1.5 Bq m−3 were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6–1.8 Bq m−3 were elevated above the 18-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 18-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m−3 (Station Aloha, 17 values. In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1–4 Bq m−3 and 137Cs levels were about 2–3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 1.5 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

  11. Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi Nuclear Power Plant accident

    Directory of Open Access Journals (Sweden)

    J. Kameník

    2013-09-01

    Full Text Available Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable 134Cs values that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2–1.5 Bq m–3 were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6–1.8 Bq m–3 were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m–3 (Station Aloha, 18 values. In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1–4 Bq m–3, and 137Cs levels were about 2–3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

  12. Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi Nuclear Power Plant accident

    Science.gov (United States)

    Kameník, J.; Dulaiova, H.; Buesseler, K. O.; Pike, S. M.; Št'astná, K.

    2013-09-01

    Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable 134Cs values that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2-1.5 Bq m-3) were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6-1.8 Bq m-3) were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m-3 (Station Aloha, 18 values). In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1-4 Bq m-3, and 137Cs levels were about 2-3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

  13. Experimental contamination of margaritana margaritifera (L) (a Fresh water bivalve) by caesium 137; Contamination experimentale de margaritana margaritifera (L) (bivalve d'eau douce) par le cesium 137

    Energy Technology Data Exchange (ETDEWEB)

    Foulquier, L.; Bovard, P.; Grauby, A. [Commissariat a l' Energie Atomique, Cadarache (France). Centre d' Etudes Nucleaires

    1966-07-01

    The hydro biological research carried out in the Radio-Ecology Section has led the authors to study some Margaritana sampling stations situated down-stream from the Monts d'Arree nuclear power station. They describe the preservation and contamination methods used for fixing the {sup 137}Cs concentration factors in the case of Margaritana Margaritifera (L). The results of experiments carried out over a period of one hundred days show that the specific activity of the various organs is stabilized after thirty to thirty-five days. The authors have noticed a relatively low adsorption on the shell through the intermediary of micro-organisms, and a strong and rapid absorption in the soft parts. The concentration factors have values, at equilibrium, of around: 9 for the shell, 300 for all the organs, and 38 for the whole animal. A comparison of these results with work published by other authors makes it possible to draw general conclusions concerning the mechanism of {sup 137}Cs fixation by lamellibranch, as well as their capacity of fixation. (author) [French] Les etudes hydrobiologiques effectuees au sein de la Section de Radio-Ecologie ont amene les auteurs a etudier des stations de prelevement de Margaritana en aval de la Centrale Nucleaire des Monts d'Arree. Ils decrivent les methodes de conservation et de contamination utilisees pour l'etablissement des facteurs de concentration du {sup 137}Cs par Margaritana margaritifera (L). Les resultats des experimentations menees pendant cent jours montrent que les activites specifiques de la coquille et des differents organes se stabilisent au bout de trente a trente-cinq jours. Les auteurs constatent une adsorption relativement faible sur la coquille par l'intermediaire des micro-organismes et une absorption forte et rapide dans les parties molles. Les facteurs de concentration se situent, a l'equilibre, autour de: 9 pour la coquille, 300 pour l'ensemble des organes et 38 si l'on considere

  14. Oak Ridge Reservation Volume 3. Records relating to RaLa, iodine-131, and cesium-137 at the Oak Ridge National Laboratory and the Oak Ridge Operations Office: A guide to record series of the Department of Energy and its contractors

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-21

    The purpose of this guide is to describe each of the documents and record series pertaining to the production, release, and disposal of radioactive barium-lanthanum (RaLa), iodine-131, and cesium-137 at the Department of Energy`s (DOE) Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. History Associates Incorporated (HAI) prepared this guide as part of DOE`s Epidemiologic Records Inventory Project, which seeks to verify and conduct inventories of epidemiologic and health-related records at various DOE and DOE contractor sites. This introduction briefly describes the Epidemiologic Records Inventory Project and HAI`s role. It provides information on the history of the DOE-Oak Ridge Reservation (ORR), particularly ORNL. Specific attention is given to the production of RaLa and the fission products iodine-131 and cesium-137. This introduction also describes the methodologies HAI used in the selection and inventorying of documents and record series pertaining to RaLa, iodine-131, and cesium-137, and in the production of this guide. Concluding paragraphs describe the arrangement of the record series, explain the information contained in the record series descriptions, and indicate restrictions on access to the records.

  15. Some thoughts on the compliance with intervention levels in an area contaminated by an accidental deposition of caesium 137; Reflexions sur le respect des niveaux d`intervention dans un territoire contamine par un depot accidentel de cesium 137

    Energy Technology Data Exchange (ETDEWEB)

    Maubert, H.; Robeau, D.; Renaud, P. [CEA Centre d`Etudes de Cadarache, 13 - Saint-Paul-lez-Durance (France); Linge, I.; Pavlovski, O.; Ossipiants, I. [Institut de Surete Nucleaire, Moscou (Russian Federation)

    1995-10-01

    After a nuclear accident leading to an important radionuclide deposition, the responsible authorities are faced to the question of complying with intervention levels. These regulations may be expressed as mass activities in foodstuffs, or individual doses for the populations. A situation of acute caesium 137 contamination of the environment was played in 1993 during a French and Russian joint crisis exercise. In answering the questions from the administration, the experts examined the conditions allowing agricultural practices (1) according to a set of intervention levels in foodstuffs, and (2) how that was compatible with a recommendation relative to an individual dose for the populations of 1 mSv/y, although this limit is applicable in normal conditions and is not intended for post-accidental situations. (authors). 9 refs., 2 figs., 3 tabs.

  16. Monitoring of caesium-137 in food plants and muscle from moose, red deer and wild reindeer in 2010.; Overvaaking av cesium-137 i beitevekster og kjoett av elg, hjort og villrein i 2010.

    Energy Technology Data Exchange (ETDEWEB)

    Veiberg, Vebjoern; Gaare, Eldar; Stokke, Sigbjoern; Solberg, Erling J.; Skuterud, Lavrans

    2011-07-01

    The monitoring of Cs-137 fall-out from the Chernobyl accident in 1986, started the same year. Several plants and wild reindeer in natural ecosystems in Nord-Rondane have been followed annually ever since. Four more wild reindeer ranges were included in 2001: Setesdal-Ryfylkeheiene, Hardangervidda, Nord-Ottadalen, Snoehetta and Nord-Rondane. From 2007 Forollhogna was also included. On fixed plots in Nord-Rondane and Snoehetta some of the reindeer forage plants, including both higher plants and fruticose lichens, have been sampled and analyzed annually since 1986. This was also done in 2010. In addition plants and lichens were sampled at five locations along an altitudinal gradient at Soendre Knutshoe, and at 7-8 locations along an east-west gradient from Kollaflata to Skarhoe in the Jora valley continuing along the Aursjoe to Torbudalen. All these locations were sampled annually between 1987-1990, but they have not been sampled since. In 2010 samples from red deer and moose was also collected from eight different regions located within the following counties: Oppland, Telemark, Vest-Agder, Rogaland, Sogn and Fjordane, Nord-Troendelag, Nordland and Troms. Red deer were sampled in four regions and moose in six. Both species were sampled in Oppland. In 2010 76, 49 and 61 samples were collected from wild reindeer, red deer and moose respectively. All measures of caesium levels were performed on dried samples. For the 596 samples of plants and lichen the results refer to caesium-levels in dried samples. For the meat samples, results refer to caesium-137 levels in raw meat. Due to large variation in measured levels of caesium within species and sampling area, we give median values instead of mean values.The highest caesium levels in wild reindeer were found in Snoehetta (1010 Bq/kg) and Nord-Rondane (2686 Bq/kg). The levels found in the other areas were considerably lower. The highest caesium levels in both red deer (Sel, 677 Bq/kg) and moose (Vaaga, 365 Bq/kg) were found

  17. Using remote-sensing technologies in combination with Cesium-137 measurements to estimate soil-erosion quantity in semi-arid steppe areas

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Soil erosion by wind is one of the most important processes in the changing the earth’s surface in semi-arid areas,Thus it is of great importance to study soil-erosion action.Using integrated technologies of remote sensing and geochemistry radioactivity iso-tope to extract regional soil-erosion information and to calculate quantity of soil erosion is accomplished successfully in this paper by means of beneficial experiments in the Talatan region of the Gonghe Basin,which is located in northeastern Qinghai-Tibet Pla-teau in China.The results show that the soil erosion by wind is not intensive in this region;the erosion types belong to the classes of very-soft erosion and soft-erosion type,which account for 47.12 percent and 35.58 percent,respectively,of the total study area.In total,two kinds of soil erosion account for 82.70 percent of the study area;only a small area belongs to the classes of severe erosion and very-severe erosion;this area is about 22.14 km2.Severe deposition activity has taken place in this region,and has appeared in a large area(322.67 km2),which accounts for 11.78 percent of the total study area.The results of this study show that soil erosion and deposition inventories are 870,000-1,150,000 tons and 550,000-780,000 tons,respectively,per year.The soil in-ventory shows about 320,000-370,000 tons from Talatan to Longyangxia reservoir per year.Using remote-sensing technology and 137Cs techniques is a valid means to analyze and to evaluate the quantity of soil erosion by wind in semi-arid environments.

  18. Using remote-sensing technologies in combination with Cesium-137 measurements to estimate soil-erosion quantity in semi-arid steppe areas

    Institute of Scientific and Technical Information of China (English)

    ZhanJiang Sha; HaiZhou Ma; LingQin Li; Jinzhou Du; FeiQuan Wu; QiShun Fan

    2009-01-01

    Soil erosion by wind is one of the most important processes in the changing the earth's surface in semi-arid areas, Thus it is of great importance to study soil-erosion action. Using integrated technologies of remote sensing and geochemistry radioactivity isotope to extract regional soil-erosion information and to calculate quantity of soil erosion is accomplished successfully in this paper by means of beneficial experiments in the Talatan region of the Gonghe Basin, which is located in northeastern Qinghai-Tibet Plateau in China. The results show that the soil erosion by wind is not intensive in this region; the erosion types belong to the classes of very-soft erosion and soft-erosion type, which account for 47.12 percent and 35.58 percent, respectively, of the total study area.In total, two kinds of soil erosion account for 82.70 percent of the study area; only a small area belongs to the classes of severe erosion and very-severe erosion; this area is about 22.14 km2. Severe deposition activity has taken place in this region, and has appeared in a large area (322.67 km2), which accounts for 11.78 percent of the total study area. The results of this study show that soil erosion and deposition inventories are 870,000-1,150,000 tons and 550,000-780,000 tons, respectively, per year. The soil inventory shows about 320,000-370,000 tons from Talatan to Longyangxia reservoir per year. Using remote-sensing technology and 137Cs techniques is a valid means to analyze and to evaluate the quantity of soil erosion by wind in semi-arid environments.

  19. Cesium diffusion in graphite

    Energy Technology Data Exchange (ETDEWEB)

    Evans, R.B. III; Davis, W. Jr.; Sutton, A.L. Jr.

    1980-05-01

    Experiments on diffusion of /sup 137/Cs in five types of graphite were performed. The document provides a completion of the report that was started and includes a presentation of all of the diffusion data, previously unpublished. Except for data on mass transfer of /sup 137/Cs in the Hawker-Siddeley graphite, analyses of experimental results were initiated but not completed. The mass transfer process of cesium in HS-1-1 graphite at 600 to 1000/sup 0/C in a helium atmosphere is essentially pure diffusion wherein values of (E/epsilon) and ..delta..E of the equation D/epsilon = (D/epsilon)/sub 0/ exp (-..delta..E/RT) are about 4 x 10/sup -2/ cm/sup 2//s and 30 kcal/mole, respectively.

  20. Study About Origin of Radioactive Cesium in Wild Mushroom in Japan

    OpenAIRE

    鎌田, 素之; 角田, 光淳

    2016-01-01

    Radioactive cesium, released from the Fukushima I nuclear power plant that destroyed by Great East Japan Earthquake, has been detected from various agricultural products. Especially, wild mushrooms are known to assimilate radioactive cesium and other heavy metals. In this study, we focused on the concentration of radioactive cesium in wild mushrooms in Japan, calculated the ratio of 134Cs/137Cs and discussed on their origin whether they were released from the Fukushima I nuclear power plant o...

  1. Study of the 137Cs Stabilizer Source

    Directory of Open Access Journals (Sweden)

    GAO Yan;WANG Yan-ling;XU Zhi-jian;XU Liang;REN Chun-xia;TAN Xiao-ming;CUI Hong-qi

    2014-02-01

    Full Text Available The attenuation laws of the Cesium -137 γ-ray penetrating the ceramic core、stainless steel and tungsten steel were studied. The radioactivity of the 137Cs stabilizer source was determined through the surface dose rate of 137Cs stabilizer sources. In addition, the adsorption properties of the ceramic core were studied to improve the stability of the output rate, and established a production line. The application results showed that the output rate of ray source was accurate and was of a good consistency. At present, the source had been used in logging lithology, and achieved the realization of domestic product.

  2. A selectivity study of the examination of radionuclides Cesium-1 37 for foods based on different detection conditions%食品中放射性核素137 Cs基于不同检测条件的方法选择研究

    Institute of Scientific and Technical Information of China (English)

    曹艺耀; 宣志强; 俞顺飞; 赵尧贤; 李新星

    2016-01-01

    Objective Aselectivitystudywasconductedthroughtheexaminationofradionuclides137Cs(Cesium-137)for foodbasedondifferentdetectionconditions.Methods Atotalof48foodsampleswereselectedfromthreeareasincluding Qinshan nuclear power plant,Sanmen nuclear power plant and Hangzhou and Zhoushan respectively.1 37 Cs of these samples were determined by γspectrometry and Phosphoric acid ammonium molybdate method.The level of 48 foods were statistically analyzed,and then the time consuming,sample size requirements,influence factors were comprehensively discussed,thustheselectionreferenceproposaloftheexaminationmethodcouldbeprovided.Results Therewereno significant difference for the data of two examination method (P>0.05 ).The limit of detection of the γspectrometry was lower (P <0.05 ).Compared with Phosphoric acid ammonium molybdate method,γspectrometry had lower limit of detection,and could detect a variety of radionuclides at a time,but need more sample and time-consuming when multi-sample were detected.The limit of detection of the Phosphoric acid ammonium molybdate method was high,and the chemicalprocessingstepswerecumbersomeandwaseasytobeinterferedby134Cs.Conclusion Thelimitofdetectionof the γspectrometry is low,and the sensitivity of the Phosphoric acid ammonium molybdate method is high.Most food are recommended to be detected by γspectrometry in the practical work,and the food which were difficult collected,less ash or low content,are recommended to be detected by Phosphoric acid ammonium molybdate method.%目的:探讨食品中放射性核素137Cs (Cesium-137)在不同条件下检测方法的选择。方法选取秦山核电站和三门核电站周边地区及对照区域(杭州和舟山)共48份食品样品,分别采用γ能谱法和磷酸钼铵法检测137 Cs,对两种方法的检测结果、探测限、检验周期、样品用量、灵敏度以及干扰因素等进行分析。结果两种方法检测样品137 Cs结果值的差值均数

  3. Adsorption of cesium on cement mortar from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Volchek, Konstantin, E-mail: konstantin.volchek@ec.gc.ca [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Kuang, Wenxing; DeMaleki, Zack [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, Canada K1N 6N5 (Canada)

    2011-10-30

    Highlights: {yields} The adsorption of cesium on cement mortar was investigated in a range of temperatures and cesium concentrations. {yields} The pseudo-second order kinetic model produced a good fit with the experimental kinetic data. {yields} Equilibrium test results correlated well with the Freundlich isotherm adsorption model. {yields} The interaction between cesium ions and cement mortar was dominated by chemical adsorption. - Abstract: The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L{sup -1} and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L{sup -1} while the respective surface concentration on coupons varied from 0.0395 to 22.34 {mu}g cm{sup -2}. Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol{sup -1} suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  4. Adsorption of cesium on cement mortar from aqueous solutions.

    Science.gov (United States)

    Volchek, Konstantin; Miah, Muhammed Yusuf; Kuang, Wenxing; DeMaleki, Zack; Tezel, F Handan

    2011-10-30

    The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L(-1) and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive (137)Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L(-1) while the respective surface concentration on coupons varied from 0.0395 to 22.34 μg cm(-2). Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol(-1) suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  5. Analysis, method and techniques for the studying of Cesium-137 transfer from soil to plants (maize and beans) (continuation of the technical report GSR-91-20); Analisis, metodo y tecnicas para estudio de transferencia de Cesio-137 de suelo a plantas (maiz y frijol) (continuacion del informe tecnico GSR-91-20)

    Energy Technology Data Exchange (ETDEWEB)

    Cervantes N, M.L

    1992-12-15

    In this report the complete results of transfer of corn and bean whose objective is to determine the transfer of Cs-137 via: soil {yields} root {yields} plant, which is determined by the transfer factors or concentration factors (FC), which indicates the incorporation from Cs-137 to soil and plant starting from two models of compartments which were already described in the technical report GSR-91-20-1 that precedes to this are presented. These results correspond to that carried out during the agricultural cycle of 1991, as well as the first results corresponding to 1992 in the radioactive wastes storage center (CADER) in Mexico. (Author)

  6. Concentration levels of cesium-137 in soils of the municipalities of Guadalupe and Zacatecas before the accident of Fukushima Daiichi; Niveles de concentracion de cesio-137 en suelos de los municipios de Guadalupe y Zacatecas antes del accidente de Fukushima Daiichi

    Energy Technology Data Exchange (ETDEWEB)

    Mireles, F.; Davila, J. I.; Pinedo, J. L.; Lopez, H.; Rios, C.; Saucedo, S. A.; Flores, F. E., E-mail: fmireles@uaz.edu.mx [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (MX)

    2011-11-15

    The study of the emitter radioisotopes of gamma-rays in soil is very important considering damages to the health and quality of the environment. The main objective of this work is the study of the concentration of the artificial radioisotope {sup 137}Cs in soil of the cities and municipalities of Zacatecas and Guadalupe of the Zacatecas State, Mexico. The study was carried out in two stages for different times, the first stage corresponded to the cities of Zacatecas and Guadalupe in 2000; and the second corresponded to the municipalities of Zacatecas and Guadalupe in 2008. The first study region was the cities of Zacatecas and Guadalupe, and environs where 20 soil samples were obtained. The second study region was inside the municipalities of Guadalupe and Zacatecas and 44 samples of near soil to the communities with major population in both municipalities were obtained. A spectrometry system of gamma-rays was used based on a coaxial detector of germanium hyper pure of high resolution, and was calculated the concentration of the {sup 137}Cs with the energy photo-pick 661.66 KeV. In this work the activity concentrations of the {sup 137}Cs in soil are presented and their variation in function of the time. These data will be a reference to evaluate a possible increment of the {sup 137}Cs because of the accident of Fukushima Daiichi (Japan) nuclear power plant happened March 11, 2011. (Author)

  7. Cesium chloride: preventive medicine for radioactive cesium exposure?

    Science.gov (United States)

    Braverman, E R; Sohler, A; Pfeiffer, C C

    1988-06-01

    Cesium is produced in high yield fission of uranium and plutonium. Radioactive cesium needles are a radiation hazard for radiotherapists. In this age of nuclear reactors, i.e. Chernobyl, radioactive cesium exposure may be a growing problem. Furthermore, there are numerous therapeutic potentials for cesium therapy, i.e. cancer, depression and schizophrenia. We explored the clearance of cesium in man and found that an oral dose of 50 mg maintains elevated blood cesium levels for 80 days. Cesium is accumulated mainly in the red blood cell fraction. Larger doses (6-9 grams) produce no observed harmful effects and maintain elevated blood levels of cesium for more than a year. Our data suggests there is a threshold of maximum cesium saturation in blood; if maintained, any additional cesium exposure, i.e. radioactive cesium, would be excreted at a more rapid rate. It is probable that large cesium doses can protect against radiation toxicity by blocking sites on red blood cells and thereby result in increased excretion and clearance of the radioactive forms of cesium. This hypothesis should be easily testable in laboratory animals.

  8. European inter-comparison of Monte Carlo codes users for the uncertainty calculation of the kerma in air beside a caesium-137 source; Intercomparaison europeenne d'utilisateurs de codes monte carlo pour le calcul d'incertitudes sur le kerma dans l'air aupres d'une source de cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    De Carlan, L.; Bordy, J.M.; Gouriou, J. [CEA Saclay, LIST, Laboratoire National Henri Becquerel, Laboratoire de Metrologie de la Dose 91 - Gif-sur-Yvette (France)

    2010-07-01

    Within the frame of the CONRAD European project (Coordination Network for Radiation Dosimetry), and more precisely within a work group paying attention to uncertainty assessment in computational dosimetry and aiming at comparing different approaches, the authors report the simulation of an irradiator containing a caesium 137 source to calculate the kerma in air as well as its uncertainty due to different parameters. They present the problem geometry, recall the studied issues (kerma uncertainty, influence of capsule source, influence of the collimator, influence of the air volume surrounding the source). They indicate the codes which have been used (MNCP, Fluka, Penelope, etc.) and discuss the obtained results for the first issue

  9. Comparative analysis of cesium and potassium uptake in onion Allium cepa L.

    Science.gov (United States)

    Urban, P. Ł.; Bystrzejewska-Piotrowska, G.

    2003-01-01

    Cesium uptake in onion (from 0.3 mM CsCl solution traced with 137CsCl) has been examined. The highest uptake occurred at pH 4-5 and it decreased with increasing pH. The intensity of Cs translocation depended on acidity of the solution. For acidic solutions, translocation of cesium into bulbs and leaves was greater than in case of alkaline solutions, where most of the cesium remained in the roots. Addition of potassium into the solutions (millimolar K concentrations) inhibits Cs uptake. The potassium pH-influx/efflux characteristic does not coincide with the Cs uptake.

  10. Application of Cesium isotopes in daily life; Aplicacoes dos isotopos do Cesio no cotidiano

    Energy Technology Data Exchange (ETDEWEB)

    Jordao, B.O.; Quaresma, D.S.; Carvalho, R.J., E-mail: bjordan@on.br, E-mail: dansq@on.br, E-mail: carvalho@on.br [Observatorio Nacional (ON/LPTF), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Tempo e Frequencia; Peixoto, J.G.P., E-mail: guilherm@ird.gov.br [Instituto de Radioprotecao e Dosimetria, (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. de Metrologia das Radiacoes Ionizantes

    2014-07-01

    In the world of science, the desire of the scientific community to discover new chemical elements is crucial for the development of new technologies in various fields of knowledge. And the main chemical element addressed by this article is Cesium, but specifically {sup 133}Cesium isotope and radioisotope {sup 137}Cesium, exemplifying their physical and chemical characteristics, and their applications. This article will also show how these isotopes have provided researchers a breakthrough in the field of radiological medicine and in time and frequency metrology. (author)

  11. Radioactive cesium. Dynamics and transport in forestal food-webs; Radioaktivt cesium. Dynamik och transport i skogliga naeringsvaevar

    Energy Technology Data Exchange (ETDEWEB)

    Palo, T.; Nelin, P. [Swedish Univ. of Agricultural Sciences, Umeaa (Sweden). Dept. of Animal Ecology; Bergman, R.; Nylen, T. [FOA NBC Defence, Umeaa (Sweden)

    1995-12-01

    This report summarises results from a radioecological study during 1994-1995 concerning turnover, redistribution and loss of radioactive Cesium (134 and 137) in boreal forest ecosystems, as well as uptake and transfer in important food-chains over moose, vole and vegetation. The basis for this report are 9 publications published 1994-95. These reports are presented in summary form. 9 refs, 17 figs.

  12. Protection Against Radiations from Radium, Cobalt-60, and Cesium-137

    Science.gov (United States)

    1954-09-01

    be large enough for easy threading. Thread ends subject to fraying should be pre- pared with beeswax or plastic. Screw threads should be carefully cut...separate washings should be performed. Highly alkaline soaps, abrasives, organic solvents , or cleaners that tend to increase permeability of the skin should

  13. Soil Organic Carbon Erosion Assessment by Cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Yueli; Lal, Rattan; Owens, Lloyd; Izaurralde, Roberto C.

    2001-12-31

    Soil organic carbon (SOC) is a major pool that impacts the global carbon cycle (Lal,1999). Increasing SOC pool is desirable because of its favorable effects on improving soil fertility, decreasing water and air pollution, and mitigating the greenhouse effect caused by various energy utilization activities such as fossil fuel combustion. The amount of SOC depends on kinetic competition between various input and output processes. The input processes include plant growth (plant residue, root excretion, and organic matter through-fall), addition of organic material (manure, sewage sludge, and other organic wastes) through soil management, and deposition through soil erosion. The output processes comprise decomposition into gases, leaching into groundwater, and removal through soil erosion. Assessment of these processes is one of the steps toward adopting the strategy of increasing SOC content.

  14. Export of radioactive cesium from agricultural fields under simulated rainfall in Fukushima.

    Science.gov (United States)

    Thai, Phong K; Suka, Yuma; Sakai, Masaru; Nanko, Kazuki; Yen, Jui-Hung; Watanabe, Hirozumi

    2015-06-01

    In this study, we investigated the impact of rainfall on runoff, soil erosion and consequently on the discharge of radioactive cesium in agricultural fields in Fukushima prefecture using a rainfall simulator. Simulated heavy rainfalls (50 mm h(-1)) generated significant runoff and soil erosion. The average concentration of radioactive cesium (the sum of (134)Cs and (137)Cs) in the runoff sediments was ∼3500 Bq kg(-1) dry soil, more than double the concentrations measured in the field soils which should be considered in studies using the (137)Cs loss to estimate long-term soil erosion. However, the estimated mass of cesium discharged through one runoff event was less than 2% of the cesium inventory in the field. This suggested that cesium discharge via soil erosion is not a significant factor in reducing the radioactivity of contaminated soils in Fukushima prefecture. However, the eroded sediment carrying radioactive cesium will deposit into the river systems and potentially pose a radioactivity risk for aquatic living organisms.

  15. Extraction of Cs-137 by alcohol-water solvents from plants containing cardiac glycosides

    CERN Document Server

    Dzyubak, S N; Dzyubak, O P; Sorokin, P V; Popov, V F; Orlov, A A; Krasnov, V P; Gubin, Yu.I.

    2001-01-01

    As a result of nuclear power plant accidents, large areas receive radioactive inputs of Cs-137. This cesium accumulates in herbs growing in such territories. The problem is whether the herbs contaminated by radiocesium may be used as a raw material for medicine. The answer depends on the amount of Cs-137 transfered from the contaminated raw material to the medicine. We have presented new results of the transfer of Cs-137 from contaminated Digitalis grandiflora Mill. and Convallaria majalis L. to medicine. We found that the extraction of Cs-137 depends strongly on the hydrophilicity of the solvent. For example 96.5%(vol.) ethyl alcohol extracts less Cs-137 (11.6%) than 40%(vol.) ethyl alcohol or pure water (66.2%). The solubility of the cardiac glycosides is inverse to the solubility of cesium, which may be of use in the technological processes for manufacturing ecologically pure herbal medicine.

  16. Preparation, structure and application of a new ecomaterials cesium ion-sieve

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A new ecomaterials cesium ion-sieve (Cs-IS), which has high selectivity to cesium and excellent acid resistance, is prepared with zirconyl molybdopyrophosphate as its matrix by specific chemical sieve-making means. Cs-IS has large exchange capacity ( 1.83mmol@g-1) and high distribution coefficient (4.09 x 104 mL@ L-1) in the medium of 3 mol@ L- 1 HNO3. In the static exchange with strongly acidic high-level radioactive liquid waste (HLLW) (3 mol@ L-1 HNO3), Cs-IS exhibits high exchange rate for cesium (above 96.53 % ) and large separation factor (greater than 958.41). These indicate the possible use of Cs-IS in cesium-137 selective removal and recovery from highly saline acidic HLLW system.

  17. Clinical effects of cesium intake.

    Science.gov (United States)

    Melnikov, Petr; Zanoni, Lourdes Zélia

    2010-06-01

    The knowledge about cesium metabolism and toxicity is sparse. Oral intake of cesium chloride has been widely promoted on the basis of the hypothesis referred to as "high pH cancer therapy", a complimentary alternative medicine method for cancer treatment. However, no properly confirmed tumor regression was reported so far in all probability because of neither theoretical nor experimental grounds for this proposal. The aim of the present review was to resume and discuss the material currently available on cesium salts and their applications in medicine. The presence of cesium in the cell does not guarantee high pH of its content, and there is no clinical evidence to support the claims that cancer cells are vulnerable to cesium. Cesium is relatively safe; signs of its mild toxicity are gastrointestinal distress, hypotension, syncope, numbness, or tingling of the lips. Nevertheless, total cesium intakes of 6 g/day have been found to produce severe hypokalemia, hypomagnesemia, prolonged QTc interval, episodes of polymorphic ventricular tachycardia, with or without torsade de pointes, and even acute heart arrest. However, full information on its acute and chronic toxicity is not sufficiently known. Health care providers should be aware of the cardiac complications, as a result of careless cesium usage as alternative medicine.

  18. Mineral resource of the month: cesium

    Science.gov (United States)

    Angulo, Marc A.

    2010-01-01

    The article offers information on cesium, a golden alkali metal derived from the Latin word caesium which means bluish gray. It mentions that cesium is the first element discovered with the use of spectroscopy. It adds that the leading producer and supplier of cesium is Canada and there are 50,000 kilograms of cesium consumed of the world in a year. Moreover, it states that only 85% of the cesium formate can be retrieved and recycled.

  19. Modelling turnover of Cs-137 in two subarctic salmonid ecosystems

    Energy Technology Data Exchange (ETDEWEB)

    Nordlinder, S.; Bergstroem, U. (Studsvik AB, Ecosafe, Nykoeping (Sweden)); Hammar, J. (Institute of Freshwater Research, Drottningholm (Sweden) Uppsala Univ. (Sweden). Dept. of Zoology); Notter, M. (Swedish Environmental Protection Agency, Solna (Sweden))

    1993-01-01

    The turnover of cesium-137 was simulated in two categories of subarctic, alpine lake ecosystems - a natural lake with Gammarus lacustris as major fish prey and a lake reservoir with introduced Mysis relicta as a new fish-food organism. The resulting concentrations of Cs-137 in two salmonid species - Arctic char (Salvelinus alpinus) and brown trout (Salmo trutta) - were calculated using a multi-compartment model. Observed data were taken from a major case study evaluating the distribution, pathways and major transport mechanisms of Chernobyl cesium through northern lake ecosystems in 1986-90. The aim of this study was to design a specific conceptual model for calculation of the levels of Cs-137 in fish from simple lake ecosystems, which could be adopted for other more complex types of lakes. A multi-compartment model of the ecosystem was designed and the equations were solved with the BIOPATH-code. The uncertainty of the results due to the uncertainty of input values was examined using the PRISM-system. The model gave good correlations to measured data for Cs-137 in water, zooplankton, macro invertebrates and fish in both lakes. The predicted levels in sediments were, however, considerably lower than the observed values. The inflow of Cs-137 from the drainage area to the two lakes was identified as the main contributor to the uncertainty of the long-term prognoses. 33 refs, 6 figs, 3 tabs.

  20. Cesium in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.

    1992-03-01

    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of [sup 137]Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of [sup 137]Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope [sup 137]Cs releases have resulted in a negligible risk to the environment and the population it supports.

  1. Cesium in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.

    1992-03-01

    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of {sup 137}Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of {sup 137}Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope {sup 137}Cs releases have resulted in a negligible risk to the environment and the population it supports.

  2. Concentration Ratios for Cesium and Strontium in Produce Near Los Alamos

    Energy Technology Data Exchange (ETDEWEB)

    S. Salazar, M.McNaughton, P.R. Fresquez

    2006-03-01

    The ratios of the concentrations of radionuclides in produce (fruits, vegetables, and grains) to the concentrations in the soil have been measured for cesium and strontium at locations near Los Alamos. The Soil, Foodstuffs, and Biota Team of the Meteorology and Air Quality Group of the Los Alamos National Laboratory (LANL) obtained the data at locations within a radius of 50 miles of LANL. The concentration ratios are in good agreement with previous measurements: 0.01 to 0.06 for cesium-137 and 0.1 to 0.5 for strontium-90 (wet-weight basis).

  3. Cesium chloride-induced torsades de pointes.

    Science.gov (United States)

    Wiens, Matthew; Gordon, Wendy; Baulcomb, Daisy; Mattman, Andre; Mock, Tom; Brown, Robert

    2009-09-01

    The chloride salt of cesium, a group 1A element, is gaining popularity as an alternative treatment of advanced cancers. Cesium chloride has primarily been used in cardiovascular research for arrhythmogenesis in animals because of its potassium-blocking effects. The present report describes a 45-year-old woman with metastatic breast cancer who experienced repeated episodes of torsades de pointes polymorphic ventricular tachycardia after several months of oral cesium therapy. There was a clear temporal relationship between cesium ingestion and the arrhythmia, which later resolved following discontinuation of cesium therapy. Serial cesium plasma and whole blood levels were measured over the ensuing six months and pharmacokinetic analysis was performed.

  4. Removal of cesium using coconut fiber in raw and modified forms for the treatment of radioactive liquid wastes

    Energy Technology Data Exchange (ETDEWEB)

    Jesus, Nella N.M. de; Nobre, Vanessa B.; Potiens Junior, Ademar J.; Sakata, Solange K., E-mail: sksakata@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Di Vitta, Patricia B. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Quimica

    2013-07-01

    Sorption is one of the most studied methods to reduce the volume of radioactive waste streams. Cesium-137 is a radioisotope formed by the fission of uranium and it can cause health problems due to its easy assimilation by cells. The aim of this study is to evaluate the potential of coconut fiber in removing cesium from radioactive liquid wastes; this process can help in disposing radioactive waste. The experiments were performed in batch and the particle size of the fiber ranged between 0.30 mm and 0.50 mm. The fiber was treated with hydrogen peroxide in alkaline medium. The following parameters were analyzed: contact time, pH and concentration of cesium ions in aqueous solution. After the experiments the samples were filtered and cesium remaining in solution was quantified by inductively coupled plasma optical emission spectrometry. (author)

  5. Transporting dynamics of radioactive cesium in a forest ecosystem and its discharge processes

    Energy Technology Data Exchange (ETDEWEB)

    Iseda, Kohei; Ohte, Nobuhito; Tanoi, Keitaro; Endo, Izuki; Oda, Tomoki; Kato, Hiroyu [Graduate School of Agricultural and Life Sciences, University of Tokyo (Japan)

    2014-07-01

    A lot of radioactive substance including {sup 137}Cs, {sup 134}Cs fell out to Tohoku and Kanto region in particular Fukushima prefecture after the accident of Fukushima-daiichi nuclear power plant. Generally, cesium tends to attach to clay particle and organic matter. These clay particle and organic matter can potentially flow out from the forest through the river to the downstream not only as particulate matter but also dissolved matter. It is likely that behavior of cesium is similar to sediment locomotion. The objective of this study is to understand transporting dynamics of radioactive cesium inside and outside of the forest. We started investigations on transporting dynamics of cesium in the forest upper stream of Kami-Oguni river in Date city Fukushima prefecture located in about 50 km from the nuclear power plant since July 2012. We conducted river water sampling at 9 points along the river from the uppermost stream to the middle reaches during low flow condition once a month. We also sampled river water during storm event for 5 times in order to capture the change of {sup 137}Cs concentration in a flood stage. Samples were filtered and separated into particulate and dissolved matters using glass micro-fiber filters (GF/F). Samples were analyzed their {sup 137}Cs concentration by Germanium semiconductor detector at University of Tokyo. During low flow condition, {sup 137}Cs was detected only a very small amount both in particulate and dissolved matters. In contrast, during high flow condition, {sup 137}Cs was detected about 10-100 times higher than that of during low flow condition in particulate matter. We estimated discharge flux of {sup 137}Cs from the forest using the relations between water discharge and {sup 137}Cs concentration. It was 0.977 Bq/(m2 day ) (2012/8/31-2013/4/19). In the forest, we set 2 deciduous tree plots (Quercus serrata, Zelkova serrata and so on) and 1 evergreen confer plot (Cyptomeria japonica). Atmospheric depositions of {sup 137

  6. Radiochemical determination of {sup 137}Cs in foods

    Energy Technology Data Exchange (ETDEWEB)

    Kastner, Geraldo F.; Ferreira, Andrea Vidal; Monteiro, Roberto P.G., E-mail: gfk@cdtn.br, E-mail: avf@cdtn.br, E-mail: rpgm@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    A determination of radionuclides in food samples is important in commodities in order to attend to regulatory requirements for international trade. As a long-lived radioisotope of cesium, {sup 137}Cs is produced as a result of human nuclear activities and than its contamination level evaluation among others radionuclides in foods is necessary. A methodology for the determination of {sup 137}Cs in foods, pork and fish, is described. The procedures covered homogenization and freeze-drying of the samples. The {sup 137}Cs was measured by gamma spectrometry using Canberra 50% HPGe detector. The counting was carried out with Monte Carlo software for detection conditions optimization including geometry and chemical data information. A certified sample, SRM IAEA-375, was analyzed in order to evaluate the reliability of the method, and the results showed good agreement between the measured and certified values. (author)

  7. Temporal variation of cesium isotope concentrations and atom ratios in zooplankton in the Pacific off the east coast of Japan

    Science.gov (United States)

    Ikenoue, Takahito; Takata, Hyoe; Kusakabe, Masashi; Kudo, Natsumi; Hasegawa, Kazuyuki; Ishimaru, Takashi

    2017-01-01

    After the Fukushima Daiichi Nuclear Power Plant accident in March 2011, concentrations of cesium isotopes (133Cs, 134Cs, and 137Cs) were measured in zooplankton collected in the Pacific off the east coast of Japan from May 2012 to February 2015. The time series of the data exhibited sporadic 137Cs concentration peaks in zooplankton. In addition, the atom ratio of 137Cs/133Cs in zooplankton was consistently high compared to that in ambient seawater throughout the sampling period. These phenomena cannot be explained fully by the bioaccumulation of 137Cs in zooplankton via ambient seawater intake, the inclusion of resuspended sediment in the plankton sample, or the taxonomic composition of the plankton. Autoradiography revealed highly radioactive particles within zooplankton samples, which could be the main factor underlying the sporadic appearance of high 137Cs concentrations in zooplankton as well as the higher ratio of 137Cs/133Cs in zooplankton than in seawater.

  8. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Man; Jang, Sung-Chan; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-10-15

    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe{sub 3}O{sub 4} nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired.

  9. Low Level Gamma Spectroscopy Measurements of Radium and Cesium in Lucerne (Medicago Sativa)

    Science.gov (United States)

    Fokapić, S.; Bikit, I.; Mrđa, D.; Vesković, M.; Slivka, J.; Mihaljev, Ž.; Ćupić, Ž.

    2007-04-01

    Nineteen years after Chernobyl nuclear accident, activity concentration of 137Cs still could be detected in food and soil samples in Central and Eastern Europe. In this paper radiation levels of radium and cesium in Lucerne will be presented. It is a perennial plant with a deep root system and it is widely grown throughout the world as forage for cattle. The samples of Lucerne were taken from twelve different locations in Vojvodina in the summer period July-September 2004. The samples were specially dried on the air and after that ground, powdered and mineralized by method of dry burning on the temperature of 450°C. Gamma spectrometry measurements of the ash were performed by means of actively shielded germanium detector with maximal background reduction. For cesium 137Cs 10 mBq/kg order of magnitude detection limits were achieved.

  10. New data for Cesium from soil in Cluj-Napoca town after Cernobyl accident

    Directory of Open Access Journals (Sweden)

    Dan C. Niţă

    2011-08-01

    Full Text Available Cesium 137 deposits are due to serious nuclear disaster (such as Chernobyl and nuclearweapons tests. Due to the wide range of uses in environmental studies is important to know thatradionuclide concentrations in environment. Soil samples were measured, in which 137 Cs activitiesvaries between 4.3 and 114.3 Bq / kg. The highest concentrations were found in the top layers of thesoil. From the soil depth profiles it can be observed the 137 Cs migration. Horizontal and verticalmigration depends mainly on water runoff and the concentration of radionuclides, hydrological regimeand the type of soil. It is important to know the amount of radionuclides in the soil because there arealready developed models which describe the radionuclides migration in different environments. One ofthe most studied radionuclide Cs-137 is due to its abundance and relatively long half-life. If theconcentration of the radionuclides exceeds a certain value, it might be a threat to human health.

  11. {sup 137}Cs in marine sediments of Admiralty Bay, King George Island, Antarctica

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Paulo Alves de Lima [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil); Ribeiro, Andreza Portella, E-mail: andrezpr@usp.br [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil); Mestrado de Gestão Ambiental e Sustentabilidade, Universidade Nove de Julho (UNINOVE), Avenida Francisco Matarazzo, 612, prédio C, andar térreo, Água Branca, São Paulo, SP, 05001 100 (Brazil); Nascimento, Mylene Giseli do; Martins, Cesar de Castro [Centro de Estudos do Mar, Universidade Federal do Paraná (CEM-UFPR), Av. Beira-mar, no number, Balneário Pontal do Sul, Pontal do Paraná, PR, 83255 971 (Brazil); Mahiques, Michel Michaelovitch de; Montone, Rosalinda Carmelo; Figueira, Rubens Cesar Lopes [Instituto Oceanográfico, Universidade de São Paulo (IO-USP), Pça. do Oceanográfico, 191, Butantã, SP, 05508 900 (Brazil)

    2013-01-15

    The radionuclide cesium-137 ({sup 137}Cs) is produced exclusively by anthropogenic processes and primarily by nuclear explosions. This study determined the reference inventory that is {sup 137}Cs associated with the element's original input, and utilized the levels of activity of this radionuclide previously measured in five sediment profiles collected from Admiralty Bay, Antarctica, to investigate the mobility of this element in the environment. {sup 137}Cs has a half-life of 30 years. Because of this, it is environmentally persistent and has been shown to accumulate in marine organisms. The mean reference inventory of this radionuclide in Admiralty Bay sediments, determined using high resolution gamma ray spectrometry, was 20.23 ± 8.94 Bq m{sup −2}, and within the ambient {sup 137}Cs activity range. A model of {sup 137}Cs diffusion–convection was applied to data collected from 1 cm intervals in sediment cores with the aim of providing insights with respect to this element's behavior in sediments. Model results showed a significant correlation between measured and modeled values using the concentrations of {sup 137}Cs, and estimated input into the system from the global fallout of past nuclear tests and expected values based on local sedimentation rates. Results highlight the importance of accounting for the vertical diffusion of {sup 137}Cs in marine sediments when used as a tracer for environmental processes and for assessing potential bioavailability. - Highlights: ► Cesium-137 ({sup 137}Cs) is produced exclusively by anthropogenic processes. ► A model of diffusion–convection simulated {sup 137}Cs environmental behavior. ► This is important for assessing the bioavailability of this toxic element. ► In Antarctica ice cover influenced the input to the sediments.

  12. Efficiency of aluminum-pillared montmorillonite on the removal of cesium and copper from aqueous solutions.

    Science.gov (United States)

    Karamanis, D; Assimakopoulos, P A

    2007-05-01

    Aluminum-pillared-layered montmorillonites (PILMs) were tested for their potential application in the removal of copper or cesium from aqueous solutions. By varying the initial conditions, several PILMs were prepared and characterized by means of X-ray fluorescence (XRF), proton induced gamma-ray emission (PIGE), X-ray diffraction (XRD) and sorption isotherms. Uptake of metals was studied by means of XRF spectrometry for copper sorption or gamma-ray spectrometry for cesium, using 137Cs as radiotracer. The sorption kinetics and capacity of PILMs were determined in relation to the effects of factors such as the initial metal concentration, initial pH of the solution and the presence of competitive cations. Kinetic studies showed that an equilibrium time of few minutes was needed for the adsorption of metal ions on PILMs. A pseudo-first-order equation was used to describe the sorption process for either copper or cesium. The most effective pH range for the removal of copper and cesium was found to be 4.0-6.0 and 3.0-8.0, respectively. Cesium sorption isotherms were best represented by a two-site Langmuir model while copper isotherms followed the Freundlich or the two-site Langmuir model. Cesium sorption experiments with inorganic or organic competitive cations as blocking agents revealed that the high selective sites of PILMs for cesium sorption (1-2% of total) are surface and edge sites in addition to interlayer exchange sites. In copper sorption, the two sites were determined as interlayer sites of PILMs after restoring their cation exchange capacity and sites associated with the pillar oxides.

  13. Bioaccumulation and removal of {sup 1}`3{sup 7} Cs by algae Gracilaria Greville and preparation of compartimental model; Bioacumulo e eliminacao de {sup 137} Cs pela alga Gracilaria Greville e elaboracao de modelo compartimental

    Energy Technology Data Exchange (ETDEWEB)

    Marchese, Sandra R.M. [Centro Tecnologico da Marinha, Sao Paulo, SP (Brazil); Cunha, Ieda I.L.; Mesquita, Carlos H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1997-12-01

    Cesium-137 may be accumulated by biota and transferred through marine chains so, it is important to quantify the accumulation and elimination of radioactivity at different trophic levels. A series of laboratory radiotracer experiments were performed to study the accumulation na delimination rates of cesium-137 in Gracilaria Greville seaweed. The concentration factor as wellas the biological half time for cesium were determined. A compartimental model (AnaComp Program) was employed to estimate transfer rates between compartiments. (author). 8 refs., 2 figs., 4 tabs.

  14. Cs-137 accumulation and elimination by Gracilaria caudata alga and Abudefduf saxatilis fish. Compartmental analysis; Acumulo e eliminacao de Cs-137 pela alga Gracilaria caudata e peixe Abudefduf saxatilis. Modelo compartimental

    Energy Technology Data Exchange (ETDEWEB)

    Mattiolo-Marchese, Sandra Regina

    1998-07-01

    From the ecological point of view, {sup 137}Cs is a critical radionuclide because its physical half-life is long (30 years), and it has a high fission yield. Besides, it presents similar characteristics to sodium and potassium, fundamental elements for the living organisms, in great concentration in all cells. This work has as aim to study the {sup 137}Cs accumulation and elimination by the alga Gracilaria caudata and by the fish Abudefduf saxatilis as well as to obtain the transfer constants of the{sup 137}Cs from the water into the organisms. The concentration factor found for the fish was 5.6 +- 0.2 and for the alga, 13.0 +- 0,6. With 7 and 22 days, the fish and alga respectively had already eliminated half of the accumulated radionuclide. The {sup 137}Cs ingestion efficiency by the fish was also studied and it was verified that the fish assimilated only 47.6 % of the cesium content in the food; and within of 4 days it had eliminated more than half of ingested cesium. A compartmental model was proposed to explain the distribution of cesium in the compartments (water - alga and water - fish). Data obtained from the experiments of {sup 137}Cs accumulation and elimination were applied in the Ana Comp Program. This program permits the compartmental analysis, and quantifies the cesium distribution from the sea-water to the organisms, and vice versa, through the transfer constants (k). The Ana Comp Program also allowed to calculate the dose that one would receive by the consumption of fish contaminated by cesium. Levels of {sup 137}Cs from the global fallout in environmental samples, from Sao Sebastiao, northern coast of Sao Paulo, (where the 'Centro de Biologia Marinha da Universidade de Sao Paulo - CEBIMar - USP' is located), were verified. (author)

  15. Cesium chloride-induced torsades de pointes

    OpenAIRE

    Wiens, Matthew; Gordon, Wendy; Baulcomb, Daisy; Mattman, Andre; Mock, Tom; Brown, Robert

    2009-01-01

    The chloride salt of cesium, a group 1A element, is gaining popularity as an alternative treatment of advanced cancers. Cesium chloride has primarily been used in cardiovascular research for arrhythmogenesis in animals because of its potassium-blocking effects. The present report describes a 45-year-old woman with metastatic breast cancer who experienced repeated episodes of torsades de pointes polymorphic ventricular tachycardia after several months of oral cesium therapy. There was a clear ...

  16. Spatial variability and the fate of cesium in coastal sediments near Fukushima, Japan

    Directory of Open Access Journals (Sweden)

    E. Black

    2014-05-01

    Full Text Available Quantifying the amount of cesium incorporated into marine sediments as a result of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP accident has proven challenging due to the limited multi-core sampling from within the 30 km zone around the facility, the inherent spatial heterogeneities in ocean sediments, and the potential for inventory fluctuations due to physical, biological, and chemical processes. Using 210Pb, 234Th, 137Cs, and 134Cs profiles from 20 sediment cores, coastal sediment inventories were reevaluated. A minimum 137Cs sediment inventory of 100 ± 50 TBq was found for an area of 55 000 km2 using cores from this study and a total of 130 ± 60 TBq using an additional 181 samples. These inventories represent less than 1% of the estimated 15–30 PBq of cesium released during the FDNPP disaster and constitute ~ 90% of the total coastal inventory of 137Cs remaining in 2012. The time needed for surface sediment activities (0 to 3 cm at the 20 locations to reduce by 50% via bioturbation was estimated to range from 0.4 to 26 years, indicating a much greater persistence of cesium in the sediments relative to coastal water activities. However, due to the observed variability in mixing rates, grain size, and inventories, additional cores are needed to further improve estimates and capture the full extent of cesium penetration into the shallow coastal sediments, which was deeper than 14 cm for all cores retrieved from water depths less than 150 m.

  17. Determination of low (137)Cs concentration in seawater using ammonium 12-molybdophosphate adsorption and chemical separation method.

    Science.gov (United States)

    Park, J H; Chang, B U; Kim, Y J; Seo, J S; Choi, S W; Yun, J Y

    2008-12-01

    A new method has been developed for analyzing (137)Cs in a small volume of seawater. Ammonium 12-molybdophosphate (AMP) was used two times during pretreatment procedure. The first step was to adsorb (137)Cs in seawater samples into AMP in order to reduce sample volume, and the second was to remove (87)Rb, interference nuclide for beta counting. The AMP adsorbing (137)Cs was dissolved by sodium hydroxide solution, and then (137)Cs was finally formed to be cesium chloroplatinate precipitate by adding 10% hexachloroplatinic acid. The beta rays emitted from (137)Cs were measured with a low background gas-proportional alpha/beta counter. This method was applied to several seawater samples taken in the East Sea of Korea. Compared to the routinely used gamma-spectrometry method, this new AMP method was reliable and suitable for analyzing (137)Cs in deep seawater.

  18. Small-Column Cesium Ion Exchange Elution Testing of Spherical Resorcinol-Formaldehyde

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Garrett N.; Russell, Renee L.; Peterson, Reid A.

    2011-10-21

    This report summarizes the work performed to evaluate multiple, cesium loading, and elution cycles for small columns containing SRF resin using a simple, high-level waste (HLW) simulant. Cesium ion exchange loading and elution curves were generated for a nominal 5 M Na, 2.4E-05 M Cs, 0.115 M Al loading solution traced with 134Cs followed by elution with variable HNO3 (0.02, 0.07, 0.15, 0.23, and 0.28 M) containing variable CsNO3 (5.0E-09, 5.0E-08, and 5.0E-07 M) and traced with 137Cs. The ion exchange system consisted of a pump, tubing, process solutions, and a single, small ({approx}15.7 mL) bed of SRF resin with a water-jacketed column for temperature-control. The columns were loaded with approximately 250 bed volumes (BVs) of feed solution at 45 C and at 1.5 to 12 BV per hour (0.15 to 1.2 cm/min). The columns were then eluted with 29+ BVs of HNO3 processed at 25 C and at 1.4 BV/h. The two independent tracers allowed analysis of the on-column cesium interaction between the loading and elution solutions. The objective of these tests was to improve the correlation between the spent resin cesium content and cesium leached out of the resin in subsequent loading cycles (cesium leakage) to help establish acid strength and purity requirements.

  19. Fabrication of stimuli-sensitive hydrogel for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Man; Bong, Sang Bum; Park, Chan Woo; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment.1 Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. 2 Various surface including road, roof, house, building were contaminated with Cs-137. These coating materials have some problems and limitation such as toxic component, and lack of reusability of materials related to the cost. Thus, a more cost-effective and environmental friendly coating materials is still desired. 3 In the present study, the stimuli-sensitive hydrogel were fabricated for the removal of radioactive Cs from solid surface. We describe the morphology, structure, and physical property of these stimuli sensitive hydrogel. In addition, their ability to eliminate cesium was also evaluated. The smart hydrogel coating materials showed an excellent morphology change from the liquid to film by addition of Ca ion. Therefore, the stimuli-sensitive hydrogel demonstrated good potential for the treatment of contaminated surface for the removal of radioactive cesium.

  20. Evaluation of Factors Affecting Cesium Extraction Performance by Calix[4]Arene Derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Rumppe, J.L.; Delmau, L.

    2004-01-01

    Novel aza-crown derivatives of dioctyloxy-calix[4]arene crown-6 were examined for their cesium extraction performance at different pH levels. These studies are of interest in addressing high-level waste tank remediation and the removal of 137Cs, a major contributor to heat and radiation generation. Preliminary studies were done to assess the performance of these calixarene compounds under varying conditions. Results showed an increase of cesium extraction with pH as well as expected trends in diluent effects and anion selectivity. Poor extraction performance of some aza-crown derivatives raised questions regarding the possibility of intramolecular hydrogen-bonding. A novel methylated derivative was used to address these questions. Additional experiments were conducted to determine the extraction effect on pH. Results indicate an increase in cesium extraction with pH, as shown in preliminary studies. Mono-aza derivatives were shown to exhibit better cesium extraction performance than their di-aza counterparts. The methylated derivative showed poorer extraction performance than the non-methylated derivative, indicating that completely removing the possibility of intramolecular hydrogen-bonding has negative effects on extraction performance. This suggests that the hydrogen-bonding facilitates anion co-extraction, which would lead to better overall extraction. Mono-aza derivatives were shown to cause unexpected changes in pH. This could possibly be attributed to protonation of the calix crown.

  1. In Situ Remediation of {sup 137}Cs Contaminated Wetlands Using Naturally Occurring Minerals

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, D.I.

    1999-08-11

    Cesium-137 has contaminated a large area of the wetlands on the Savannah River Site. Remediation of the contaminated wetlands is problematic because current techniques destroy the sensitive ecosystem and generate a higher dose to workers. To address this problem, we proposed a non-trusive, in situ technology to sequester 137Cs in sediments. One intention of this study was to provide information regarding a go/no go decision for future work. Since the proof-of-concept was successful and several minerals were identified as potential candidates for this technology, a go decision was made.

  2. Determination of (137)Cs half-life with an ionization chamber.

    Science.gov (United States)

    Juget, Frédéric; Nedjadi, Youcef; Buchillier, Thierry; Bochud, François; Bailat, Claude

    2016-12-01

    The half-life of (137)Cs was measured with an ionization chamber by following the decay of 5 sources over a 30 years period between 1983 and 2013. The ratio between the ionization chamber current for the cesium sources and (226)Ra source was used for the half-life calculation. The value found for the (137)Cs half-life is 10,955.2±10.7 days, where the uncertainty evaluation combines type A and B for one standard deviation.

  3. Radiocesium concentrations in two populations of naturally contaminated feral hogs (Sus scrofa domesticus). [/sup 137/Cs

    Energy Technology Data Exchange (ETDEWEB)

    Stribling, H.L.

    1978-12-01

    Two populations of feral hogs (Sus scrofa domesticus) were studied during the summer and winter seasons from 1976 to 1978 in order to determine concentrations, distributional patterns, and predictability of cesium-137 in the whole body and various body compartments of these animals. One population inhabited the Savannah River Plant (SRP) Aiken, South Carolina, an area contaminated by reactor waste and natural fallout; the other inhabited Ossabaw Island (OI), Georgia, an area contaminated by natural fallout alone. Whole-body burdens on the SRP averaged about 2 and about 1.5 times higher than those samples on OI during the summer and winter seasons, respectively. Radiocesium levels in feral hogs on SRP were not only influenced by the additional source of contamination but apparently fluctuated seasonally as well since the whole-body burdens of SRP hogs sampled were about 1.5 times higher in the summer than in the winter. Levels of cesium-137 in skeletal muscle have decreased in the SRP feral hog population since 1968. On the SRP, feces best predicted whole-body burdens with an r/sup 2/ of 0.67. All internal organs examined predicted levels in skeletal muscle well for SRP animals but best predictability of muscle (R/sup 2/ = 0.94) was achieved when brain, liver, and feces were combined in a multiple regression equation. Muscle was the best predictor of cesium-137 in all body compartments.

  4. Cesium adsorption/desorption behavior of clay minerals considering actual contamination conditions in Fukushima

    Science.gov (United States)

    Mukai, Hiroki; Hirose, Atsushi; Motai, Satoko; Kikuchi, Ryosuke; Tanoi, Keitaro; Nakanishi, Tomoko M.; Yaita, Tsuyoshi; Kogure, Toshihiro

    2016-02-01

    Cesium adsorption/desorption experiments for various clay minerals, considering actual contamination conditions in Fukushima, were conducted using the 137Cs radioisotope and an autoradiography using imaging plates (IPs). A 50 μl solution containing 0.185 ~ 1.85 Bq of 137Cs (10-11 ~ 10-9 molL-1 of 137Cs) was dropped onto a substrate where various mineral particles were arranged. It was found that partially-vermiculitized biotite, which is termed “weathered biotite” (WB) in this study, from Fukushima sorbed 137Cs far more than the other clay minerals (fresh biotite, illite, smectite, kaolinite, halloysite, allophane, imogolite) on the same substrate. When WB was absent on the substrate, the amount of 137Cs sorbed to the other clay minerals was considerably increased, implying that selective sorption to WB caused depletion of radiocesium in the solution and less sorption to the coexisting minerals. Cs-sorption to WB continued for about one day, whereas that to ferruginous smectite was completed within one hour. The sorbed 137Cs in WB was hardly leached with hydrochloric acid at pH 1, particularly in samples with a longer sorption time. The presence/absence of WB sorbing radiocesium is a key factor affecting the dynamics and fate of radiocesium in Fukushima.

  5. Cesium adsorption/desorption behavior of clay minerals considering actual contamination conditions in Fukushima.

    Science.gov (United States)

    Mukai, Hiroki; Hirose, Atsushi; Motai, Satoko; Kikuchi, Ryosuke; Tanoi, Keitaro; Nakanishi, Tomoko M; Yaita, Tsuyoshi; Kogure, Toshihiro

    2016-01-01

    Cesium adsorption/desorption experiments for various clay minerals, considering actual contamination conditions in Fukushima, were conducted using the (137)Cs radioisotope and an autoradiography using imaging plates (IPs). A 50 μl solution containing 0.185 ~ 1.85 Bq of (137)Cs (10(-11) ~ 10(-9 )molL(-1) of (137)Cs) was dropped onto a substrate where various mineral particles were arranged. It was found that partially-vermiculitized biotite, which is termed "weathered biotite" (WB) in this study, from Fukushima sorbed (137)Cs far more than the other clay minerals (fresh biotite, illite, smectite, kaolinite, halloysite, allophane, imogolite) on the same substrate. When WB was absent on the substrate, the amount of (137)Cs sorbed to the other clay minerals was considerably increased, implying that selective sorption to WB caused depletion of radiocesium in the solution and less sorption to the coexisting minerals. Cs-sorption to WB continued for about one day, whereas that to ferruginous smectite was completed within one hour. The sorbed (137)Cs in WB was hardly leached with hydrochloric acid at pH 1, particularly in samples with a longer sorption time. The presence/absence of WB sorbing radiocesium is a key factor affecting the dynamics and fate of radiocesium in Fukushima.

  6. Copper ferrocyanide functionalized magnetic nanoparticles using polyelectrolyte for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee Man; Lee, Kune Woo; Seo, Bum Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2013-10-15

    In the present study, magnetite nanoparticles were coated with copper ferrocyanide for the adsorption of radioactive Cs-137 in an aqueous solution through the grafting of polyethyleneimine. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate Cs-137 from water was also evaluated. Magnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. Since the nuclear accident at the Fukushima Daiichi nuclear power station in 2011, a huge amount of radioactive contaminants has been released into the environment. Among the various radioactive contaminants, cesium (Cs)-137 (137Cs) is the most apprehensive element owing to its long half-life (30.2 years), high solubility in water, and strong radiation emission in the form of gamma rays (γ-rays). Various methods such as ion exchange solvent extraction and precipitation are applied for the remediation of Cs-137 contaminated water. In particular, metal ferrocyanides show a high selectivity toward Cs-137. However, the very fine powder form of metal ferrocyanide causes a difficult separation from water through filtration.

  7. A study on the fission product release behavior during DUPIC pellet fabrication and the characteristics of cesium trapping

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jong Ho; Shin, Jin Myeong; Park, Geun Il; Nam, Seung Hee; Park, Jang Jin; Lee, Jung Won; Yang, Myung Seung [Korea Atomic Energy Reserach Institute, Daejon (Korea, Republic of)

    2001-11-15

    During the OREOX and sintering process in DUPIC fuel fabrication, fission products would be released from the spent fuel material. Radioactivity measurement using gamma spectrometry technique was performed to identify the radionuclide species released from the spent fuel material at high temperatures up to 1700 deg. C. It was revealed that Cs-137 is the main fission product released from the spent fuel material, and about 99% of Cs-137 is released during sintering process. Therefore, the trapping characteristics of inactive cesium using the fly ash filter in off-gas stream at high temperature was investigated in terms of reaction temperature, carrier gas and gas velocity. The amount of trapped cesium by the fly ash filter was increased with increasing reaction temperature, whereas it was decreased with increasing gas velocity.

  8. Accumulation of radioactive cesium released from Fukushima Daiichi Nuclear Power Plant in terrestrial cyanobacteria Nostoc commune.

    Science.gov (United States)

    Sasaki, Hideaki; Shirato, Susumu; Tahara, Tomoya; Sato, Kenji; Takenaka, Hiroyuki

    2013-01-01

    The Fukushima Daiichi Nuclear Power Plant accident released large amounts of radioactive substances into the environment and contaminated the soil of Tohoku and Kanto districts in Japan. Removal of radioactive material from the environment is an urgent problem, and soil purification using plants is being considered. In this study, we investigated the ability of 12 seed plant species and a cyanobacterium to accumulate radioactive material. The plants did not accumulate radioactive material at high levels, but high accumulation was observed in the terrestrial cyanobacterium Nostoc commune. In Nihonmatsu City, Fukushima Prefecture, N. commune accumulated 415,000 Bq/kg dry weight (134)Cs and 607,000 Bq kg(-1) dry weight (137)Cs. The concentration of cesium in N. commune tended to be high in areas where soil radioactivity was high. A cultivation experiment confirmed that N. commune absorbed radioactive cesium from polluted soil. These data demonstrated that radiological absorption using N. commune might be suitable for decontaminating polluted soil.

  9. Prussian blue as an antidote for radioactive thallium and cesium poisoning

    Directory of Open Access Journals (Sweden)

    Altagracia-Martinez M

    2012-06-01

    Full Text Available Marina Altagracia-Martínez, Jaime Kravzov-Jinich, Juan Manuel Martínez-Núñez, Camilo Ríos-Castañeda, Francisco López-NaranjoDepartments of Biological Systems and Health Care, Biological and Health Sciences Division, Universidad Autónoma Metropolitana-Xochimilco, Mexico DF, MexicoBackground: Following the attacks on the US on September 11, 2001, potentially millions of people might experience contamination from radioactive metals. However, before the specter of such accidents arose, Prussian blue was known only as an investigational agent for accidental thallium and cesium poisoning. The purpose of this review is to update the state of the art concerning use of Prussian blue as an effective and safe drug against possible bioterrorism attacks and to disseminate medical information in order to contribute to the production of Prussian blue as a biodefense drug.Methods: We compiled articles from a systematic review conducted from January 1, 1960 to March 30, 2011. The electronic databases consulted were Medline, PubMed, the Cochrane Library, and Scopus.Results: Prussian blue is effective and safe for use against radioactive intoxications involving cesium-137 and thallium. The US Food and Drug Administration has approved Prussian blue as a drug, but there is only one manufacturer providing Prussian blue to the US. Based on the evidence, Prussian blue is effective for use against radioactive intoxications involving cesium-137 and thallium, but additional clinical research on and production of Prussian blue are needed.Keywords: Prussian blue, radioactive cesium, thallium, intoxication, biodefense drug

  10. The effect of organic amendment on mobility of cesium in tropical soils - The effect of organic amendment on sorption mechanisms for cesium and cobalt in tropical soils

    Energy Technology Data Exchange (ETDEWEB)

    Wasserman, M.A.V.; Santos-Oliveira, R. [Instituto de Engenharia nuclear/CNEN. Rua Helio de Almeida, 75. Cidade Universitaria - Ilha do Fundao, Rio de Janeiro, RJ. CEP 21941-906 (Brazil); Garcia, R.J.L.; Ferreira, A.C.M.; Rochedo, E.R.R.; Sobrinho, G.A.N. [Instituto de Radioprotecao e Dosimetria/CNEN. Av. Salvador Allende s /no. Rio de Janeiro, RJ. CEP: 22780-160 (Brazil); Perez, D.V. [Centro Nacional de Pesquisa de Solos/EMBRAPA. R. Jardim Botanico, 1024.Rio de Janeiro, RJ, CEP: 22460-000 (Brazil); Wasserman, J.C. [dUFF Network of Environment and Sustainable Development (REMADS-UFF), University Federal Fluminense, Niteroi, RJ (Brazil)

    2014-07-01

    This work aimed to investigate the mechanisms involved in the sorption of {sup 137}Cs and {sup 60}Co as a function of the physico-chemical properties of some types of Brazilian soils and the changes on the behavior of these radionuclides due to changes in soil properties promoted by organic amendment. The experimental study was conducted in a controlled area, where pots containing different types of soils (Ferralsol, Nitisol and Histosol) and different doses of organic amendment (no amendment; 2 kg.m{sup -2} and 4 kg.m{sup -2}) were spiked with {sup 137}Cs and {sup 60}Co. The organic amendment used in this experiment was obtained in the Unit of Compost of the Organic Material of Pinheiral (RJ, Brazil), where the compost is made up from the leaves swept from the streets of the Pinheiral city. The mobility of these radionuclides in the soil was assessed through sequential chemical extraction and desorption studies as a function of pH. The bioavailability was evaluated through the effective absorption of radionuclide by root crops (Raphanus sativus, L). This study evidenced that the organic amendment plays an important role in the desorption processes of cobalt and cesium, reducing desorption of both nuclides beneath higher organic amendment dose. This behavior was observed in acid conditions as well in alkaline. However extreme acid conditions may mobilize both radionuclides, although cobalt mobility was shown to be more sensitive to low pH than cesium. (authors)

  11. Cesium and strontium ion specific exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Yates, S.

    1996-10-01

    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with AlliedSignal, Inc. (Des Plaines, Illinois) to develop inorganic ion exchangers that are selective for strontium and cesium from alkaline high-level waste and groundwater streams.

  12. Accumulation of uranium, cesium, and radium by microbial cells: bench-scale studies

    Energy Technology Data Exchange (ETDEWEB)

    Strandberg, G.W.; Shumate, S.E. II

    1982-07-01

    This report describes bench-scale studies on the utilization of microbial cells for the concentration and removal of uranium, radium, and cesium from nuclear processing waste streams. Included are studies aimed at elucidating the basic mechanism of uranium uptake, process development efforts for the use of a combined denitrification-uranium removal process to treat a specific nuclear processing waste stream, and a preliminary investigation of the applicability of microorganisms for the removal of /sup 137/Cs and /sup 226/Ra from existing waste solutions.

  13. Study on the Volatility of Cesium in Dry Ashing Pretreatment and Dissolution of Ash by Microwave Digestion System - 13331

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Kwang-Soon; Lee, Chang Heon; Ahn, Hong-Joo; Park, Yong Joon; Song, Kyuseok [Nuclear Chemistry Research Division, Korea Atomic Energy Research Institute, Daedeok-daero 989-111, Yuseong-gu, Daejeon, 305-353 (Korea, Republic of)

    2013-07-01

    Based on the regulation of the activity concentration of Cs-137, Co-58, Co-60, Fe-55, Ni-59, Ni-63, Sr-90, Nb-94, and Tc-99, and the total alpha from the radioactive waste acceptance criteria, the measurement of the activity concentration of these nuclides in low and intermediate levels of radioactive waste such as in paper, cotton, vinyl and plastic samples was investigated. A dry ashing method was applied to obtain a concentration effect of the samples. Owing to the temperature dependence of the volatility for cesium, the temperature of 300 to 650 deg. C was examined. It was found that 450 deg. C is the optimum dry ashing temperature. After dry ashing, the produced ash was dissolved with HNO{sub 3}, HCl, and HF by a high-performance microwave digestion system. The ash sample, for the most part, was completely dissolved with 10 mL of HNO{sub 3}, 4 mL of HCl, and 0.25 mL of HF by a high-performance microwave digestion system using a nova high temperature rotor at 250 deg. C for 90 min until reaching 0.2 g. To confirm the reliability of cesium loss after the performance of the dry ashing procedure, a cesium standard solution for AAS and a Cs-137 standard solution for gamma spectrometry were added to a paper towel or a planchet of stainless steel, respectively. Cesium was measured by AAS, ICP-MS, and gamma spectrometry. The volatility of cesium did not occur until 450 deg. C ashing. (authors)

  14. Understanding of amount and dynamics of radioactive cesium deposited on trees in Fukushima

    Energy Technology Data Exchange (ETDEWEB)

    Endo, Izuki; Ohte, Nobuhito; Iseda, Kohei; Tanoi, Keitaro; Hirose, Atsushi; Kobayashi, Natsuko I. [The University of Tokyo, 113-8657, 1-1-1 Yayoi Bunkyo-ku, Tokyo (Japan); Ishii, Nobuyoshi [National Institute of Radiological Sciences, 263-8555, 4-9-1 Anagawa, Inage-ku, Chiba-shi, Chiba (Japan); Ohashi, Mizue [University of Hyogo, 670-0092, 1-1-12 Shinzaike-Honcho, Himeji, Hyogo (Japan)

    2014-07-01

    The accident of Fukushima Daiichi nuclear power plant after the earthquake and Tsunami in March 11, 2011 caused large amount of radioactive cesium ({sup 134}Cs, {sup 137}Cs) deposition onto the forest in the surrounding areas. River water from the forest area is used for food production and also for drinking water in these regions. In order to predict how radioactive Cs diffuse and discharge from the forest catchments, it is important to understand the amount and dynamics of radioactive Cs deposited on the trees. In this report, we show our preliminary results of {sup 137}Cs deposition in forest. Study was conducted in the forest at the upstream of Kami-Oguni River catchment, northern part of Fukushima Prefecture. Three plots (2 deciduous stands and 1 Japanese cedar (Cryptomeria japonica) plantation) were set in the forest. Quercus serrata and C. japonica, a representative of deciduous and evergreen tree species in this region, were chosen from each plot. Sample trees were logged in October 2012. Stem samples were collected every 2 m from above the ground to tree top and separated into bark, sapwood and heartwood. Litter traps were set in each plot and collected every month. Leaf litter was classified among species. Also, soil samples were collected in the cylinder of 5 cm in diameter and maximum 30 cm in depth from the forest floor every month. {sup 137}Cs concentration of all samples were measured by germanium semiconductor detector or NaI(Tl) scintillation counter. Deposited {sup 137}Cs was attached strongly on the bark of Q. serrata at high concentration (9-18 kBq/kg) but there were no clear relationship with tree height. In C. japonica, {sup 137}Cs concentration was about half times lower than that of Q. serrata at 0-10 m part of the tree. {sup 137}Cs concentration in wood of C. japonica was higher than Q. serrata. {sup 137}Cs concentration of sapwood was as high as that of heartwood in C. japonica, but in Q. serrata, {sup 137}Cs concentration in sapwood was

  15. Preferential removal and immobilization of stable and radioactive cesium in contaminated fly ash with nanometallic Ca/CaO methanol suspension.

    Science.gov (United States)

    Mallampati, Srinivasa Reddy; Mitoma, Yoshiharu; Okuda, Tetsuji; Sakita, Shogo; Simion, Cristian

    2014-08-30

    In this work, the capability of nanometallic Ca/CaO methanol suspension in removing and/or immobilizing stable ((133)Cs) and radioactive cesium species ((134)Cs and (137)Cs) in contaminated fly ash was investigated. After a first methanol and second water washing yielded only 45% of (133)Cs removal. While, after a first methanol washing, the second solvent with nanometallic Ca/CaO methanol suspension yielded simultaneous enhanced removal and immobilization about 99% of (133)Cs. SEM-EDS analysis revealed that the mass percent of detectable (133)Cs on the fly ash surface recorded a 100% decrease. When real radioactive cesium contaminated fly ash (containing an initial 14,040Bqkg(-1)(134)Cs and (137)Cs cumulated concentration) obtained from burning wastes from Fukushima were reduced to 3583Bqkg(-1) after treatment with nanometallic Ca/CaO methanol suspension. Elution test conducted on the treated fly ash gave 100BqL(-1) total (134)Cs and (137)Cs concentrations in eluted solution. Furthermore, both ash content and eluted solution concentrations of (134)Cs and (137)Cs were much lower than the Japanese Ministry of the Environment regulatory limit of 8000Bqkg(-1) and 150BqL(-1) respectively. The results of this study suggest that the nanometallic Ca/CaO methanol suspension is a highly potential amendment for the remediation of radioactive cesium-contaminated fly ash.

  16. Cesium radioactivity in peripheral blood is linearly correlated to that in skeletal muscle: analyses of cattle within the evacuation zone of the Fukushima Daiichi Nuclear Power Plant.

    Science.gov (United States)

    Fukuda, Tomokazu; Kino, Yasushi; Abe, Yasuyuki; Yamashiro, Hideaki; Kobayashi, Jin; Shimizu, Yoshinaka; Takahashi, Atsushi; Suzuki, Toshihiko; Chiba, Mirei; Takahashi, Shintaro; Inoue, Kazuya; Kuwahara, Yoshikazu; Morimoto, Motoko; Shinoda, Hisashi; Hiji, Masahiro; Sekine, Tsutomu; Fukumoto, Manabu; Isogai, Emiko

    2015-01-01

    The accident at the Fukushima Daiichi Nuclear Power Plant (FNPP) released a large amount of radioactive substances into the environment. Furthermore, beef contaminated with radioactive cesium above the 500 Bq/kg safety standard was circulated in the food chain in 2011. Japanese consumers remain concerned about the safety of radioactively contaminated food. In our previous study, we detected a linear correlation between radioactive cesium ((137) Cs) activity in blood and muscle around 500 to 2500 Bq/kg in cattle. However, it was unclear whether the correlation was maintained at a lower radioactivity close to the current safety standard of 100 Bq/kg. In this study, we evaluated 17 cattle in the FNPP evacuation zone that had a (137) Cs blood level less than 10 Bq/kg. The results showed a linear correlation between blood (137) Cs and muscle (137) Cs (Y = 28.0X, R(2)  = 0.590) at low radioactivity concentration, indicating that cesium radioactivity in the muscle can be estimated from blood radioactivity. This technique would be useful in detecting high-risk cattle before they enter the market, and will contribute to food safety.

  17. Immobilization of Cesium Traps from the BN-350 Fast Reactor (Aktau, Kazakhstan)

    Energy Technology Data Exchange (ETDEWEB)

    J. A. Michelbacher; C. Knight; O. G. Romanenko; I. L. Tazhibaeva; I. L. Yakovlev; A. V. Rovneyko; V. I. Maev; D. Wells; A. Herrick

    2011-03-01

    During BN-350 reactor operations and also during the initial stages of decommissioning, cesium traps were used to decontaminate the reactor’s primary sodium coolant. Two different types of carbon-based trap were used – the MAVR series, low ash granulated graphite adsorber (LAG) contained in a carrier designed to be inserted into the reactor core during shutdown; and a series of ex-reactor trap accumulators(TAs) which used reticulated vitreous carbon (RVC) to reduce Cs-137 levels in the sodium after final reactor shutdown. In total four MAVRs and seven TAs were used at BN-350 to remove an estimated cumulative 755 TBq of cesium. The traps, which also contain residual sodium, need to be immobilized in an appropriate way to allow them to be consigned as waste packages for long term storage and, ultimately, disposal. The present paper reports on the current status of the implementation phase, with particular reference to the work done to date on the trap accumulators, which have the most similarity with the cesium traps used at other reactors.

  18. WESF cesium capsule behavior at high temperature or during thermal cycling

    Energy Technology Data Exchange (ETDEWEB)

    Tingey, G.L.; Gray, W.J.; Shippell, R.J.; Katayama, Y.B.

    1985-06-01

    Double-walled stainless steel (SS) capsules prepared for storage of radioactive /sup 137/Cs from defense waste are now being considered for use as sources for commercial irradiation. Cesium was recovered at B-plant from the high-level radioactive waste generated during processing of defense nuclear fuel. It was then purified, converted to the chloride form, and encapsulated at the Hanford Waste Encapsulation and Storage Facility (WESF). The molten cesium chloride salt was encapsulated by pouring it into the inner of two concentric SS cylinders. Each cylinder was fitted with a SS end cap that was welded in place by inert gas-tungsten arc welding. The capsule configuration and dimensions are shown in Figure 1. In a recent review of the safety of these capsules, Tingey, Wheelwright, and Lytle (1984) indicated that experimental studies were continuing to produce long-term corrosion data, to reaffirm capsule integrity during a 90-min fire where capsule temperatures reached 800/sup 0/C, to monitor mechanical properties as a function of time, and to assess the effects of thermal cycling due to periodic transfer of the capsules from a water storage pool to the air environment of an irradiator facility. This report covers results from tests that simulated the effects of the 90-min fire and from thermal cycling actual WESF cesium capsules for 3845 cycles over a period of six months. 11 refs., 39 figs., 9 tabs.

  19. Kinetic and equilibrium studies of cesium adsorption on ceiling tiles from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Volchek, Konstantin, E-mail: Konstantin.Volchek@ec.gc.ca [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Kuang, Wenxing [SAIC Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, K1N 6N5 (Canada)

    2010-11-15

    A series of experiments were performed to quantify the adsorption of cesium on ceiling tiles as a representative of urban construction materials. Adsorption was carried out from solutions to mimic wet environmental conditions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. The experiments were performed in the range of initial cesium concentrations of 0.114-23.9 mg L{sup -1} at room temperature (21 deg. C) around three weeks. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectrometry (ICP-MS). The quantity of adsorbed Cs was calculated by mass balance as a function of time. Two kinetic and three equilibrium models were employed to interpret the test results. Determination of kinetic parameters for adsorption was carried out using the first-order reaction model and the intra-particle diffusion model. Adsorption equilibrium was studied using Langmuir, Freundlich and three-parameter Langmuir-Freundlich adsorption isotherm models. A satisfactory correlation between the experimental and the predicted values was observed.

  20. Modeling {sup 137}Cs bioaccumulation in the salmon–resident killer whale food web of the Northeastern Pacific following the Fukushima Nuclear Accident

    Energy Technology Data Exchange (ETDEWEB)

    Alava, Juan José, E-mail: jalavasa@sfu.ca; Gobas, Frank A.P.C.

    2016-02-15

    To track the long term bioaccumulation of {sup 137}Cs in marine organisms off the Pacific Northwest coast of Canada, we developed a time dependent bioaccumulation model for {sup 137}Cs in a marine mammalian food web that included fish-eating resident killer whales. The model outcomes show that {sup 137}Cs can be expected to gradually bioaccumulate in the food web over time as demonstrated by the increase of the apparent trophic magnification factor of {sup 137}Cs, ranging from 0.76 after 1 month of exposure to 2.0 following 30 years of exposure. {sup 137}Cs bioaccumulation is driven by relatively rapid dietary uptake rates, moderate depuration rates in lower trophic level organisms and slow elimination rates in high trophic level organisms. Model estimates of the {sup 137}Cs activity in species of the food web, based on current measurements and forecasts of {sup 137}Cs activities in oceanic waters and sediments off the Canadian Pacific Northwest, indicate that the long term {sup 137}Cs activities in fish species including Pacific herring, wild Pacific salmon, sablefish and halibut will remain well below the current {sup 137}Cs-Canada Action Level for consumption (1000 Bq/kg) following a nuclear emergency. Killer whales and Pacific salmon are expected to exhibit the largest long term {sup 137}Cs activities and may be good sentinels for monitoring {sup 137}Cs in the region. Assessment of the long term consequences of {sup 137}Cs releases from the Fukushima aftermath should consider the extent of ecological magnification in addition to ocean dilution. - Highlights: • A food web bioaccumulation model to assess the biomagnification of {sup 137}Cs is developed. • Cesium 137 exhibits bioaccumulation over time as simulated by the model. • Predicted activities in marine biota are below {sup 137}Cs-food consumption benchmarks. • Long-term monitoring of {sup 137}Cs in the ocean will improve the model predictions.

  1. 40 CFR 721.10168 - Cesium tungsten oxide.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Cesium tungsten oxide. 721.10168... Substances § 721.10168 Cesium tungsten oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as cesium tungsten oxide (PMN P-08-275; CAS No....

  2. Tracing cohesive sediment transportation at river mouths around Tokyo, Japan by Cesium originated from Fukushima Daiichi Power Plant

    Science.gov (United States)

    koibuchi, Y.

    2012-12-01

    Sediment transport at river mouths, which consists of suspended-load and bed-load, has not been fully understood, since bed-load transport of cohesive sand is difficult to observe. Especially, the impact of sediment transport on the total amount of fine-grained cohesive sediment has not been elucidated. Cesium-134 and cesium-137 were spread from the Fukushima Daiichi Nuclear Power Plant (FDNPP) after the earthquake of March 11 of 2011, and attached to the fine-grained sand on the land. The contaminated sand flowed into the river mouths through the rivers possibly due to the complex physical processes in estuarine areas. To evaluate the fine-grained sediment transport around Tokyo and Tokyo Bay, field observations were carried out utilizing radionuclide originated from FDNPP as an effective tracer. The cohesive sediment transport at three different river mouths around Tokyo was successfully quantified. The cohesive sediment transport deposited in the estuary was found to be greatly dependent on the land use, geometry, river discharge and salinity. In addition,the transport driven by the rainfall was minute, and its behavior was quite different from suspended solids. Although further field observations of radionuclide are necessary, it is clear that fine-grained sediment in the bay from rivers already settled on the river mouth by aggregation. The settled sand will not move even in rainfall events. Consequently, the transport of radionuclide to the Pacific Ocean may not occur.; Cesium distribution around Tokyo Bay ; Cesium Concentration in Edogawa river

  3. Preferential removal and immobilization of stable and radioactive cesium in contaminated fly ash with nanometallic Ca/CaO methanol suspension

    Energy Technology Data Exchange (ETDEWEB)

    Mallampati, Srinivasa Reddy, E-mail: srireddys@ulsan.ac.kr [Department of Civil and Environmental Engineering, University of Ulsan, Ulsan 680-749 (Korea, Republic of); Mitoma, Yoshiharu, E-mail: mitomay@pu-hiroshima.ac.jp [Department of Environmental Sciences, Faculty of Life and Environmental Sciences, Prefectural University of Hiroshima, 562 Nanatsuka-Cho, Shobara City, Hiroshima 727-0023 (Japan); Okuda, Tetsuji [Environmental Research and Management Center, Hiroshima University, 1-5-3 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8513 (Japan); Sakita, Shogo [Department of Environmental Sciences, Faculty of Life and Environmental Sciences, Prefectural University of Hiroshima, 562 Nanatsuka-Cho, Shobara City, Hiroshima 727-0023 (Japan); Simion, Cristian [Politehnica University of Bucharest, Department of Organic Chemistry, Bucharest 060042 (Romania)

    2014-08-30

    Graphical abstract: Schematic representation of possible mechanisms determining the Cs extraction and immobilization in fly ash during water, methanol or n-MCaS extraction. - Highlights: • nMCaS suspension for cesium extraction and immobilization in fly ash was developed. • Enhanced cesium immobilization was done by nanometallic Ca/CaO methanol suspension. • By SEM analysis the amount of cesium detectable on soil particle surface decreases. • Leachable cesium concentrations reduced, lower than the standard regulatory limit. • nMCaS unique and a highly potential amendment for the remediation of Cs. - Abstract: In this work, the capability of nanometallic Ca/CaO methanol suspension in removing and/or immobilizing stable ({sup 133}Cs) and radioactive cesium species ({sup 134}Cs and {sup 137}Cs) in contaminated fly ash was investigated. After a first methanol and second water washing yielded only 45% of {sup 133}Cs removal. While, after a first methanol washing, the second solvent with nanometallic Ca/CaO methanol suspension yielded simultaneous enhanced removal and immobilization about 99% of {sup 133}Cs. SEM-EDS analysis revealed that the mass percent of detectable {sup 133}Cs on the fly ash surface recorded a 100% decrease. When real radioactive cesium contaminated fly ash (containing an initial 14,040 Bq kg{sup −1134}Cs and {sup 137}Cs cumulated concentration) obtained from burning wastes from Fukushima were reduced to 3583 Bq kg{sup −1} after treatment with nanometallic Ca/CaO methanol suspension. Elution test conducted on the treated fly ash gave 100 Bq L{sup −1} total {sup 134}Cs and {sup 137}Cs concentrations in eluted solution. Furthermore, both ash content and eluted solution concentrations of {sup 134}Cs and {sup 137}Cs were much lower than the Japanese Ministry of the Environment regulatory limit of 8000 Bq kg{sup −1} and 150 Bq L{sup −1} respectively. The results of this study suggest that the nanometallic Ca/CaO methanol suspension is

  4. ARAC Modeling of the Algeciras, Spain Steel Mill CS-137 Release

    Energy Technology Data Exchange (ETDEWEB)

    Vogt, P J; Pobanz, B M; Aluzzi, F J; Baskett, R L; Sullivan, T J

    1999-05-01

    On 12 June 1998, the Atmospheric Release Advisory Capability (ARAC) learned from news reports about the accidental release of cesium-137 from a steel mill near Algeciras, Spain. We used the U.S. Navy Operational Global Atmospheric Prediction System (NOGAPS) gridded data for meteorological input into our diagnostic models. To better resolve near-release location and coastal meteorological conditions, we blended four days of WMO surface and upper air observations with the gridded data. Our calculations showed the plume initially traveled eastward over the Mediterranean Sea, turned northward into central Europe, and was split by the Alps. We determined the timing and amount of cesium released by fitting our modeled air concentrations to the available set of measurements. Accuracy statistics from a small set of ratios of measured to computed air concentrations paired in space and time were similar to those achieved from larger data sets in previous ARAC model evaluation studies on the continental scale.

  5. Perlite for permanent confinement of cesium

    Science.gov (United States)

    Balencie, J.; Burger, D.; Rehspringer, J.-L.; Estournès, C.; Vilminot, S.; Richard-Plouet, M.; Boos, A.

    2006-06-01

    We present the potential use of expanded perlite, a metastable amorphous hydrated aluminium silicate, as a permanent medium for the long-term confinement of cesium. The method requires simply a loading by mixing an aqueous cesium nitrate solution and expanded perlite at 300 K followed by densification by sintering. The formation of pollucite, CsAlSi2O6, a naturally occurring mineral phase, upon careful heat treatment is demonstrated by X-ray diffraction. Leaching tests on the resulting glass-ceramics reveal a very low Cs departure of 0.5 mg m-2 d-1.

  6. Crystalline silicotitanates for cesium/strontium removal

    Energy Technology Data Exchange (ETDEWEB)

    Brown, N.; Miller, J.; Sherman, J.

    1996-10-01

    A new class of inorganic ion exchangers called crystalline silicotitanates (CST) has been developed that exhibits very high selectivity for cesium and strontium in the highly alkaline radioactive wastes at the Hanford Site and other DOE sites. Tests have also shown that CSTs have high selectivity for cesium in acidic and neutral solutions. The ESP is supporting an effort at Sandia National Laboratories and Texas A & M University to further develop and characterize the important chemical and physical properties that will determine the applicability of CST to radioactive waste treatment at Hanford and other DOE facilities.

  7. Microbial accumulation of uranium, radium, and cesium

    Energy Technology Data Exchange (ETDEWEB)

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; North, S.E.

    1981-05-01

    Diverse microbial species varied considerably in their ability to accumulate uranium, cesium, and radium. Mechanistic differences in uranium uptake by Saccharomyces cerevisiae and Pseudomonas aeruginosa were indicated. S. serevisiae exhibited a slow (hours) surface accumulation of uranium which was subject to environmental factors, while P. aeruginosa accumulated uranium rapidly (minutes) as dense intracellular deposits and did not appear to be affected by environmental parameters. Metabolism was not required for uranium uptake by either organism. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several species tested.

  8. Resonance Ionization Spectroscopy of Cesium Atoms in a Cesium Heat Pipe

    Science.gov (United States)

    Ardis, Robert G.; Gardner, Bernard W.; Smith, R. Seth

    1997-11-01

    A Cesium Heat Pipe has been constructed to produce a cesium metal vapor for use in laser spectroscopy. The heat pipe consists of a 24 inch stainless steel pipe with 2 inch diameter calcium fluoride windows on each end. Electric heaters are used to control the cesium vapor pressure. An argon buffer gas is used to maintain high transmittance through the end windows. Sensors are used to monitor both temperature and pressure. A Nd:YAG-pumped dye laser system is used to probe the cesium atoms via resonance ionization spectroscopy. Details of the construction of the heat pipe and the experimental setup will be presented. The results of the resonance ionization spectroscopy will be discussed. This experimental setup can be utilized with undergraduates in courses such as Optics, Laser Physics, and Senior Laboratory/Research.

  9. Water hyacinth for phytoremediation of radioactive waste simulate contaminated with cesium and cobalt radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, H.M., E-mail: hosamsaleh70@yahoo.com [Radioisotope Department, Nuclear Research Center, Atomic Energy Authority, Dokki 12311, Giza (Egypt)

    2012-01-15

    Highlights: Black-Right-Pointing-Pointer Phytoremediation of radioactive wastes containing {sup 137}Cs and {sup 60}Co radionuclides. Black-Right-Pointing-Pointer Using water hyacinth for radioactive waste treatment. Black-Right-Pointing-Pointer Bioaccumulation of radionuclides from radioactive waste streams. Black-Right-Pointing-Pointer Factors affecting bioaccumulation of {sup 137}Cs and {sup 60}Co using floating plants. - Abstract: Phytoremediation is based on the capability of plants to remove hazardous contaminants present in the environment. This study aimed to demonstrate some factors controlling the phytoremediation efficiency of live floating plant, water hyacinth (Eichhornia crassipes), towards the effluents contaminated with {sup 137}Cs and/or {sup 60}Co. Cesium has unknown vital biological role for plant while cobalt is one of the essential trace elements required for plant. The main idea of this work i.e. using undesirable species, water hyacinth, in purification of radiocontaminated aqueous solutions has been receiving much attention. The controlling factors such as radioactivity concentration, pH values, the amount of biomass and the light were studied. The uptake rate of radiocesium from the simulated waste solution is inversely proportional to the initial activity content and directly proportional to the increase in mass of plant and sunlight exposure. A spiked solution of pH Almost-Equal-To 4.9 was found to be the suitable medium for the treatment process. The uptake efficiency of {sup 137}Cs present with {sup 60}Co in mixed solution was higher than if it was present separately. On the contrary, uptake of {sup 60}Co is affected negatively by the presence of {sup 137}Cs in their mixed solution. Sunlight is the most required factor for the plant vitality and radiation resistance. The results of the present study indicated that water hyacinth may be a potential candidate plant of high concentration ratios (CR) for phytoremediation of radionuclides

  10. Cesium vapor thermionic converter anomalies arising from negative ion emission

    Science.gov (United States)

    Rasor, Ned S.

    2016-08-01

    Compelling experimental evidence is given that a longstanding limit encountered on cesium vapor thermionic energy converter performance improvement and other anomalies arise from thermionic emission of cesium negative ions. It is shown that the energy that characterizes thermionic emission of cesium negative ions is 1.38 eV and, understandably, is not the electron affinity 0.47 eV determined for the photodetachment threshold of the cesium negative ion. The experimental evidence includes measurements of collector work functions and volt-ampere characteristics in quasi-vacuum cesium vapor thermionic diodes, along with reinterpretation of the classic Taylor-Langmuir S-curve data on electron emission in cesium vapor. The quantitative effects of negative ion emission on performance in the ignited, unignited, and quasi-vacuum modes of cesium vapor thermionic converter operation are estimated.

  11. Cesium and Strontium Separation Technologies Literature Review

    Energy Technology Data Exchange (ETDEWEB)

    T. A. Todd; T. A. Todd; J. D. Law; R. S. Herbst

    2004-03-01

    Integral to the Advanced Fuel Cycle Initiative (AFCI) Program’s proposed closed nuclear fuel cycle, the fission products cesium and strontium in the dissolved spent nuclear fuel stream are to be separated and managed separately. A comprehensive literature survey is presented to identify cesium and strontium separation technologies that have the highest potential and to focus research and development efforts on these technologies. Removal of these high-heat-emitting fission products reduces the radiation fields in subsequent fuel cycle reprocessing streams and provides a significant short-term (100 yr) heat source reduction in the repository. This, along with separation of actinides, may provide a substantial future improvement in the amount of fuel that could be stored in a geologic repository. The survey and review of the candidate cesium and strontium separation technologies are presented herein. Because the AFCI program intends to manage cesium and strontium together, technologies that simultaneously separate both elements are of the greatest interest, relative to technologies that separate only one of the two elements.

  12. (137)Cs, (40)K and (210)Po in marine mammals from the southern Baltic Sea.

    Science.gov (United States)

    Ciesielski, Tomasz; Góral, Marta; Szefer, Piotr; Jenssen, Bjørn Munro; Bojanowski, Ryszard

    2015-12-15

    This study provides information on baseline concentrations of the radionuclides Cesium-137, Potassium-40 and Polonium-210 in sea mammals from the Baltic Sea. The radionuclides were analyzed in the liver, kidney and muscle of harbor porpoises, striped dolphins, and gray and ringed seals from the Polish coast by γ- and α-spectrometry. Median (137)Cs activities were 14.8, 13.2 and 23.2 Bq kg(-1) w.w. in the liver, kidney and muscles, respectively. Activities of (40)K and (210)Po in the respective tissues were found to be 79.1, 79.8 and 111 Bq kg(-1) for (40)K and 58.1, 59.2 and 32.9 Bq kg(-1) for (210)Po. The measured (137)Cs concentrations were extraordinarily high in comparison to those reported in sea mammals from other locations. However, dose assessments did not imply health effects from (137)Cs exposure in Baltic Sea mammals. Correlations between (137)Cs tissue activities and reported sea water concentrations highlight the potential use of marine mammals for biomonitoring purposes.

  13. Long-term reduction in {sup 137}Cs concentration in food crops on coral atolls resulting from potassium treatment

    Energy Technology Data Exchange (ETDEWEB)

    Robison, William L. [Lawrence Livermore National Laboratory, 7000 East Avenue, L-642, Livermore, CA 94550-9234 (United States)]. E-mail: robison1@llnl.gov; Stone, E.L. [Soil Science Department, University of Florida, Gainesville, FL 32609 (United States); Hamilton, T.F. [Lawrence Livermore National Laboratory, 7000 East Avenue, L-642, Livermore, CA 94550-9234 (United States); Conrado, C.L. [Lawrence Livermore National Laboratory, 7000 East Avenue, L-642, Livermore, CA 94550-9234 (United States)

    2006-07-01

    Bikini Island was contaminated on March 1, 1954 by the Bravo detonation (U.S. nuclear test series, Castle) at Bikini Atoll. About 90% of the estimated dose from nuclear fallout to potential island residents is from cesium-137 ({sup 137}Cs) transferred from soil to plants that are consumed by residents. Thus, radioecology research efforts have been focused on removing {sup 137}Cs from soil and/or reducing its uptake into vegetation. Most effective was addition of potassium (K) to soil that reduces {sup 137}Cs concentration in fruits to 3-5% of pretreatment concentrations. Initial observations indicated this low concentration continued for some time after K was last applied. Long-term studies were designed to evaluate this persistence in more detail because it is very important to provide assurance to returning populations that {sup 137}Cs concentrations in food (and, therefore, radiation dose) will remain low for extended periods, even if K is not applied annually or biennially. Potassium applied at 300, 660, 1260, and 2070 kg ha{sup -1} lead to a {sup 137}Cs concentration in drinking-coconut meat that is 34, 22, 10, and about 4% of original concentration, respectively. Concentration of {sup 137}Cs remains low 8-10 y after K is last applied. An explanation for this unexpected result is discussed.

  14. Long-Term Reduction in 137Cs Concentration in Food Crops on Coral Atolls Resulting from Potassium Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Robison, W; Stone, E; Hamilton, T; Conrado, C

    2005-04-08

    Bikini Island was contaminated March 1, 1954 by the Bravo detonation (U.S nuclear test series, Castle) at Bikini Atoll. About 90% of the estimated dose from nuclear fallout to potential island residents is from cesium-137 ({sup 137}Cs) transferred from soil to plants that are consumed by residents. Thus, radioecology research efforts have been focused on removing {sup 137}Cs from soil and/or reducing its uptake into vegetation. Most effective was addition of potassium (K) to soil that reduces {sup 137}Cs concentration in fruits to 3-5% of pretreatment concentrations. Initial observations indicated this low concentration continued for some time after K was last applied. Long-term studies were designed to evaluate this persistence in more detail because it is very important to provide assurance to returning populations that {sup 137}Cs concentrations in food (and, therefore, radiation dose) will remain low for extended periods, even if K is not applied annually or biennially. Potassium applied at 300, 660, 1260, and 1970 kg ha{sup -1} lead to a {sup 137}Cs concentration in drinking coconut meat that is 34, 22, 10, and about 4 % of original concentration, respectively. Concentration of {sup 137}Cs remains low 8 to 10 y after K is last applied. An explanation for this unexpected result is discussed.

  15. Long-Term Reduction in 137Cs Concentration in Food Crops on Coral Atolls Resulting from Potassium Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Robison, W L; Stone, E L; Hamilton, T F; Conrado, C L

    2004-04-14

    Bikini Island was contaminated March 1, 1954 by the Bravo detonation (U.S nuclear test series, Castle) at Bikini Atoll. About 90% of the estimated dose from nuclear fallout to potential island residents is from cesium-137 ({sup 137}Cs) transferred from soil to plants that are consumed by residents. Thus, radioecology research efforts have been focused on removing {sup 137}Cs from soil and/or reducing its uptake into vegetation. Most effective was addition of potassium (K) to soil that reduces {sup 137}Cs concentration in fruits to 3-5% of pretreatment concentrations. Initial observations indicated this low concentration continued for some time after K was last applied. Long-term studies were designed to evaluate this persistence in more detail because it is very important to provide assurance to returning populations that {sup 137}Cs concentrations in food (and, therefore, radiation dose) will remain low for extended periods, even if K is not applied annually or biennially. Potassium applied at 300, 660, 1260, and 2070 kg ha{sup -1} lead to a {sup 137}Cs concentration in drinking coconut meat that is 34, 22, 10, and about 4% of original concentration, respectively. Concentration of {sup 137}Cs remains low 8 to 10 y after K is last applied. An explanation for this unexpected result is discussed.

  16. Spatial heterogeneity of Cs-137 soil contamination at the landscape scale of the Bryansk Region (Russia)

    Science.gov (United States)

    Sokolov, Alexander; Sokolov, Anton; Linnik, Vitaly

    2016-04-01

    The passage of the Chernobyl plume over the Bryansk region (Russia) in the end of April 1986 led to the deposition of radionuclides on the ground by wet and dry deposition processes. According to the results of the Cs-137 air gamma survey (AGS, grid size: 100 m x100 m), which was conducted in summer 1993, it was shown that the processes of Cs-137 lateral migration took place due to nearly a fourfold increase of Cs-137 in the lower slope as compared to the upper part of the slope during a seven-year period after the Chernobyl accident. The variability patterns of Cs-137 could be described by a stochastic or a deterministic function of the measurement location. The patterns variations could be associated with the nonlinear response of many interacting variables within the landscape system. In the test area located at a distance of about 280 km from the Chernobyl Nuclear Power Plant Cs-137 surface activity typically ranges from below 7 kBq/m2 to approximately 50-60 kBq/m2 reflecting the combination of deposition due to global fallout from the atmospheric testing of nuclear weapons, and the relatively low levels of Chernobyl deposition to the area. To model the Cs-137 distribution depending on complex landscape attributes the following information layers were used: 1) the soil map at the scale of 1:50,000; 2) SRTM elevation data acquired from the Global Land Cover Facility at a 3 arc second resolution. Fundamental difficulties in distributed erosion modelling arise from the natural complexity of landscape systems and Cs-137 spatial heterogeneity. The SRTM DEM of the test site has a grid size about 90 m, which is not sufficient for distributed hydrological modelling at the landscape scale. The scaling problem arises because of the mismatch between SRTM DEM pixel dimensions and the size of erosion network (width about 10-50 m) that concentrates Cs-137 run-off from the overlying slopes and watershed areas. To build a hydrologically correct local drain direction (LDD) with

  17. Engineered Materials for Cesium and Strontium Storage Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Sean M. McDeavitt

    2010-04-14

    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at

  18. Nano-Cesium for Anti-Cancer Properties: An Investigation into Cesium Induced Metabolic Interference.

    Science.gov (United States)

    Daza, Enrique A; Misra, Santosh K; Schwartz-Duval, Aaron S; Ohoka, Ayako; Miller, Callie; Pan, Dipanjan

    2016-10-03

    The use of cesium chloride (CsCl) for cancer therapy ("high pH therapy") has been theorized to produce anticancer properties by raising intracellular pH to induce apoptosis. Although considered as "alternative medicine", little scientific evidence supports this theory. Alternatively, cells have no cesium ion (Cs(+)) mediated channels for clearance. Thus, such unstable electrochemical distributions have the severe potential to disrupt electrochemical dependent cellular processes, such as glucose cotransporters. Hence, a detailed investigation of pH changing effects and glucose uptake inhibition are warranted as a possible cesium-induced anticancer therapy. We developed and characterized cesium nanoparticles (38 ± 6 nm), termed NanoCs, for nanoparticle-mediated internalization of the ion, and compared its treatment to free CsCl. Our investigations suggest that neither NanoCs nor CsCl drastically changed the intracellular pH, negating the theory. Alternatively, NanoCs lead to a significant decrease in glucose uptake when compared to free CsCl, suggesting cesium inhibited glucose uptake. An apoptosis assay of observed cell death affirms that NanoCs leads tumor cells to initiate apoptosis rather than follow necrotic behavior. Furthermore, NanoCs lead to in vivo tumor regression, where H&E analysis confirmed apoptotic cell populations. Thus, NanoCs performed pH-independent anticancer therapy by inducing metabolic stasis.

  19. Recent {sup 137}Cs deposition in sediments of Admiralty Bay, Antarctica

    Energy Technology Data Exchange (ETDEWEB)

    Sanders, Christian J., E-mail: zinosanders@yahoo.co [Departamento de Geoquimica, Universidade Federal Fluminense, 24020-007, Niteroi-RJ (Brazil); Santos, Isaac R. [Centre for Coastal Biogeochemistry, School of Environmental Science and Management, Southern Cross University, Lismore, NSW 2480 (Australia); Patchineelam, Sambasiva R. [Departamento de Geoquimica, Universidade Federal Fluminense, 24020-007, Niteroi-RJ (Brazil); Schaefer, Carlos [Departamento de Solos, Universidade Federal de Vicosa, 36570-000, Vicosa-MG (Brazil); Silva-Filho, Emmanoel V. [Departamento de Geoquimica, Universidade Federal Fluminense, 24020-007, Niteroi-RJ (Brazil)

    2010-05-15

    Cesium-137, radium-226 and lead-210 profiles of a 25 cm sediment core give an indication of recent changes in land-ocean interactions at a polar coastal environment (Admiralty Bay, King George Island, Antarctica). The linear sedimentation accumulation rate at the study site calculated from the unsupported {sup 210}Pb profile was 6.7 mm/year from 1965 to 2005. A 3.5-fold increase in {sup 137}Cs concentrations was observed in the top layer of this sediment core. This sharp increase seems to indicate a recent redistribution of fallout radionuclides previously deposited on soil, vegetation and snow. These results imply enhanced land-ocean interactions at this site likely as a result of climate change. Because our results are based on a single core, additional investigations are needed to confirm our observations.

  20. Cesium Atomic Fountain Clocks at NMIJ

    Science.gov (United States)

    2010-11-01

    shift in caesium fountain clocks,” Physical Review Letters, 98, 153002. [10] A. Takamizawa, Y. Shirakawa, S. Yanagimachi et al., 2010, “Proposal of a...beam of laser-cooled cesium atoms,” Physical Review, A 60, R4241-R4244. [13] V. Gerginov, N. Nemitz, S. Weyers, et al., 2010, “Uncertainty evaluation of the caesium fountain clock PTB-CSF2,” Metrologia, 47, 65-79.

  1. Lanthanide doped strontium-barium cesium halide scintillators

    Science.gov (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  2. Surface interactions of cesium and boric acid with stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Grossman-Canfield, N.

    1995-08-01

    In this report, the effects of cesium hydroxide and boric acid on oxidized stainless steel surfaces at high temperatures and near one atmosphere of pressure are investigated. This is the first experimental investigation of this chemical system. The experimental investigations were performed using a mass spectrometer and a mass electrobalance. Surfaces from the different experiments were examined using a scanning electron microscope to identify the presence of deposited species, and electron spectroscopy for chemical analysis to identify the species deposited on the surface. A better understanding of the equilibrium thermodynamics, the kinetics of the steam-accelerated volatilizations, and the release kinetics are gained by these experiments. The release rate is characterized by bulk vaporization/gas-phase mass transfer data. The analysis couples vaporization, deposition, and desorption of the compounds formed by cesium hydroxide and boric acid under conditions similar to what is expected during certain nuclear reactor accidents. This study shows that cesium deposits on an oxidized stainless steel surface at temperatures between 1000 and 1200 Kelvin. Cesium also deposits on stainless steel surfaces coated with boric oxide in the same temperature ranges. The mechanism for cesium deposition onto the oxide layer was found to involve the chemical reaction between cesium and chromate. Some revaporization in the cesium hydroxide-boric acid system was observed. It has been found that under the conditions given, boric acid will react with cesium hydroxide to form cesium metaborate. A model is proposed for this chemical reaction.

  3. Polarizabilities and Shielding Factors of Ions in Cesium Halide Crystals with the Cesium Chloride Structure

    Science.gov (United States)

    Mahbubar, Rahman; Michihiro, Yoshitaka; Nakamura, Koichi; Kanashiro, Tatsuo

    2001-08-01

    The calculated results of the polarizabilities and the quadrupole shielding factor of the ions in cesium halide crystals with the cesium chloride structure are presented. The calculation is done on the basis of the self-consistent field local density approximation and the modified Sternheimer equation. The crystalline potential is treated by the spherical solid model. The size effect is seen in the values of the polarizabilities and the quadrupole shielding factor. The values of the polarizabilities and the quadrupole shielding factor of cesium ion show only slight change in different crystals. The values of chlorine ion show significant reduction and the amount of the reduction is different in the different crystals. The effect of the crystalline environment on the electron states is discussed.

  4. The existence state in the soil of radioactive cesium from the Fukushima Dai-ichi nuclear power plant accident by imaging plate photograph

    Science.gov (United States)

    Satou, Yukihiko; Sueki, Keisuke

    2013-04-01

    In the accident of the Fukushima Daiichi nuclear power plant, the wide area in east Japan was polluted seriously with radioactive cesium. But, unlike Chernobyl, reactor core explosion did not occur in Fukushima. Therefore, it is thought that many radioactive nuclides emitted into the atmosphere were in the gas state and aerosol. However, when the imaging plate photographs of the surface soils in Fukushima was observed, many granular radionuclides existed. Then, in order to confirm a radioactive cesium of particle state, the treatment for the soils contaminated with radioactive cesium by using chemical operation was tried. Three type soils, that is, paddy soil, river sediment, and sea sand, were made applicable to research. The contaminated soil samples were collected in Fukushima and Ibaraki prefecture. Radioactivity concentrations of 137Cs and 134Cs were measured by using gamma-ray spectrometry with a high pure germanium (HPGe) detector. After the radioactively measurement, soils had been burned in oven for five hours in 500 degree Celsius. Concentrated hydrochloric acid was added to soil samples, and they were heated for three hours. These samples were divided into residue and elution by centrifugal separation, and then radioactivity of cesium contained in residue was measured. After chemical operations, 70% and 85% of radioactive cesium from river sediment and sea sand were extracted approximately into elution, respectively. In contrast, in the soil of the paddy field, only 30% of radioactive cesium was approximately eluted. When radiation image photograph of the residues of all three types of soils were taken and observed, the granular radioactive nuclides remained clearly in paddy soil and river sediment. In contrast, all the granular radioactive nuclides in sea sand disappeared after treatment. The results of above things that desorption of radioactive cesium depend on the kind of soil. Furthermore, it was suggested that there was radioactive cesium of

  5. Comparison of the effectiveness of exposure to low LET helium particles (4He) and gamma rays (137Cs) on the disruption of cognitive performance

    Science.gov (United States)

    Rats were exposed to either Helium (4He) particles (1000 MeV/n; 0.1 – 10 cGy; head-only) or Cesium 137Cs gamma rays (50 – 400 cGy; whole body) and the effects of irradiation on cognitive performance evaluated. The results indicated that exposure to doses of 4He particles as low as 0.1 cGy disrupted...

  6. Biomonitoring fallout 137Cs in resident and migratory fishes collected along the southern coast of India and assessment of dose.

    Science.gov (United States)

    Khan, Mohan Feroz; Wesley, Samuel Godwin

    2012-05-01

    The globally distributed fallout radionuclide (137)Cs was monitored in 25 resident and 22 migratory fish species collected from some regions of west and east coast of southern India to establish a baseline data. The samples were collected during June 2008 to June 2009. Higher level of (137)Cs was noted in planktivorous fishes and lower level in herbivores. A significant variation in (137)Cs was observed between fishes with different feeding habits and different migratory pattern. Oceanodromic migratory fishes displayed higher cesium levels than other migratory types. Similarly, migratory fishes displayed higher (137)Cs concentration compared to resident fishes. The overall range of (137)Cs varied from 0.06 to 0.3 Bq/kg in fishes. The biological concentration varied from 55 to 250. The average external dose rate to fishes was calculated to be 2.7 × 10(-7) μGy/h, while the internal dose rate varied from 8.50 × 10(-6) to 5.27 × 10(-5) μGy/h. The hazard quotient for fishes was found to be less than 1. The average intake of (137)Cs via fishes to the public was calculated to be 3.5 Bq/year and subsequently the committed effective dose was 0.05 μSv/year. The data obtained were less than global average and comparable to those of many regions.

  7. Selective removal of cesium and strontium using porous frameworks from high level nuclear waste.

    Science.gov (United States)

    Aguila, Briana; Banerjee, Debasis; Nie, Zimin; Shin, Yongsoon; Ma, Shengqian; Thallapally, Praveen K

    2016-05-01

    Efficient and cost-effective removal of radioactive (137)Cs and (90)Sr found in spent fuel is an important step for safe, long-term storage of nuclear waste. Solid-state materials such as resins and titanosilicate zeolites have been assessed for the removal of Cs and Sr from aqueous solutions, but there is room for improvement in terms of capacity and selectivity. Herein, we report the Cs(+) and Sr(2+) exchange potential of an ultra stable MOF, namely, MIL-101-SO3H, as a function of different contact times, concentrations, pH levels, and in the presence of competing ions. Our preliminary results suggest that MOFs with suitable ion exchange groups can be promising alternate materials for cesium and strontium removal.

  8. Input contribution and vertical migration of plutonium, americium and cesium in lake sediments (Belham Tarn, Cumbria, UK)

    Energy Technology Data Exchange (ETDEWEB)

    Michel, H.; Barci-Funel, G.; Barci, V.; Ardisson, G. [Lab. de Radiochimie et de Radioecologie, Univ. de Nice Sophia Antipolis, Nice (France)

    2002-07-01

    The record of the global atmospheric fallout could be found in the lake sediments. A mass balance for fallout radionuclides in Blelham Tarn and its catchment is established. The sediment activity contribution is coming from direct atmospheric fallout and from indirect atmospheric fallout via the catchment. The catchement activity is conveyed to the sediment by the rivers and the direct streaming. A comparison of the fallout and the sediment inventory allows the activity estimation of these different contributions and to understand the mobility of these elements on the catchment and in the sediments. The study of activity profile in sediment core allows to characterise the different radioactive events occurred in the past. For the lake Blelham, the results show two cesium activity peaks and only one peak for transuranic activities. The deepest peaks correspond to the atmospheric nuclear test fallout in the sixties (1963) and the second peak to the Chernobyl accident (1986). The activity ratio {sup 239-240}Pu/{sup 137}Cs allows estimating the ratio between cesium activities in sediments coming from these two events. Plutonium and cesium diffusion coefficients are calculated with a simple analytical model. (orig.)

  9. DEVELOPMENT OF PROTOTYPE TITANATE ION EXCHANGE LOADED MEMBRANES FOR STRONTIUM, CESIUM AND ACTINIDE DECONTAMINATION FROM AQUEOUS MEDIA

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L; Keisha Martin, K; David Hobbs, D

    2008-05-30

    We have successfully incorporated high surface area particles of titanate ion exchange materials (monosodium titanate and crystalline silicotitanate) with acceptable particle size distribution into porous and inert support membrane fibrils consisting of polytetrafluoroethylene (Teflon{reg_sign}), polyethylene and cellulose materials. The resulting membrane sheets, under laboratory conditions, were used to evaluate the removal of surrogate radioactive materials for cesium-137 and strontium-90 from high caustic nuclear waste simulants. These membrane supports met the nominal requirement for nonchemical interaction with the embedded ion exchange materials and were porous enough to allow sufficient liquid flow. Some of this 47-mm size stamped out prototype titanium impregnated ion exchange membrane discs was found to remove more than 96% of dissolved cesium-133 and strontium-88 from a caustic nuclear waste salt simulants. Since in traditional ion exchange based column technology monosodium titanate (MST) is known to have great affinity for the sorbing of other actinides like plutonium, neptunium and even uranium, we expect that the MST-based membranes developed here, although not directly evaluated for uptake of these three actinides because of costs associated with working with actinides which do not have 'true' experimental surrogates, would also show significant affinity for these actinides in aqueous media. It was also observed that crystalline silicotitanate impregnated polytetrafluoroethylene or polyethylene membranes became less selective and sorbed both cesium and strontium from the caustic aqueous salt simulants.

  10. Fish pollution with anthropogenic 137Cs in the southern Baltic Sea.

    Science.gov (United States)

    Zalewska, Tamara; Suplińska, Maria

    2013-02-01

    This paper presents the results of a study on changes in (137)Cs activity concentrations in three fish species from the southern Baltic Sea: cod (Gadus morhua), herring (Clupea harengus) and flounder (Platichtys flesus), in the period 2000-2010. During the study period a marked decline in cesium activity concentration in fish muscle tissue was observed, which reflected changes in radionuclide activity concentration in seawater. No statistically significant temporal trends were determined in changes of concentration factors (CF(fish/seawater)) calculated for the examined fish species. The analysis of (137)Cs activity as a function of ichthyological parameters revealed the lack of a relationship between radionuclide activity concentrations in herring muscle tissue and the fish age in an narrow age range (2-4 years). However, a reverse proportionality of total fish mass, as well as body length, against (137)Cs activity concentrations in muscles was well documented. The latter observation can be the direct result of the dilution effect related to the increase of fish body weight. (137)Cs activity concentration in muscle tissue of the five fish species forms a declining sequence: Gadus morhua, Platichthys flesus, Clupea harengus, Perca fluviatilis and Neogobius melanostomus.

  11. Sintered bentonite ceramics for the immobilization of cesium- and strontium-bearing radioactive waste

    Science.gov (United States)

    Ortega, Luis Humberto

    The Advanced Fuel Cycle Initiative (AFCI) is a Department of Energy (DOE) program, that has been investigating technologies to improve fuel cycle sustainability and proliferation resistance. One of the program's goals is to reduce the amount of radioactive waste requiring repository disposal. Cesium and strontium are two primary heat sources during the first 300 years of spent nuclear fuel's decay, specifically isotopes Cs-137 and Sr-90. Removal of these isotopes from spent nuclear fuel will reduce the activity of the bulk spent fuel, reducing the heat given off by the waste. Once the cesium and strontium are separated from the bulk of the spent nuclear fuel, the isotopes must be immobilized. This study is focused on a method to immobilize a cesium- and strontium-bearing radioactive liquid waste stream. While there are various schemes to remove these isotopes from spent fuel, this study has focused on a nitric acid based liquid waste. The waste liquid was mixed with the bentonite, dried then sintered. To be effective sintering temperatures from 1100 to 1200°C were required, and waste concentrations must be at least 25 wt%. The product is a leach resistant ceramic solid with the waste elements embedded within alumino-silicates and a silicon rich phase. The cesium is primarily incorporated into pollucite and the strontium into a monoclinic feldspar. The simulated waste was prepared from nitrate salts of stable ions. These ions were limited to cesium, strontium, barium and rubidium. Barium and rubidium will be co-extracted during separation due to similar chemical properties to cesium and strontium. The waste liquid was added to the bentonite clay incrementally with drying steps between each addition. The dry powder was pressed and then sintered at various temperatures. The maximum loading tested is 32 wt. percent waste, which refers to 13.9 wt. percent cesium, 12.2 wt. percent barium, 4.1 wt. percent strontium, and 2.0 wt. percent rubidium. Lower loadings of waste

  12. Selective chemical binding enhances cesium tolerance in plants through inhibition of cesium uptake

    DEFF Research Database (Denmark)

    Adams, Eri; Chaban, Vitaly; Khandelia, Himanshu;

    2015-01-01

    High concentrations of cesium (Cs(+)) inhibit plant growth but the detailed mechanisms of Cs(+) uptake, transport and response in plants are not well known. In order to identify small molecules with a capacity to enhance plant tolerance to Cs(+), chemical library screening was performed using Ara...

  13. Cesium-associated hypokalemia successfully treated with amiloride.

    Science.gov (United States)

    Horn, Sarah; Naidus, Elliot; Alper, Seth L; Danziger, John

    2015-06-01

    Self-treatment of cancer with cesium chloride, despite proven lack of efficacy, continues to produce serious adverse effects. Among these is hypokalemia predisposing to life-threatening arrhythmia. The mechanism of cesium-associated hypokalemia (CAH) has not been described. We report urinary potassium wasting responsive to amiloride therapy in a cancer patient with CAH, and discuss possible mechanisms.

  14. Cesium-associated hypokalemia successfully treated with amiloride

    OpenAIRE

    Horn, Sarah; Naidus, Elliot; Alper, Seth L; Danziger, John

    2015-01-01

    Self-treatment of cancer with cesium chloride, despite proven lack of efficacy, continues to produce serious adverse effects. Among these is hypokalemia predisposing to life-threatening arrhythmia. The mechanism of cesium-associated hypokalemia (CAH) has not been described. We report urinary potassium wasting responsive to amiloride therapy in a cancer patient with CAH, and discuss possible mechanisms.

  15. Distillation device supplies cesium vapor at constant pressure

    Science.gov (United States)

    Basiulis, A.; Shefsiek, P. K.

    1968-01-01

    Distillation apparatus in the form of a U tube supplies small amounts of pure cesium vapor at constant pressure to a thermionic converter. The upstream leg of the U tube is connected to a vacuum pump to withdraw noncondensable impurities, the bottom portion serves as a reservoir for the liquid cesium.

  16. 137Cs and 210Po in Pacific Walrus and Bearded Seal from St. Lawrence Island, Alaska

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T F; Seagars, D J; Jokela, T; Layton, D

    2005-02-02

    The activity concentration of Cesium-137 ({sup 137}Cs) and naturally-occurring Polonium-210 ({sup 210}Po) were measured in the muscle tissue, kidney and liver of Pacific walrus (Odobenus rosmarus divergens) and bearded seal (Erignathus barbatus) collected by native hunters from the Bering Sea. The mean {sup 137}Cs concentrations in muscle, liver and kidney of Pacific walrus were 0.07, 0.09 and 0.07 Bq kg{sup -1} (N= 5, wet weight), respectively, and 0.17, 0.10, and 0.17 Bq kg{sup -1} (N=2, wet weight), respectively, in bearded seal. In general, {sup 137}Cs tissue concentrations are significantly lower than those previously reported for mammals from other regions. By comparison, {sup 210}Po activity concentrations appear to be higher than those reported elsewhere but a larger variation. The mean {sup 210}Po concentration in the muscle tissue, liver and kidney of Pacific walrus (N=5, wet weight) were 28.7, 189, and 174 Bq kg{sup -1}, respectively. This compares with {sup 210}Po concentration values (N=2, wet weight) of 27, 207, and 68 Bq kg{sup -1} measured in the muscle tissue, liver and kidney, of bearded seal, respectively. Estimated bioaccumulation factors--as defined by the radionuclide concentration ratio between the target tissue to that in sea water--were two to three orders of magnitude higher for {sup 210}Po that those of {sup 137}Cs. We conclude from radiological dose estimates that ingestion of {sup 137}Cs in foods derived from walrus and seal will pose no threat to human health. This work has important implications for assessing health risks to Alaskan coastal communities concerned about the dumping of nuclear waste in the Russia Arctic.

  17. 21 CFR 137.350 - Enriched rice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched rice. 137.350 Section 137.350 Food and... Related Products § 137.350 Enriched rice. (a) The foods for which definitions and standards of identity are prescribed by this section are forms of milled rice (except rice coated with talc and glucose...

  18. 7 CFR 58.137 - Excluded milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Excluded milk. 58.137 Section 58.137 Agriculture... Milk § 58.137 Excluded milk. A plant shall not accept milk from a producer if: (a) The milk has been in...) Three of the last five milk samples have exceeded the maximum bacterial estimate of 500,000 per...

  19. 14 CFR 125.137 - Oil valves.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Oil valves. 125.137 Section 125.137....137 Oil valves. (a) Each oil valve must— (1) Comply with § 125.155; (2) Have positive stops or... the valve. (b) The closing of an oil shutoff means must not prevent feathering the propeller,...

  20. 49 CFR 213.137 - Frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frogs. 213.137 Section 213.137 Transportation... TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.137 Frogs. (a) The flangeway depth measured from a plane across the wheel-bearing area of a frog on Class 1 track shall not be less than 13/8 inches,...

  1. 49 CFR 176.137 - Portable magazine.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Portable magazine. 176.137 Section 176.137... Requirements for Class 1 (Explosive) Materials Stowage § 176.137 Portable magazine. (a) Each portable magazine... wood, a portable magazine must be framed of nominal 5 cm × 10 cm (2×4 inch) lumber, and sheathed...

  2. 25 CFR 137.1 - Water supply.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Water supply. 137.1 Section 137.1 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.1 Water supply. The engineering report dealt with in... capacity of the San Carlos reservoir created by the Coolidge Dam and the water supply therefor over...

  3. 42 CFR 137.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Definitions. 137.10 Section 137.10 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Definitions § 137.10 Definitions. Unless...

  4. 21 CFR 137.190 - Cracked wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cracked wheat. 137.190 Section 137.190 Food and... Related Products § 137.190 Cracked wheat. Cracked wheat is the food prepared by so cracking or cutting into angular fragments cleaned wheat other than durum wheat and red durum wheat that, when tested...

  5. 21 CFR 137.195 - Crushed wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Crushed wheat. 137.195 Section 137.195 Food and... Related Products § 137.195 Crushed wheat. Crushed wheat, coarse ground wheat, is the food prepared by so crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the...

  6. 46 CFR 45.137 - Cargo ports.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Cargo ports. 45.137 Section 45.137 Shipping COAST GUARD....137 Cargo ports. (a) Unless otherwise authorized by the Commandant, the lower edge of any opening for cargo, personnel, machinery access, or similar opening in the side of a ship must be above a line...

  7. 29 CFR 452.137 - Effective dates.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Effective dates. 452.137 Section 452.137 Labor Regulations Relating to Labor OFFICE OF LABOR-MANAGEMENT STANDARDS, DEPARTMENT OF LABOR LABOR-MANAGEMENT STANDARDS... OF 1959 Dates and Scope of Application § 452.137 Effective dates. (a) Section 404 states when...

  8. 25 CFR 137.6 - Power development.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Power development. 137.6 Section 137.6 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.6 Power development. The cost of the power development at... power development shall be disposed of as required by the terms and conditions of the act of March...

  9. [Surveillance of radioactive cesium in foods].

    Science.gov (United States)

    Nabeshi, Hiromi; Tsutsumi, Tomoaki; Ikarashi, Atsuko; Hachisuka, Akiko; Matsuda, Rieko

    2013-01-01

    We surveyed foods on the market from areas that had been exposed to radioactive materials contamination following the Fukushima accident. We used a NaI (Tl) scintillation spectrometer for the screening tests and a germanium semiconductor detector for the final tests. Test results from 1,427 samples showed that 6 samples (0.4%) exceeded the regulatory limit of 500 Bq/kg. Considering the detection rate of radioactive cesium in each food category, we suggest that it is necessary to continue monitoring fruits such as chestnuts and ginkgo nuts, mushrooms (especially raw wood-shiitake), mountain vegetables, and sea fish.

  10. Whole-Body Counter Evaluation of Internal Radioactive Cesium in Dogs and Cats Exposed to the Fukushima Nuclear Disaster

    Science.gov (United States)

    Wada, Seiichi; Ito, Nobuhiko; Watanabe, Masamichi; Kakizaki, Takehiko; Natsuhori, Masahiro; Kawamata, Jun; Urayama, Yoshio

    2017-01-01

    As a result of the 2011 nuclear incident that occurred at the Fukushima Nuclear Power Plant, a large number of abandoned dogs and cats were left within the disaster zone. A small number of these animals were rescued and cared for at shelters. Prior to the dispersal of these animals to their owners or fosterers, we evaluated the degree of internal radiocesium contamination using a specially designed whole-body counter. We conducted 863 non-invasive measurements of gamma rays due to internal radioactive cesium for 68 dogs and 120 cats at one shelter. After plotting graphs of 137Cs density we generated exponential functions of decay from seven dogs and six cats. From the regression formulae, we were able to determine the biological half-lives as 38.2 days for dogs and 30.8 days for cats. We found that in dogs there was a correlation between the biological half-life of radioactive cesium and age. Using our data, we estimated whole-body densities for each cat and dog at the time when they were rescued. We found that there were deviations in the data distributions among the different species, likely due to the timing of rescue, or living habits prior to rescue. A significant correlation was found when extracted feline reproductive organs were analyzed; the coefficients for the estimation of whole-body densities were approximately 7-fold higher than those based on the extracted feline reproductive organs. This may be due to the fact that majority of the radioactive cesium accumulates within muscular tissue with less distribution in other organs. It is possible to plan the appropriate management period in an animal shelter based on the use of the biological half-life of radioactive cesium calculated in this study. We believe that the correlations we uncovered in this work would be of great use for the management of companion animals in the event of a future nuclear accident. PMID:28099476

  11. Physicochemical fractionation of {sup 137}Cs from TEPCO Fukushima Daiichi Nuclear Plant in irrigation water

    Energy Technology Data Exchange (ETDEWEB)

    Tsukada, Hirofumi; Ohse, Kenji; Ishii, Hideki; Kitayama, Kyo; Nanba, Kenji; Kawatsu, Kencho [Fukushima University, 1 Kanayagawa, Fukushima, Fukushima 960-1296 (Japan)

    2014-07-01

    Significant quantities of radionuclides were released into the environment due to the TEPCO Fukushima Daiichi Nuclear Power Plant accident. Cesium-137 is the most important radionuclide for the assessment of radiation exposure to the public for the long-term. The physicochemical form of radionuclides is an important factor in determining the fate of radionuclides in the environment. For instance, {sup 137}Cs in soil can be divided into three fractions (such as exchangeable, bound to organic matter, and strongly bound to particles), and their transferability to biota and contacting waters are different. In the present study, the physicochemical fractions in rice irrigation water were determined. Sixty L of the irrigation water was collected in Oguni, Date, Fukushima (northwest 55 km far away from the Plant) in 2013. The collected sample was filtered with a 0.45 μm membrane filter (Merck Millipore, Durapore{sup R} Membrane Filters), and separated into suspended and dissolved fractions. In addition, 2000-4000 L of the irrigation water was treated by a continuous high-speed centrifugation method, and several g of suspended matter were collected. Twenty ml of concentrated nitric acid was added to 20 L of the filtrated sample and the sample was concentrated with heating, which was used to determine the total concentration of {sup 137}Cs in the dissolved fraction. Then, 5 L of the filtrated sample was passed through a Cs disk (3M, Empore{sup TM} Cesium RAD Disks) and the inorganic, cationic fraction that existed as {sup 137}Cs+ was collected. The difference between the total dissolved fraction and the inorganic fraction was defined as the dissolved organic fraction. The suspended matter collected with the centrifugation method was separated into the three solid-phase fractions noted above: exchangeable, bound to organic matter, and strongly bound to particles. Thus, the total {sup 137}Cs inventory in the irrigation water was separated into five fractions: dissolved

  12. Design of a Carousel Process for Removing Cesium from SRS Waste Using Crystalline Silicotitanate Ion Exchanger

    Energy Technology Data Exchange (ETDEWEB)

    Walker, D.D.

    1999-01-15

    Designs of a three-column carousel process based on crystalline silicotitanate (CST) ion exchanger have been developed for removing radioactive 137Cs+ from Savannah River Site's (SRS) nuclear wastes. A multicomponent ion exchange equilibrium model (Zheng et al., 1997) from Texas A&M University, which is based on batch data obtained from CST powder, is used to generate cesium loading data at different cesium concentrations for various types of SRS wastes. These loading data are fit to the Langmuir equation to obtain effective single-component cesium isotherm parameters. The predictions are in reasonable agreement with batch test data obtained from CST powder, an early CST pellet batch (38B), and a later batch (IE911) using two SRS waste simulants. The ratios between experimental cesium distribution coefficients and predicted values are between 0.56 and 1.0. The variation appears to be due to inadequate equilibration time in some of the batches. Mass transfer parameters are estimated by analyzing column data of a simulated SRS waste and Melton Valley Storage Tank W29 (MVST-W29) waste. The intraparticle diffusivity estimated for the two wastes can be well correlated by means of the Stokes-Einstein equation.Simulations are performed to determine the length of the mass transfer zone for given feed compositions, Cs+ concentrations, and linear velocities. In order to ensure high column utilization during both the transient and cyclic steady state periods, the length of a single segment in the carousel process is chosen to be the mass transfer zone length after the concentration wave achieves a constant pattern. Analysis of the dimensionless groups in the differential mass balance equations reveals that the normalized mass transfer zone length is linearly proportional to the particle Peclet number. The proportionality constant is a function of the waste composition and the Cs+ concentration in the waste. The higher the effective Cs+ capacity and the higher the Cs

  13. Microcrystalline hexagonal tungsten bronze. 1. Basis of ion exchange selectivity for cesium and strontium.

    Science.gov (United States)

    Griffith, Christopher S; Luca, Vittorio; Hanna, John V; Pike, Kevin J; Smith, Mark E; Thorogood, Gordon S

    2009-07-06

    The structural basis of selectivity for cesium and strontium of microcrystalline hexagonal tungsten bronze (HTB) phase Na(x)WO(3+x/2).zH(2)O has been studied using X-ray and neutron diffraction techniques, 1D and 2D (23)Na magic angle spinning (MAS) nuclear magnetic resonance (NMR) spectroscopy, and radiochemical ion exchange investigations. For the HTB system, this study has shown that scattering techniques alone provide an incomplete description of the disorder and rapid exchange of water (with tunnel cations) occurring in this system. However, 1D and 2D (23)Na MAS NMR has identified three sodium species within the HTB tunnels-species A, which is located at the center of the hexagonal window and is devoid of coordinated water, and species B and C, which are the di- and monohydrated variants, respectively, of species A. Although species B accords with the traditional crystallographic model of the HTB phase, this work is the first to propose and identify the anhydrous species A and monohydrate species C. The population (total) of species B and C decreases in comparison to that of species A with increasing exchange of either cesium or strontium; that is, species B and C appear more exchangeable than species A. Moreover, a significant proportion of tunnel water is redistributed by these cations. Multiple ion exchange investigations with radiotracers (137)Cs and (85)Sr have shown that for strontium there is a definite advantage in ensuring that any easily exchanged sodium is removed from the HTB tunnels prior to exchange. The decrease in selectivity (wrt cesium) is most probably due to the slightly smaller effective size of Sr(2+); namely, it is less of a good fit for the hexagonal window, ion exchange site. The selectivity of the HTB framework for cesium has been shown unequivocally to be defined by the structure of the hexagonal window, ion exchange site. Compromising the geometry of this window even in the slightest way by either (1) varying the cell volume through

  14. Modeling of leachable {sup 137}Cs in throughfall and stemflow for Japanese forest canopies after Fukushima Daiichi Nuclear Power Plant accident

    Energy Technology Data Exchange (ETDEWEB)

    Loffredo, Nicolas, E-mail: wataiso@free.fr [Center for Research in Isotopes and Environmental Dynamics, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8572 (Japan); Onda, Yuichi [Center for Research in Isotopes and Environmental Dynamics, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8572 (Japan); Kawamori, Ayumi [Graduate School of Life and Environmental Sciences, University of Tsukuba (Japan); Kato, Hiroaki [Center for Research in Isotopes and Environmental Dynamics, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8572 (Japan)

    2014-09-15

    The Fukushima accident dispersed significant amounts of radioactive cesium (Cs) in the landscape. Our research investigated, from June 2011 to November 2013, the mobility of leachable Cs in forests canopies. In particular, {sup 137}Cs and {sup 134}Cs activity concentrations were measured in rainfall, throughfall, and stemflow in broad-leaf and cedar forests in an area located 40 km from the power plant. Leachable {sup 137}Cs loss was modeled by a double exponential (DE) model. This model could not reproduce the variation in activity concentration observed. In order to refine the DE model, the main physical measurable parameters (rainfall intensity, wind velocity, and snowfall occurrence) were assessed, and rainfall was identified as the dominant factor controlling observed variation. A corrective factor was then developed to incorporate rainfall intensity in an improved DE model. With the original DE model, we estimated total {sup 137}Cs loss by leaching from canopies to be 72 ± 4%, 67 ± 4%, and 48 ± 2% of the total plume deposition under mature cedar, young cedar, and broad-leaf forests, respectively. In contrast, with the improved DE model, the total {sup 137}Cs loss by leaching was estimated to be 34 ± 2%, 34 ± 2%, and 16 ± 1% of the total plume deposition under mature cedar, young cedar, and broad-leaf forests, respectively. The improved DE model corresponds better to observed data in literature. Understanding {sup 137}Cs and {sup 134}Cs forest dynamics is important for forecasting future contamination of forest soils around the FDNPP. It also provides a basis for understanding forest transfers in future potential nuclear disasters. - Highlights: • A double exponential model was used to model leachable cesium loss from canopies. • The model could not reproduce variation observed. • Rainfall was identified as the dominant factor controlling the variation. • A rainfall parameter was used to develop an improved double exponential model. • The

  15. Performance evaluation of 24 ion exchange materials for removing cesium and strontium from actual and simulated N-Reactor storage basin water

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G.N.; Carson, K.J.; DesChane, J.R.; Elovich, R.J.

    1997-09-01

    This report describes the evaluation of 24 organic and inorganic ion exchange materials for removing cesium and strontium from actual and simulated waters from the 100 Area 105 N-Reactor fuel storage basin. The data described in this report can be applied for developing and evaluating ion exchange pre-treatment process flowsheets. Cesium and strontium batch distribution ratios (K{sub d}`s), decontamination factors (DF), and material loadings (mmol g{sup -1}) are compared as a function of ion exchange material and initial cesium concentration. The actual and simulated N-Basin waters contain relatively low levels of aluminum, barium, calcium, potassium, and magnesium (ranging from 8.33E-04 to 6.40E-05 M), with slightly higher levels of boron (6.63E-03 M) and sodium (1.62E-03 M). The {sup 137}Cs level is 1.74E-06 Ci L-{sup 1} which corresponds to approximately 4.87E-10 M Cs. The initial Na/Cs ratio was 3.33E+06. The concentration of total strontium is 4.45E-06 M, while the {sup 90}Sr radioactive component was measured to be 6.13E-06 Ci L{sup -1}. Simulant tests were conducted by contacting 0.067 g or each ion exchange material with approximately 100 mL of either the actual or simulated N-Basin water. The simulants contained variable initial cesium concentrations ranging from 1.00E-04 to 2.57E- 10 M Cs while all other components were held constant. For all materials, the average cesium K{sub d} was independent of cesium concentration below approximately 1.0E-06 M. Above this level, the average cesium K{sub d} values decreased significantly. Cesium K{sub d} values exceeding 1.0E+07 mL g{sup -1} were measured in the simulated N-Basin water. However, when measured in the actual N-Basin water the values were several orders of magnitude lower, with a maximum of 1.24E+05 mL g{sup -1} observed.

  16. Spectral range calculation inside the Research Irradiating Facility Army Technology Center using code MCNPX and comparison with the spectra of energy Caesium 137 raised in laboratory; Calculo gama espectral no interior do irradiador de pesquisa do Centro Tecnologico do Exercito utilizando o codigo MCNPX e comparacao com espectros de energia do Cesio 137 levantados em laboratorio

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, Renato G.; Rebello, Wilson F.; Cavaliere, Marcos Paulo; Vellozo, Sergio O.; Moreira Junior, Luis, E-mail: renatoguedes@ime.eb.br, E-mail: rebello@ime.eb.br, E-mail: eng.cavaliere@gmail.com, E-mail: vellozo@cbpf.br, E-mail: luisjrmoreira@hotmail.com [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil); Vital, Helio C., E-mail: vital@ctex.eb.br [Centro Tecnologico do Exercito (CTEX), Barra de Guaratiba, RJ (Brazil); Silva, Ademir X., E-mail: ademir@con.ufrj.br [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    Using the MCNPX code, the objective was to calculate by means of computer simulation spectroscopy range inside the irradiation chamber upper radiator gamma research irradiating facility Army Technology Center (CTEx). The calculations were performed in the spectral range usual 2 points for research purposes irradiating the energy spectra of gamma rays from the source of Cesium chloride 137. Sought the discretization of the spectrum in 100 channels at points of upper bound of 1cm higher and lower dose rates previously known. It was also conducted in the laboratory lifting the spectrum of Cesium-137 source using NaI scintillator detector and multichannel analyzer. With the source spectrum Cesium-137 contained in the literature and raised in the laboratory, both used as reference for comparison and analysis in terms of probability of emission maximum of 0.661 MeV The spectra were quite consistent in terms of the behavior of the energy distributions with scores. The position of maximum dose rate showed absorption detection almost maximum energy of 0.661 MeV photopeak In the spectrum of the position of minimum dosage rate, it was found that due to the removal of the source point of interest, some loss detection were caused by Compton scattering. (author)

  17. Mars at Ls 137o

    Science.gov (United States)

    2006-01-01

    13 November 2006 These images capture what Mars typically looks like in mid-afternoon at Ls 137o. In other words, with the exception of occasional differences in weather and polar frost patterns, this is what the red planet looks like this month (November 2006). Six views are shown, including the two polar regions. These are composites of 24-26 Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) daily global mapping images acquired at red and blue wavelengths. The 'hole' over the south pole is an area where no images were obtained, because this polar region is enveloped in wintertime darkness. Presently, it is summer in the northern hemisphere and winter in the southern hemisphere. Ls, solar longitude, is a measure of the time of year on Mars. Mars travels 360o around the Sun in 1 Mars year. The year begins at Ls 0o, the start of northern spring and southern autumn. Northern summer/southern winter begins at Ls 90o, northern autumn/southern spring start at Ls 180o, and northern winter/southern summer begin at Ls 270o. Ls 137o occurs in the middle of this month (November 2006). The pictures show how Mars appeared to the MOC wide angle cameras at a previous Ls 137o in March 2001. The six views are centered on the Tharsis region (upper left), Acidalia and Mare Eyrthraeum (upper right), Syrtis Major and Hellas (middle left), Elysium and Mare Cimmeria (middle right), the north pole (lower left), and the south pole (lower right).

  18. Biodistribution of (137)Cs in a mouse model of chronic contamination by ingestion and effects on the hematopoietic system.

    Science.gov (United States)

    Bertho, Jean-Marc; Louiba, Sonia; Faure, Marie-Cécile; Tourlonias, Elie; Stefani, Johanna; Siffert, Baptiste; Paquet, François; Dublineau, Isabelle

    2010-05-01

    The aim of this work was to define the possible occurrence of hematological changes during the course of a chronic ingestion of (137)Cs. A mouse model was used, with ingestion through drinking water with a cesium concentration of 20 kBq l(-1). Ingestion started in parent animals before mating, and (137)Cs intake and its effect on the hematopoietic system was studied in offspring at various ages between birth and 20 weeks. (137)Cs content was measured in various organs, indicating that (137)Cs was distributed throughout the organism including lympho-hematopoietic organs, i.e., femurs, spleen and thymus. However, we did not observe any effect on the hematopoietic system, whatever the parameter used. In fact, blood cell counts, mononuclear cell counts and progenitor frequency in bone marrow and spleen, and Flt3-ligand, Erythropoietin, G-CSF and SDF-1 concentration in plasma remained unchanged when compared to control animals. Moreover, phenotypic analysis did not show any change in the proportions of bone marrow cell populations. These results indicate that, although (137)Cs was found in all organs implicated in the hematopoietic system, this did not induce any changes in bone marrow function.

  19. Continuing 137 Cs release to the sea from the Fukushima Dai-ichi Nuclear Power Plant through 2012

    Directory of Open Access Journals (Sweden)

    J. Kanda

    2013-09-01

    Full Text Available The rate of cesium-137 (137Cs release to the sea from the Fukushima Dai-ichi Nuclear Power Plant for the period until September 2012 was estimated. Publicly released data on 137Cs radioactivity in seawater near the power plant by Tokyo Electric Power Company strongly suggest a continuing release of radionuclides to the sea. The plant has an artificial harbour facility, and the exchange rate of harbour water with surrounding seawater was estimated by the decrease in radioactivity immediately after an intense radioactive water release. The estimated exchange rate of water in the harbour was 0.44 d−1 during the period from 6 to 19 April. The 137Cs radioactivity in the harbour water was substantially higher than that of seawater outside and remained relatively stable after June 2011. A quasi-steady state was assumed with continuous water exchange, and the average release rate of 137Cs was estimated to be 93 GBq d−1 in summer 2011 and 8.1 GBq d−1 in summer 2012.

  20. Assessment of wind characteristics and atmospheric dispersion modeling of {sup 137}Cs on the Barakah NPP area in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong Kuk; Lee, Kun Jai; Yun, Jong IL [Dept. of Nuclear and Quantum Engineering, Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Kim, Jae Chul; Belorid, Miloslav [Institute of Environmental Research, Chuncheon (Korea, Republic of); Beeley, Philip A. [Khalifa University of Science, Technology and Research, Dubai (Antigua and Barbuda)

    2014-08-15

    This paper presents the results of an analysis of wind characteristics and atmosphere dispersion modeling that are based on computational simulation and part of a preliminary study evaluating environmental radiation monitoring system (ERMS) positions within the Barakah nuclear power plant (BNPP). The return period of extreme wind speed was estimated using the Weibull distribution over the life time of the BNPP. In the annual meteorological modeling, the winds from the north and west accounted for more than 90 % of the wind directions. Seasonal effects were not represented. However, a discrepancy in the tendency between daytime and nighttime was observed. Six variations of cesium-137 ({sup 137}Cs) dispersion test were simulated under severe accident condition. The {sup 137}Cs dispersion was strongly influenced by the direction and speed of the main wind. A virtual receptor was set and calculated for observation of the {sup 137}Cs movement and accumulation. The results of the surface roughness effect demonstrated that the deposition of {sup 137}Cs was affected by surface condition. The results of these studies offer useful information for developing environmental radiation monitoring systems (ERMSs) for the BNPP and can be used to assess the environmental effects of new nuclear power plant.

  1. Continuing 137Cs release to the sea from the Fukushima Dai-ichi Nuclear Power Plant through 2012

    Directory of Open Access Journals (Sweden)

    J. Kanda

    2013-02-01

    Full Text Available Rate of cesium-137 (137Cs release to the sea from the Fukushima Dai-ichi Nuclear Power Plant was estimated until September 2012. Based on publicly released data of 137Cs in seawater near the power plant by Tokyo Electric Power Company, a continuing release of radionuclides to the sea is strongly suggested. The plant has an artificial harbour facility, and the exchange rate of harbour water with surrounding seawater was estimated by decrease of radioactivity immediately after an intense event of radioactive water release. The estimated exchange rate of water in the harbour is 0.44 day−1 during the period from 6 to 19 April 2011. 137Cs radioactivity of the harbour water is substantially higher than seawater outside and remained relatively stable after June 2011. A quasi-steady state was assumed with continuous water exchange, and an average release rate of 137Cs was estimated to be 93 GBq day−1 in summer 2011 and 8.1 GBq day−1 in summer 2012.

  2. Dermatological consequences of the Cs-137 radiological accident in Goiania, Goias State, Brazil; Repercussoes dermatologicas no acidente radioativo com o Cesio 137 em Goiania

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Lia Candida Miranda de

    1996-07-01

    The objective of the present study was to analyse the occurrence of dermatosis in individuals that had been exposed to cesium{sup 137} during the radioactive accident in Goiania, in 1987 and detect pre-cancerous dermatosis or those predictive of low immunity. The groups were evaluated according to the intensity of radiation they had been exposed to and then compared to a control group of people not exposed to radiation. The population exposed to the cesium{sup 137} was comprised of 109 people, who were divided into Groups I and II, according to the CNEN norms. In group I, 54 people with {<=} 20 rads exposure and/or radio lesion were included; in group II, 55 people with > 20 rads exposure were included, along with the children of group I individuals. This was a historic cohort study, that is, a retrospective study that lasted 9 years, extending from September of 1987 to August, 1996. The presence of the oncoprotein p-53 was studied in the radio lesions of 10 patients. There is no evidence of an increase in the incidence of dermatosis in the exposed groups, excepts for pyoderma in patients with radio lesions. The most frequent dermatosis were: pyoderma, pityriasis versicolor, scabies, dermatophytosis and seborrhoeic dermatitis. The results obtained were not statistically significant for the evaluation of dermatosis predictive of low immunity or precancerous lesions. The oncoprotein p-53 in individuals with radio lesion showed a 80% positivity rate and risk factor estimated in 8 times, for the test. It has proved to be useful because it represents one more option in terms of propaedeutic evaluation and suggests that one should pay close and continuous attention in order to better control the evolution of these individuals. (author)

  3. Seaweed against strontium and preussian blue against cesium

    Directory of Open Access Journals (Sweden)

    G Michanek

    1988-06-01

    Full Text Available The fact that alginates bind strontium and cyanates bind cesium and are capable of removing these elements from living organisms is scientifically verified. Zeolites offer another possibility for exchange of these ions. Practical research should be initiated to find the right doses and procedure to decrease the body burden of radioactive isotopes in reindeer.Alger mot strontium och berlinerblått mot cesium.Abstract in Swedish / Sammanfattning: Mitt budskap år kort: Alger binder strontium, Berlinerblått binder cesium, Sätt fart på forskning och forsök!

  4. Immobilization of cesium in alkaline activated fly ash matrix

    Science.gov (United States)

    Fernandez-Jimenez, A.; Macphee, D. E.; Lachowski, E. E.; Palomo, A.

    2005-11-01

    The immobilization potential of alkaline activated fly ash (AAFA) matrices for cesium has been investigated. The presence of Cs in the AAFA pastes, prepared using 8M NaOH solution as activator, showed no significant adverse effects on mechanical strength or microstructure, nor were significant quantities of Cs leached following application of the Toxic Characteristic Leaching Procedure (TCLP) and American Nuclear Society (ANS) 16.1 leaching protocols. Microstructural analysis shows Cs associated with the main reaction product in the AAFA suggesting that cesium is chemically bound rather than physically encapsulated. It is proposed that cesium is incorporated into the alkaline aluminosilicate gel, a precursor for zeolite formation.

  5. Biological half-life of radioactive cesium in Japanese rockfish Sebastes cheni contaminated by the Fukushima Daiichi nuclear power plant accident.

    Science.gov (United States)

    Matsumoto, Akira; Shigeoka, Yu; Arakawa, Hisayuki; Hirakawa, Naoto; Morioka, Yoshiaki; Mizuno, Takuji

    2015-12-01

    Since the Fukushima accident in March 2011 the concentration of radioactive cesium in Japanese rockfish (Sebastes cheni) has been decreasing slower than other fish species. The aim of this study was therefore to investigate the possibility of slow elimination rate (i.e., relatively longer Tb) as one of the reasons for the slow decrease in (137)Cs concentrations in Japanese rockfish (S. cheni). To do this, we reared twenty-three individuals of this species for a period of about 1 year, during which time we measured the (137)Cs concentrations and γ-ray spectra 14 times by using a high-efficiency NaI(Tl) scintillator. We then examined the relationship between the (137)Cs concentrations and the total length of each individual. We estimated the biological half-life (Tb, day) for each individual using the total number of (137)Cs counts in the energy region, and examined the effects of total length and (137)Cs concentration on Tb by generalized linear model (GLM). We also examined the effect of sex, total length, seawater temperature, and the (137)Cs concentration of seawater on temporal changes in the (137)Cs count reduction rate by GLM. There was no clear relationship between the corrected whole-body (137)Cs concentrations and the total length in females, however there was a significant positive correlation between these two variables in males. The difference between males and females may be attributable to variation in the degree of dilution because of variable growth of individuals, and suggests that the (137)Cs concentrations of small individuals may be greatly diluted because of faster growth. However, there was no significant difference in Tb between sexes. The mean Tb (±SD) in all individuals was 269 (±39) days; this Tb value is 2.7-5.4 times longer than past Tb values (marine fish: 50-100 days), and is thought to be one of the reasons for the slower decrease in (137)Cs concentrations in this species than other fish species on the coast of Fukushima. The GLM

  6. Atmospheric transmission for cesium DPAL using TDLAS

    Science.gov (United States)

    Rice, Christopher A.; Perram, Glen P.

    2012-03-01

    The cesium (Cs) Diode Pumped Alkali Laser (DPAL) operates near 894 nm, in the vicinity of atmospheric water vapor absorption lines. An open-path Tunable Diode Laser Absorption (TDLAS) system composed of narrow band (~300 kHz) diode laser fiber coupled to a 12" Ritchey-Chrétien transmit telescope has been used to study the atmospheric transmission characteristics of Cs DPALs over extended paths. The ruggedized system has been field deployed and tested for propagation distances of greater than 1 km. By scanning the diode laser across many free spectral ranges, many rotational absorption features are observed. Absolute laser frequency is monitored with a High Finesse wavemeter to an accuracy of less than 10 MHz. Phase sensitive detection is employed with an absorbance of less than 1% observable under field conditions.

  7. Dicty_cDB: SLA137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA137 (Link to dictyBase) - - - Contig-U16449-1 SLA137Z (Link... to Original site) - - SLA137Z 491 - - - - Show SLA137 Library SL (Link to library) Clone ID SLA137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA1-B/SLA137Q.Seq.d/ Representative seq. ID SLA13...7Z (Link to Original site) Representative DNA sequence >SLA137 (SLA137Q) /CSM/SL/SLA1-B/SLA137Q.Seq.d/ XXXXX...ATAAAAAAAAAAAAAAAA sequence update 1997. 5. 8 Translated Amino Acid sequence ---AWVDENGGGTMIPVSVSFEKALLDLSSD

  8. Dicty_cDB: VSI137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSI137 (Link to dictyBase) - - - - VSI137P (Link to Original site) VSI137F 60 VSI...dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSI...1-B/VSI137Q.Seq.d/ Representative seq. ID VSI137P (Link to Original si...flsnhfkkk--- ---ymq Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSI137 (VSI...137Z 12 VSI137P 72 - - Show VSI137 Library VS (Link to library) Clone ID VSI137 (Link to

  9. Low-work-function surfaces produced by cesium carbonate decomposition

    Science.gov (United States)

    Briere, T. R.; Sommer, A. H.

    1977-01-01

    Cesium carbonate (Cs2CO3) was heated to the decomposition temperature of approximately 600 C. The nonvolatile decomposition products were condensed on a nickel substrate while the carbon dioxide was removed by pumping. The deposited material is characterized by an effective work function of between 1.05 and 1.15 eV at 450 K and by photoemission in the visible and near-infrared region of the spectrum. It is suggested that the deposited material consists of Cs2O, possibly Cs2O2, and adsorbed cesium. Silver, evaporated from a heated silver bead, produced the typical photoemissive and thermionic properties of a silver-oxygen-cesium (S-1) photocathode. The material may be of interest for thermionic energy converters and for the formation of silver-oxygen-cesium photocathodes.

  10. 129I and 137Cs in groundwater in the vicinity of Fukushima Dai-ichi nuclear power plant

    DEFF Research Database (Denmark)

    Xu, Sheng; Zhang, Luyuan; Freeman, Stewart P.H.T.;

    2016-01-01

    This paper reports iodine (127I and 129I) and cesium (137Cs) isotope concentrations in groundwater of confined and unconfined aquifers in the vicinity of the Fukushima Dai-ichi nuclear power plant (FDNPP). 127I and 129I concentrations range from 2–13 μg/L and 5 × 107–8 × 1010 atom/L respectively......, resulting in 129I/127I atomic ratios from 5 × 10–9 to 2 × 10–6. In all samples, 137Cs concentrations were below detection limit. The deep-sealed groundwater from the confined aquifer did not contain significant quantities of Fukushima-derived 129I compared to the groundwater in the unconfined aquifer...

  11. Direct Grout Stabilization of High Cesium Salt Waste: Salt Alternative Phase III Feasibility Study

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C.A.

    1998-12-07

    The direct grout alternative is a viable option for treatment/stabilization and disposal of salt waste containing Cs-137 concentrations of 1-3 Ci/gal. The composition of the direct grout salt solution is higher in sodium salts and contains up to a few hundred ppm Cs-137 more than the current reference salt solution. However it is still similar to the composition of the current reference salt solution. Consequently, the processing, setting, and leaching properties (including TCLP for Cr and Hg) of the direct grout and current saltstone waste forms are very similar. The significant difference between these waste solutions is that the high cesium salt solution will contain between 1 and 3 Curies of Cs-137 per gallon compared to a negligible amount in the current salt solution. This difference will require special engineering and shielding for a direct grout processing facility and disposal units to achieve acceptable radiation exposure conditions. The Cs-137 concentration in the direct grout salt solution will also affect the long-term curing temperature of the waste form since 4.84 Watts of energy are generated per 1000 Ci of Cs-137. The temperature rise of the direct grout during long-term curing has been calculated by A. Shaddy, SRTC.1 The effect of curing temperature on the strength, leaching and physical durability of the direct grout saltstone is described in this report. At the present time, long term curing at 90 degrees C appears to be unacceptable because of cracking which will affect the structural integrity as evaluated in the immersion test. (The experiments conducted in this feasibility study do not address the effect of cracking on leaching of contaminants other than Cr, Hg, and Cs.) No cracking of the direct grout or reference saltstone waste forms was observed for samples cured at 70 degrees C. At the present time the implications of waste form cracking at elevated curing temperatures has not been fully addressed. The direct grout falls within the

  12. Determination of concentration factors for Cs-137 and Ra-226 in the mullet species Chelon labrosus (Mugilidae) from the South Adriatic Sea.

    Science.gov (United States)

    Antovic, Ivanka; Antovic, Nevenka M

    2011-07-01

    Concentration factors for Cs-137 and Ra-226 transfer from seawater, and dried sediment or mud with detritus, have been determined for whole, fresh weight, Chelon labrosus individuals and selected organs. Cesium was detected in 5 of 22 fish individuals, and its activity ranged from 1.0 to 1.6 Bq kg(-1). Radium was detected in all fish, and ranged from 0.4 to 2.1 Bq kg(-1), with an arithmetic mean of 1.0 Bq kg(-1). In regards to fish organs, cesium activity concentration was highest in muscles (maximum - 3.7 Bq kg(-1)), while radium was highest in skeletons (maximum - 25 Bq kg(-1)). Among cesium concentration factors, those for muscles were the highest (from seawater - an average of 47, from sediment - an average of 3.3, from mud with detritus - an average of 0.8). Radium concentration factors were the highest for skeleton (from seawater - an average of 130, from sediment - an average of 1.8, from mud with detritus - an average of 1.5). Additionally, annual intake of cesium and radium by human adults consuming muscles of this fish species has been estimated to provide, in aggregate, an effective dose of about 4.1 μSv y(-1).

  13. Epiphytic fruticose lichens as biomonitors for retrospective evaluation of the (134)Cs/(137)Cs ratio in Fukushima fallout.

    Science.gov (United States)

    Ramzaev, V; Barkovsky, A; Gromov, A; Ivanov, S; Kaduka, M

    2014-12-01

    In 2011-2013, sampling of epiphytic fruticose lichens of the genera Usnea, Bryoria and Alectoria was carried out on Sakhalin and Kuril Islands (the Sakhalin region, Russia) to investigate contamination of these organisms with the Fukushima-derived (134)Cs and (137)Cs. Activities of the radionuclides were determined in all 56 samples of lichens taken for the analysis. After correction for radioactive decay (on 15 March 2011), the activity concentrations ranged from 2.1 Bq kg(-1) (d.w.) to 52 Bq kg(-1) for (134)Cs and from 2.3 Bq kg(-1) to 52 Bq kg(-1) for (137)Cs. Cesium-134 and (137)Cs activities for the whole set of lichens (n = 56) were strongly positively correlated; Spearman's rank correlation coefficient was calculated as 0.991 (P lichens from the Sakhalin and Kunashir islands declined with a factor of three in the period from 2011 to 2013. The average biological half-time for both cesium radionuclides in lichens of the genus Usnea is estimated as 1.3 y. The mean of 0.99 ± 0.10 and median of 0.99 were calculated for the decay corrected (134)Cs/(137)Cs activities ratios in the lichens (n = 56). The radionuclides ratio in the lichens did not depend on location of sampling site, species and the time that had passed after the Fukushima accident. The regression analysis has shown the background pre-Fukushima level of (137)Cs of 0.4 ± 0.3 Bq kg(-1), whereas the ratio between the Fukushima-borne (134)Cs and (137)Cs in the lichens was estimated as 1.04. The (134)Cs/(137)Cs activities ratio in lichens from the Sakhalin region is consistent with the ratios reported by others for the heavy contaminated areas on Honshu Island in Japan following the Fukushima accident. The activity concentrations of natural (7)Be in lichens from the Sakhalin region varied between 100 Bq kg(-1) and 600 Bq kg(-1); the activity concentrations did not exhibit temporal variations during a 2y-period of observations. The applicability of epiphytic fruticose lichens as

  14. 7 CFR 4279.137 - Financial statements.

    Science.gov (United States)

    2010-01-01

    ... § 4279.137 Financial statements. (a) The lender will determine the type and frequency of submission of financial statements by the borrower. At a minimum, annual financial statements prepared by an accountant in... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial statements. 4279.137 Section...

  15. 21 CFR 137.165 - Enriched flour.

    Science.gov (United States)

    2010-04-01

    ... riboflavin, 24 milligrams of niacin, 0.7 milligrams of folic acid, and 20 milligrams of iron. (b) It may... calcium or wheat germ is excluded in calculating ash content. (f) All ingredients from which the food is... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched flour. 137.165 Section 137.165 Food...

  16. Uptake and translocation of cesium-133 in napiergrass (Pennisetum purpureum Schum.) under hydroponic conditions.

    Science.gov (United States)

    Kang, Dong Jin; Seo, Young-Jin; Saito, Tsukasa; Suzuki, Hiroyuki; Ishii, Yasuyuki

    2012-08-01

    The present study reports the potential remediation of cesium (Cs) using napiergrass, which produces the largest biomass among the herbaceous plants in hydroponic culture containing stable Cs (Cs-133) at concentrations of 50, 150, 300, 1000, and 3,000 μM using cesium chloride (CsCl), with 0 μM Cs as a control concentration. Plant height was significantly decreased in higher Cs-treated conditions (300, 1000, and 3000 μM Cs) at 7 weeks after treatment (WAT), but tiller numbers tended to increase compared with the control plant. No significant difference was observed in the aboveground dry matter weight in all Cs treatments throughout the study period. Cs content in the roots, leaf blades, and leaf sheaths clearly increased with increasing Cs concentration in the solutions. Cs content in the aboveground parts (leaf blades and leaf sheaths) was consistently higher than in the roots at concentration of 3,000 μM. Total Cs contents in the aboveground parts were 6305 and 26,365 mg kg(-1) at 7WAT in 1000- and 3000-μM Cs treatments, respectively. Mean values of transfer factors (TFs) in the aboveground parts were 50 μM=0.78, 150 μM=1.02, 300 μM=0.86, 1,000 μM=0.68, and 3,000 μM=0.94, respectively at 7WAT. Due to its high Cs content and high TF in the aboveground parts, napiergrass may be a candidate plant with high potential for phytoremediation of Cs from Cs-137-contaminated soil.

  17. Dicty_cDB: SLE137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE137 (Link to dictyBase) - - - Contig-U15038-1 SLE137Z (Link... to Original site) - - SLE137Z 528 - - - - Show SLE137 Library SL (Link to library) Clone ID SLE137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLE1-B/SLE137Q.Seq.d/ Representative seq. ID SLE13...7Z (Link to Original site) Representative DNA sequence >SLE137 (SLE137Q) /CSM/SL/SLE1-B/SLE137Q.Seq.d/ XXXXX...40 (VSA140Q) /CSM/VS/VSA1-B/VSA140Q.Seq.d/ 1001 0.0 SLE137 (SLE137Q) /CSM/SL/SLE1-B/SLE137Q.Seq.d/ 1001 0.0

  18. Dicty_cDB: VSD137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSD137 (Link to dictyBase) - - - Contig-U12366-1 VSD137P (Link to Original site) VSD1...37F 304 VSD137Z 282 VSD137P 586 - - Show VSD137 Library VS (Link to library) Clone ID VSD1... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSD1-B/VSD137Q.Seq.d/ Representative seq. ID VSD1...37P (Link to Original site) Representative DNA sequence >VSD137 (VSD137Q) /CSM/VS/VSD1-B/VSD1...-151 VSE776 (VSE776Q) /CSM/VS/VSE7-D/VSE776Q.Seq.d/ 535 e-151 VSD137 (VSD137Q) /CSM/VS/VSD1-B/VSD137Q.Seq.d/

  19. Dicty_cDB: CHS137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS137 (Link to dictyBase) - - - Contig-U16475-1 - (Link to Original site) - - CHS13...7Z 598 - - - - Show CHS137 Library CH (Link to library) Clone ID CHS137 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHS1-B/CHS137Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHS137 (CHS137Q) /CSM/CH/CHS1-B/CHS137Q.Seq.d/ XXXXXXXXXXATGTGTA... wall 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for CHS137 is cyt

  20. Cesium-induced QT-interval prolongation in an adolescent.

    Science.gov (United States)

    O'Brien, Catherine E; Harik, Nada; James, Laura P; Seib, Paul M; Stowe, Cindy D

    2008-08-01

    Alternative medicine is becoming increasingly popular, especially with terminally ill patients. Most alternative remedies have not been adequately studied or proven effective for the diseases for which they are promoted. In the worst cases, these therapies are harmful. We describe a 16-year-old girl with metastatic hepatocellular carcinoma who experienced cesium-induced QT-interval prolongation after the start of a cesium chloride-based alternative treatment regimen. She had received seven courses of chemotherapy, with a cumulative doxorubicin dose of 500 mg/m(2) over 5 months, resulting in minimal tumor regression. Against the advice of her oncologist, she abandoned traditional therapy and started an alternative regimen that included cesium chloride supplements. Two weeks later, the patient went to a local emergency department after experiencing two brief syncopal episodes. An electrocardiogram revealed occasional premature ventricular contractions, a QTc interval of 683 msec (normal range for females 450-460 msec), and R on T phenomenon. She was admitted to the hospital and later experienced monomorphic ventricular tachycardia, which resolved spontaneously. Lidocaine therapy was started, and the patient was transferred to a cardiac intensive care unit at our hospital. Her plasma cesium level was 2400 microg/dl (normal cesium level was 1800 microg/dl, and her QTc interval was 494 msec. According to the Naranjo adverse drug reaction probability scale, cesium was the probable cause of the patient's arrhythmia. In animal models, cesium chloride has induced cardiac arrhythmias, including torsade de pointes. It inhibits delayed rectifier potassium channels in the myocardium, causing delayed repolarization and QT-interval prolongation. Patients with cancer should be aware that alternative remedies may be harmful and ineffective. Because patients may be unlikely to self-report alternative remedies, health care providers should specifically ask their patients about any

  1. Effect of Potassium on Uptake of 137Cs in Food Crops Grown on Coral Soils: Annual Crops at Bikini Atoll

    Energy Technology Data Exchange (ETDEWEB)

    Stone, E R; Robinson, W

    2002-02-01

    In 1954 a radioactive plume from the thermonuclear device code named BRAVO contaminated the principal residential islands, Eneu and Bikini, of Bikini Atoll (11{sup o} 36 minutes N; 165{sup o} 22 minutes E), now part of the Republic of the Marshall Islands. The resulting soil radioactivity diminished greatly over the three decades before the studies discussed below began. By that time the shorter-lived isotopes had all but disappeared, but strontium-90 ({sup 90}Sr), and cesium-137, ({sup 137}Cs) were reduced by only one half-life. Minute amounts of the long-lived isotopes, plutonium-239+240 ({sup 239+240}Pu) and americium-241 ({sup 241}Am), were present in soil, but were found to be inconsequential in the food chain of humans and land animals. Rather, extensive studies demonstrated that the major concern for human health was {sup 137}Cs in the terrestrial food chain (Robison et al., 1983; Robison et al., 1997). The following papers document results from several studies between 1986 and 1997 aimed at minimizing the {sup 137}Cs content of annual food crops. The existing literature on radiocesium in soils and plant uptake is largely a consequence of two events: the worldwide fallout of 1952-58, and the fallout from Chernobyl. The resulting studies have, for the most part, dealt either with soils containing some amount of silicate clays and often with appreciable K, or with the short-term development of plants in nutrient cultures.

  2. Cesium toxicity: a case of self-treatment by alternate therapy gone awry.

    Science.gov (United States)

    Lyon, Andrew W; Mayhew, William J

    2003-02-01

    Cesium salts have been used in animal models to induce cardiac arrhythmias for several decades, but the sequelae of human cesium toxicity have seldom been described. The authors describe a case of cesium toxicity manifested by syncope, polymorphic ventricular tachycardia, hypokalemia, and a QT interval prolonged to 650 milliseconds that resolved over 4 days following withdrawal of cesium. The patient had a 2-year history of colon cancer and had self-treated with cesium chloride, 3 g/d, for several weeks, using cesium as a form of alternate therapy for cancer. The authors describe the pathophysiologic correlates and risks of cesium consumption and conclude that cesium toxicity should be considered among the differential diagnoses of prolonged QT interval.

  3. A novel role for methyl cysteinate, a cysteine derivative, in cesium accumulation in Arabidopsis thaliana

    Science.gov (United States)

    Adams, Eri; Miyazaki, Takae; Hayaishi-Satoh, Aya; Han, Minwoo; Kusano, Miyako; Khandelia, Himanshu; Saito, Kazuki; Shin, Ryoung

    2017-01-01

    Phytoaccumulation is a technique to extract metals from soil utilising ability of plants. Cesium is a valuable metal while radioactive isotopes of cesium can be hazardous. In order to establish a more efficient phytoaccumulation system, small molecules which promote plants to accumulate cesium were investigated. Through chemical library screening, 14 chemicals were isolated as ‘cesium accumulators’ in Arabidopsis thaliana. Of those, methyl cysteinate, a derivative of cysteine, was found to function within the plant to accumulate externally supplemented cesium. Moreover, metabolite profiling demonstrated that cesium treatment increased cysteine levels in Arabidopsis. The cesium accumulation effect was not observed for other cysteine derivatives or amino acids on the cysteine metabolic pathway tested. Our results suggest that methyl cysteinate, potentially metabolised from cysteine, binds with cesium on the surface of the roots or inside plant cells and improve phytoaccumulation. PMID:28230101

  4. Evaluation of ambient dose equivalent rates influenced by vertical and horizontal distribution of radioactive cesium in soil in Fukushima Prefecture

    CERN Document Server

    Malins, Alex; Nakama, Shigeo; Saito, Tatsuo; Okumura, Masahiko; Machida, Masahiko; Kitamura, Akihiro

    2016-01-01

    The air dose rate in an environment contaminated with 134Cs and 137Cs depends on the amount, depth profile and horizontal distribution of these contaminants within the ground. This paper introduces and verifies a tool that models these variables and calculates ambient dose equivalent rates at 1 m above the ground. Good correlation is found between predicted dose rates and dose rates measured with survey meters in Fukushima Prefecture in areas contaminated with radiocesium from the Fukushima Dai-ichi Nuclear Power Plant accident. This finding is insensitive to the choice for modelling the activity depth distribution in the ground using activity measurements of collected soil layers, or by using exponential and hyperbolic secant fits to the measurement data. Better predictions are obtained by modelling the horizontal distribution of radioactive cesium across an area if multiple soil samples are available, as opposed to assuming a spatially homogeneous contamination distribution. Reductions seen in air dose rate...

  5. Oak Ridge Reservation Volume 2. Records relating to cesium at the K-25 Plant: A guide to record series of the Department of Energy and its contractors

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-02-21

    The purpose of this guide is to describe the documents and record series at the K-25 plant that pertain to the handling of waste containing cesium-137 produced as a result of processes to enrich uranium and separate plutonium at the Department of Energy`s (DOE) Oak Ridge National Laboratory (ORNL) and Oak Ride Gaseous Diffusion Plant (ORGDP, called K-25) in Oak Ridge, Tennessee. History Associates Incorporated (HAI) prepared this guide as part of DOE`s Epidemiologic Records Inventory Project, the purpose of which is to verify and conduct inventories of epidemiologic and health-related records at various DOE and DOE contractor sites. This introduction briefly describes the Epidemiologic Records Inventory Project and HAI`s role in it. Specific attention is given to the history of the DOE-Oak Ridge Reservation, the history and development of the K-25 plant, the creation and handling of cesium-contaminated waste, and environmental monitoring efforts at ORNL and K-25 from the late 1940s to the present. This introduction also presents the methodology used to identify the documents and series pertaining to cesium, a discussion of the inventory of these documents, information concerning access to the site and the records, and a description of the arrangement of the chapters.

  6. Potential value of Cs-137 capsules

    Energy Technology Data Exchange (ETDEWEB)

    Bloomster, C.H.; Brown, D.R.; Bruno, G.A.; Hazelton, R.F.; Hendrickson, P.L.; Lezberg, A.J.; Tingey, G.L.; Wilfert, G.L.

    1985-04-01

    We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions.

  7. Evaluation of ambient dose equivalent rates influenced by vertical and horizontal distribution of radioactive cesium in soil in Fukushima Prefecture.

    Science.gov (United States)

    Malins, Alex; Kurikami, Hiroshi; Nakama, Shigeo; Saito, Tatsuo; Okumura, Masahiko; Machida, Masahiko; Kitamura, Akihiro

    2016-01-01

    The air dose rate in an environment contaminated with (134)Cs and (137)Cs depends on the amount, depth profile and horizontal distribution of these contaminants within the ground. This paper introduces and verifies a tool that models these variables and calculates ambient dose equivalent rates at 1 m above the ground. Good correlation is found between predicted dose rates and dose rates measured with survey meters in Fukushima Prefecture in areas contaminated with radiocesium from the Fukushima Dai-ichi Nuclear Power Plant accident. This finding is insensitive to the choice for modeling the activity depth distribution in the ground using activity measurements of collected soil layers, or by using exponential and hyperbolic secant fits to the measurement data. Better predictions are obtained by modeling the horizontal distribution of radioactive cesium across an area if multiple soil samples are available, as opposed to assuming a spatially homogeneous contamination distribution. Reductions seen in air dose rates above flat, undisturbed fields in Fukushima Prefecture are consistent with decrement by radioactive decay and downward migration of cesium into soil. Analysis of remediation strategies for farmland soils confirmed that topsoil removal and interchanging a topsoil layer with a subsoil layer result in similar reductions in the air dose rate. These two strategies are more effective than reverse tillage to invert and mix the topsoil.

  8. Ion microscopy based on laser-cooled cesium atoms

    Energy Technology Data Exchange (ETDEWEB)

    Viteau, M.; Reveillard, M.; Kime, L.; Rasser, B.; Sudraud, P. [Orsay Physics, TESCAN Orsay, 95 Avenue des Monts Auréliens – ZA Saint-Charles – 13710 Fuveau (France); Bruneau, Y.; Khalili, G.; Pillet, P.; Comparat, D. [Laboratoire Aimé Cotton, CNRS, Université Paris-Sud, ENS Cachan, Bât. 505, 91405 Orsay (France); Guerri, I. [Dipartimento di Fisica, Università di Pisa, Largo Pontecorvo 3, 56127 Pisa (Italy); Fioretti, A., E-mail: andrea.fioretti@ino.it [Istituto Nazionale di Ottica, INO-CNR, U.O.S. ”Adriano Gozzini”, via Moruzzi 1, 56124 Pisa (Italy); Consorzio Nazionale Interuniversitario per le Scienze Fisiche della Materia, CNISM, Sezione di Pisa, 56127 Pisa (Italy); Ciampini, D.; Allegrini, M.; Fuso, F. [Dipartimento di Fisica, Università di Pisa, Largo Pontecorvo 3, 56127 Pisa (Italy); Istituto Nazionale di Ottica, INO-CNR, U.O.S. ”Adriano Gozzini”, via Moruzzi 1, 56124 Pisa (Italy); Consorzio Nazionale Interuniversitario per le Scienze Fisiche della Materia, CNISM, Sezione di Pisa, 56127 Pisa (Italy)

    2016-05-15

    We demonstrate a prototype of a Focused Ion Beam machine based on the ionization of a laser-cooled cesium beam and adapted for imaging and modifying different surfaces in the few-tens nanometer range. Efficient atomic ionization is obtained by laser promoting ground-state atoms into a target excited Rydberg state, then field-ionizing them in an electric field gradient. The method allows obtaining ion currents up to 130 pA. Comparison with the standard direct photo-ionization of the atomic beam shows, in our conditions, a 40-times larger ion yield. Preliminary imaging results at ion energies in the 1–5 keV range are obtained with a resolution around 40 nm, in the present version of the prototype. Our ion beam is expected to be extremely monochromatic, with an energy spread of the order of the eV, offering great prospects for lithography, imaging and surface analysis. - Highlights: • We realize a Focused Ion Beam with an ionic source based on laser cooled cesium atoms. • Ionization involves excitation of the laser cooled atoms to Rydberg states. • We use the cesium FIB system to image different materials. • We use the cesium FIB to produce permanent modifications on surfaces. • In the present configuration, the focused probe size of the cesium FIB prototype is about 300 nm for beam energies in the 2–5 keV range.

  9. Solvent-free synthesis and application of nano-Fe/Ca/CaO/[PO{sub 4}] composite for dual separation and immobilization of stable and radioactive cesium in contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Mallampati, Srinivasa Reddy, E-mail: srireddys@ulsan.ac.kr [Department of Civil and Environmental Engineering, University of Ulsan, Daehak-ro 93, Nam-gu, Ulsan 680-749 (Korea, Republic of); Mitoma, Yoshiharu, E-mail: mitomay@pu-hiroshima.ac.jp [Department of Environmental Sciences, Faculty of Life and Environmental Sciences, Prefectural University of Hiroshima, 562 Nanatsuka-Cho Shobara City, Hiroshima 727-0023 (Japan); Okuda, Tetsuji [Environmental Research and Management Center, Hiroshima University, 1-5-3 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8513 (Japan); Simion, Cristian [Politehnica University of Bucharest, Department of Organic Chemistry, Bucharest 060042 (Romania); Lee, Byeong Kyu [Department of Civil and Environmental Engineering, University of Ulsan, Daehak-ro 93, Nam-gu, Ulsan 680-749 (Korea, Republic of)

    2015-10-30

    Graphical abstract: A possible pathway for immobilization with the nano-Fe/Ca/CaO/[PO{sub 4}] treatment (a) {sup 133}Cs is adsorbed onto the soil particles, (b) Cs encapsulation through the formation of immobile salts, and (c) solid (small/finer or larger/aggregate) soil fraction separation. - Highlights: • Nano-Fe/Ca/CaO/[PO{sub 4}] composite for Cs immobilization in soil was developed. • Enhanced cesium separation and immobilization was done in dry condition. • By SEM analysis the amount of cesium detectable on soil particle surface decreases. • Leachable cesium concentrations reduced, lower than the standard regulatory limit. • Nano-Fe/Ca/CaO/[PO{sub 4}] a highly potential amendment for the remediation of Cs. - Abstract: This study assessed the synthesis and application of nano-Fe/Ca/CaO-based composite material for use as a separation and immobilizing treatment of dry soil contaminated by stable ({sup 133}Cs) and radioactive cesium species ({sup 134}Cs and {sup 137}Cs). After grinding with nano-Fe/CaO, nano-Fe/Ca/CaO, and nano-Fe/Ca/CaO/[PO{sub 4}], approximately 31, 25, and 22 wt% of magnetic fraction soil was separated. Their resultant {sup 133}Cs immobilization values were about 78, 81, and 100%, respectively. When real radioactive cesium contaminated soil obtained from Fukushima was treated with nano-Fe/Ca/CaO/[PO{sub 4}], approximately 27.3 wt% of magnetic and 72.75% of non-magnetic soil fractions were separated. The highest amount of entrapped {sup 134}Cs and {sup 137}Cs was found in the lowest weight of the magnetically separated soil fraction (i.e., 80% in 27.3% of treated soil). Results show that {sup 134}Cs and {sup 137}Cs either in the magnetic or non-magnetic soil fractions was 100% immobilized. The morphology and mineral phases of the nano-Fe/Ca/CaO/[PO{sub 4}] treated soil were characterized using SEM–EDS, EPMA, and XRD analysis. The EPMA and XRD patterns indicate that the main fraction of enclosed/bound materials on treated soil

  10. Studies on soil to grass transfer factor (Fv) and grass to milk transfer coefficient (Fm) for cesium in Kaiga region.

    Science.gov (United States)

    Karunakara, N; Ujwal, P; Yashodhara, I; Rao, Chetan; Sudeep Kumara, K; Dileep, B N; Ravi, P M

    2013-10-01

    Detailed studies were carried out to establish site-specific soil to grass transfer factors (Fv) and grass to cow milk transfer coefficients (Fm) for radioactive cesium ((137)Cs) and stable cesium (Cs) for Kaiga region, where a nuclear power station has been in operation for more than 10 years. The study included adopted cows, cows of local farmers, and cows from the dairy farm. A grass field was developed specifically for the study and 2 local breed cows were adopted and allowed to graze in this grass field. The soil and grass samples were collected regularly from this field and analyzed for the concentrations of (137)Cs and stable Cs to evaluate the soil to grass Fv values. The milk samples from the adopted cows were analyzed for the (137)Cs and stable Cs concentrations to evaluate Fm values. For comparison, studies were also carried out in dominant grazing areas in different villages around the nuclear power plant and the cows of local farmers which graze in these areas were identified and milk samples were collected and analyzed regularly. The geometric mean values of Fv were found to be 1.1 × 10(-1) and 1.8 × 10(-1) for (137)Cs and stable Cs, respectively. The Fm of (137)Cs had geometric mean values of 1.9 × 10(-2) d L(-1) and 4.6 × 10(-2) d L(-1), respectively, for adopted Cows 1 and 2; 1.7 × 10(-2) d L(-1) for the cows of local farmers, and 4.0 × 10(-3) d L(-1) for the dairy farm cows. The geometric mean values of Fm for stable Cs were similar to those of (137)Cs. The Fm value for the dairy farm cows was an order of magnitude lower than those for local breed cows. The Fm values observed for the local breed cows were also an order of magnitude higher when compared to the many values reported in the literature and in the IAEA publication. Possible reasons for this higher Fm values were identified. The correlation between Fv and Fm values for (137)Cs and stable Cs and their dependence on the potassium content ((40)K and stable K) in

  11. Applications of cesium in the perovskite solar cells

    Science.gov (United States)

    Ye, Fengjun; Yang, Wenqiang; Luo, Deying; Zhu, Rui; Gong, Qihuang

    2017-01-01

    Perovskite solar cells have experienced an unprecedented rapid development in the power conversion efficiency (PCE) during the past 7 years, and the record PCE has been already comparable to the traditional polycrystalline silicon solar cells. Presently, it is more urgent to address the challenge on device stability for the future commercial application. Recently, the inorganic cesium lead halide perovskite has been intensively studied as one of the alternative candidates to improve device stability through controlling the phase transition. The cesium (Cs)-doped perovskites show more superior stability comparing with organic methylammonium (MA) lead halide perovskite or formamidinium (FA) lead halide perovskite. Here, recent progress of the inorganic cesium application in organic–inorganic perovskite solar cells (PSCs) is highlighted from the viewpoints of the device efficiency and the device stability. Project supported by the 973 Program of China (No. 2015CB932203), the National Natural Science Foundation of China (Nos. 61377025, 91433203), and the Young 1000 Talents Global Recruitment Program of China.

  12. Controllable evaporation of cesium from a dispenser oven

    Science.gov (United States)

    Fantz, U.; Friedl, R.; Fröschle, M.

    2012-12-01

    This instrument allows controlled evaporation of the alkali metal cesium over a wide range of evaporation rates. The oven has three unique features. The first is an alkali metal reservoir that uses a dispenser as a cesium source. The heating current of the dispenser controls the evaporation rate allowing generation of an adjustable and stable flow of pure cesium. The second is a blocking valve, which is fully metallic as is the body of the oven. This construction both reduces contamination of the dispenser and enables the oven to be operated up to 300 °C, with only small temperature variations (metal at a cold spot is significantly hindered. The last feature is an integral surface ionization detector for measuring and controlling the evaporation rate. The dispenser oven can be easily transferred to the other alkali-metals.

  13. Standardization of 137mCs+137mBa by Liquid Scintillation; Calibracion de 137Cs+137mBa por Centelleo Liquido

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, L.; Los Arcos, J.M.; Grau, A.

    1995-07-01

    A procedure for the preparation of a stable, homogeneous solution of 137Cs+''137mBa, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51 % (k=l). (Author) 5 refs.

  14. Role of mesoscale eddies in transport of Fukushima-derived cesium isotopes in the ocean

    Science.gov (United States)

    Budyansky, M. V.; Goryachev, V. A.; Kaplunenko, D. D.; Lobanov, V. B.; Prants, S. V.; Sergeev, A. F.; Shlyk, N. V.; Uleysky, M. Yu.

    2015-02-01

    We present the results of in situ measurements of 134Cs and 137Cs released from the Fukushima Nuclear Power Plant (FNPP) collected at surface and different depths in the western North Pacific in June and July 2012. It was found that 15 month after the incident concentrations of radiocesium in the Japan and Okhotsk seas were at background or slightly increased level, while they had increased values in the subarctic front area east of Japan. The highest concentrations of 134Cs and 137Cs up to 13.5±0.9 and 22.7±1.5 Bq m-3 have been found to exceed ten times the background levels before the accident. Maximal content of radiocesium was observed within subsurface and intermediate water layers inside the cores of anticyclonic eddies (100-500 m). Even slightly increased content of radiocesium was found at some eddies at depth of 1000 m. It is expected that convergence and subduction of surface water inside eddies are main mechanisms of downward transport of radionuclides. In situ observations are compared with the results of simulated advection of these radioisotopes by the AVISO altimetric velocity field. Different Lagrangian diagnostics are used to reconstruct the history and origin of synthetic tracers imitating measured seawater samples collected in each of those eddies. The results of observations are consistent with the simulated results. It is shown that the tracers, simulating water samples with increased radioactivity to be measured in the cruise, really visited the areas with presumably high level of contamination. Fast water advection between anticyclonic eddies and convergence of surface water inside eddies makes them responsible for spreading, accumulation and downward transport of cesium rich water to the intermediate depth in the frontal zone.

  15. CAFS: A Cesium Atomic Frequency Standard for GPS block IIR

    Science.gov (United States)

    Wisnia, Jeffry A.

    1993-01-01

    Kernco, Inc. was selected to design the Cesium Atomic Frequency Standards (CAFS) for the GPS Block IIR NAVSTAR satellites. These spacecraft are scheduled to be launched in the mid-1990's to replenish and upgrade the existing constellation of Global Positioning System satellites. The Block IIR CAFS output frequency is 13.4003378 MHz, the 686th submultiple of the cesium atomic resonance frequency. Using an integer submultiple simplifies the design of the atomic frequency standard's rf multiplier circuits, eliminating the secondary frequency synthesizer needed in previous designs. The GPS Block IIR CAFS design, particularly the improvements made on our earlier Block II design is described. Test results are included.

  16. Irreversible Wash Aid Additive for Cesium Mitigation: Phase II. Selection and/or Modification of COTS Field Portable Waste Water Systems

    Energy Technology Data Exchange (ETDEWEB)

    Kaminski, Michael [Argonne National Lab. (ANL), Argonne, IL (United States); Mertz, Carol [Argonne National Lab. (ANL), Argonne, IL (United States); Kivenas, Nadia [Argonne National Lab. (ANL), Argonne, IL (United States); Magnuson, Matthew [US Environmental Protection Agency (EPA), Cincinnati, OH (United States).

    2015-01-01

    After an accidental or malicious release of radioactivity, large urban areas may be contaminated, compromising response efforts by first responders and law enforcement officials. In addition, some public services (e.g., drinking water and wastewater treatment, electrical power distribution, etc.) may be disrupted. In such an event, it may be important to deploy mitigation efforts in certain areas to restore response activities and public services (Fig. S-1). This report explores the state-of-the-art approach for a system to rapidly return critical infrastructure components to service following a cesium-137 (Cs-137) radiological dispersal device (RDD) release while avoiding the spread of Cs-137 beyond its original deposition area and minimizing the amount of Cs-137-contaminated wastewater. Specifically, we describe a wash system consisting of chemical additives added to fire hydrant water and irreversible solid sequestering agents added as the water is collected and treated for recycle in situ. The wash system is intended to be a rapidly deployable, cost-effective means of mitigating an urban setting for the purpose of restoring critical infrastructure and operational activities after a radiological release.

  17. Dicty_cDB: SLD137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD137 (Link to dictyBase) - - - Contig-U16379-1 SLD137E (Link... to Original site) - - - - - - SLD137E 288 Show SLD137 Library SL (Link to library) Clone ID SLD137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLD1-B/SLD137Q.Seq.d/ Representative seq. ID SLD13...7E (Link to Original site) Representative DNA sequence >SLD137 (SLD137Q) /CSM/SL/SLD1-B/SLD137Q.Seq.d/ AAAAA...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLD137 (SLD1

  18. 75 FR 37483 - Request for Comments on the Draft Policy Statement on the Protection of Cesium-137 Chloride...

    Science.gov (United States)

    2010-06-29

    ... biomedical research, CsCl irradiation has been used for over 40 years in fields such as immunology, stem cell research, cancer research, in-vivo immunology, systemic drug research, chromosome aberrations, DNA...

  19. Selective chemical binding enhances cesium tolerance in plants through inhibition of cesium uptake

    Science.gov (United States)

    Adams, Eri; Chaban, Vitaly; Khandelia, Himanshu; Shin, Ryoung

    2015-03-01

    High concentrations of cesium (Cs+) inhibit plant growth but the detailed mechanisms of Cs+ uptake, transport and response in plants are not well known. In order to identify small molecules with a capacity to enhance plant tolerance to Cs+, chemical library screening was performed using Arabidopsis. Of 10,000 chemicals tested, five compounds were confirmed as Cs+ tolerance enhancers. Further investigation and quantum mechanical modelling revealed that one of these compounds reduced Cs+ concentrations in plants and that the imidazole moiety of this compound bound specifically to Cs+. Analysis of the analogous compounds indicated that the structure of the identified compound is important for the effect to be conferred. Taken together, Cs+ tolerance enhancer isolated here renders plants tolerant to Cs+ by inhibiting Cs+ entry into roots via specific binding to the ion thus, for instance, providing a basis for phytostabilisation of radiocesium-contaminated farmland.

  20. Dealing with the aftermath of Fukushima Daiichi nuclear accident: decontamination of radioactive cesium enriched ash.

    Science.gov (United States)

    Parajuli, Durga; Tanaka, Hisashi; Hakuta, Yukiya; Minami, Kimitaka; Fukuda, Shigeharu; Umeoka, Kuniyoshi; Kamimura, Ryuichi; Hayashi, Yukie; Ouchi, Masatoshi; Kawamoto, Tohru

    2013-04-16

    Environmental radioactivity, mainly in the Tohoku and Kanto areas, due to the long living radioisotopes of cesium is an obstacle to speedy recovery from the impacts of the Fukushima Daiichi Nuclear Power Plant accident. Although incineration of the contaminated wastes is encouraged, safe disposal of the Cs enriched ash is the big challenge. To address this issue, safe incineration of contaminated wastes while restricting the release of volatile Cs to the atmosphere was studied. Detailed study on effective removal of Cs from ash samples generated from wood bark, household garbage, and municipal sewage sludge was performed. For wood ash and garbage ash, washing only with water at ambient conditions removed radioactivity due to (134)Cs and (137)Cs, retaining most of the components other than the alkali metals with the residue. However, removing Cs from sludge ash needed acid treatment at high temperature. This difference in Cs solubility is due to the presence of soil particle originated clay minerals in the sludge ash. Because only removing the contaminated vegetation is found to sharply decrease the environmental radioactivity, volume reduction of contaminated biomass by incineration makes great sense. In addition, need for a long-term leachate monitoring system in the landfill can be avoided by washing the ash with water. Once the Cs in solids is extracted to the solution, it can be loaded to Cs selective adsorbents such as Prussian blue and safely stored in a small volume.

  1. Sorption of cesium in young till soils

    Energy Technology Data Exchange (ETDEWEB)

    Lusa, Merja; Lempinen, Janne; Ahola, Hanna; Soederlund, Mervi; Lehto, Jukka [Helsinki Univ. (Finland). Laboratory of Radiochemistry; Lahdenperae, Anne-Maj [Saanio and Riekkola Oy, Consulting Engineers, Helsinki (Finland); Ikonen, Ari T.K. [Posiva Oy, Eurajoki (Finland)

    2014-10-01

    Soil samples from three forest soil pits were examined down to a depth of approximately three metres using 1 M ammonium acetate extraction and microwave-assisted extraction with concentrated nitric acid (HNO{sub 3}), to study the binding of cesium (Cs) at Olkiluoto Island, southern Finland. Ammonium acetate was used to extract the readily exchangeable Cs fractions roughly representing the Cs fraction in soil which is available for plants. Microwave-assisted HNO{sub 3} extraction dissolves various minerals, e.g. carbonates, most sulphides, arsenides, selenides, phosphates, molybdates, sulphates, iron (Fe) and manganese (Mn) oxides and some silicates (olivine, biotite, zeolite), and reflects the total Cs concentrations. Cs was mostly found in the strongly bound fraction obtained through HNO{sub 3} extraction. The average Cs concentrations found in this fraction were 3.53 ± 0.30 mg/kg (d.w.), 3.06 ± 1.86 mg/kg (d.w.) and 1.83 ± 0.42 mg/kg (d.w.) in the three soil pits, respectively. The average exchangeable Cs found in the ammonium acetate extraction in all three sampling pits was 0.015 ± 0.008 mg/kg (d.w.). In addition, Cs concentrations in the soil solution were determined and in situ distribution coefficients (K{sub d}) for Cs were calculated. Furthermore, the in situ K{sub d} data was compared with the Cs K{sub d} data obtained using the model batch experiments. The in situ K{sub d} values were observed to fairly well follow the trend of batch sorption data with respect to soil depth, but on average the batch distribution coefficients were almost an order of magnitude higher than the in situ K{sub d} data. In situ Cs sorption data could be satisfactory fitted with the Langmuir sorption isotherm, but the Freundlich isotherm failed to fit the data. Finally, distribution coefficients were calculated by an ion exchange approach using soil solution data, the cation exchange capacity (CEC) as well as Cs to sodium (Na) and Cs to potassium (K) ion exchange selectivity

  2. 21 CFR 137.205 - Bromated whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bromated whole wheat flour. 137.205 Section 137... Cereal Flours and Related Products § 137.205 Bromated whole wheat flour. Bromated whole wheat flour... of ingredients, prescribed for whole wheat flour by § 137.200, except that potassium bromate is...

  3. Surface Electrical Conductivity of Single Crystal Spinel in Cesium Vapour.

    Science.gov (United States)

    2007-11-02

    magnesium aluminate spinel at temperatures ranging from 573K to 923K, in the presence of cesium vapour at pressures up to 1Torr. The interest in spinel has...in the core of a nuclear reactor. In contrast to magnesium oxide and alumina, electron irradiation of spinel produces no dislocation structures

  4. Detection of quadrupole relaxation in an optically pumped cesium vapour

    Energy Technology Data Exchange (ETDEWEB)

    Bernabeu, E.; Tornos, J.

    1985-10-01

    The relaxation of quadrupole orientation induced by means of optical pumping in a cesium vapour is experimentally studied, and the results are compared to the theoretical predictions. The optical detection process of this type of orientation is also discussed as a function of the polarization and spectral profile of the detection light.

  5. Fundamental study of cesium decontamination from soil by superconducting magnet

    Energy Technology Data Exchange (ETDEWEB)

    Igarashi, Susumu, E-mail: igarashi@qb.see.eng.osaka-u.ac.jp; Mishima, Fumihito; Akiyama, Yoko, E-mail: yoko-ak@see.eng.osaka-u.ac.jp; Nishijima, Shigehiro

    2013-11-15

    Highlights: •The method for the soil decontamination by the superconducting magnet is proposed. •Cesium ion can be absorbed by Prussian blue in potassium iodide wash fluid. •It is possible to recover Cs{sup +} ion-adsorbing Prussian blue with a high rate by HGMS. •It is expected that HGMS can be applied to the actual soil decontamination. -- Abstract: The radioactive substances have been spread out all over the surrounding area of Fukushima Daiichi Nuclear Power Plant caused by the accident in March 2011. Decontamination and volume reduction of radioactive substances, especially cesium ion, are desired issue. This study proposed a decontamination method of the soil by the magnetic separation using superconducting magnet. Cesium ion was adsorbed by Prussian blue in the potassium iodide solution. We succeeded in separating selectively the cesium ion-adsorbed Prussian blue out of the liquid phase by high gradient magnetic separation. High recovery ratio of the Prussian blue was achieved by this method.

  6. Membrane-based separation technologies for cesium, strontium, and technetium

    Energy Technology Data Exchange (ETDEWEB)

    Kafka, T.

    1996-10-01

    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah.

  7. Suspension of superfluid helium using cesium-coated surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Williams, M.C.; Giese, C.F.; Halley, J.W. [School of Physics and Astronomy, University of Minnesota, Minneapolis, Minnesota 55455 (United States)

    1996-03-01

    We report results of an experiment which demonstrates that a layer of superfluid helium can be suspended over a cesium-coated orifice. By measuring the layer thickness with a capacitance bridge, we have shown in two runs that fluid layers up to 2 mm thick were suspended over a 70-{mu}m-diam cesium-coated orifice in a platinum foil for over 2 h in a cryostat held at 1.2 K. The effect depends on the recently established fact that superfluid helium does not wet cesium-coated surfaces. As a consequence, superfluid helium is expected to form a stable meniscus across such a cesium-coated hole. The observed depths of suspended helium are consistent with a simple theoretical model based on this picture. We briefly discuss the possible application of this method to the performance of a proposed experiment to study quantum coherence in superfluid helium by directing pulsed beams of helium atoms at such a suspended layer of fluid. {copyright} {ital 1996 The American Physical Society.}

  8. Preparation of cesium targets for gamma-spectroscopic studies

    Science.gov (United States)

    Bhattacharyya, S.; Basu, S. K.; Chanda, S.; Deb, P.; Eqbal, Md; Kundu, S.; Joseph, D.

    2000-11-01

    A procedure to prepare monoisotopic cesium compound targets for gamma-spectroscopic experiments is described. Using this procedure, uniform targets up to thicknesses of 0.6-1.2 mg/cm 2 were prepared and used for in-beam spectroscopic studies. The purity of the target was tested by energy dispersive X-ray fluorescence (EDXRF) measurements.

  9. Modeling of leachable 137Cs in throughfall and stemflow for Japanese forest canopies after Fukushima Daiichi Nuclear Power Plant accident.

    Science.gov (United States)

    Loffredo, Nicolas; Onda, Yuichi; Kawamori, Ayumi; Kato, Hiroaki

    2014-09-15

    The Fukushima accident dispersed significant amounts of radioactive cesium (Cs) in the landscape. Our research investigated, from June 2011 to November 2013, the mobility of leachable Cs in forests canopies. In particular, (137)Cs and (134)Cs activity concentrations were measured in rainfall, throughfall, and stemflow in broad-leaf and cedar forests in an area located 40 km from the power plant. Leachable (137)Cs loss was modeled by a double exponential (DE) model. This model could not reproduce the variation in activity concentration observed. In order to refine the DE model, the main physical measurable parameters (rainfall intensity, wind velocity, and snowfall occurrence) were assessed, and rainfall was identified as the dominant factor controlling observed variation. A corrective factor was then developed to incorporate rainfall intensity in an improved DE model. With the original DE model, we estimated total (137)Cs loss by leaching from canopies to be 72 ± 4%, 67 ± 4%, and 48 ± 2% of the total plume deposition under mature cedar, young cedar, and broad-leaf forests, respectively. In contrast, with the improved DE model, the total (137)Cs loss by leaching was estimated to be 34 ± 2%, 34 ± 2%, and 16 ± 1% of the total plume deposition under mature cedar, young cedar, and broad-leaf forests, respectively. The improved DE model corresponds better to observed data in literature. Understanding (137)Cs and (134)Cs forest dynamics is important for forecasting future contamination of forest soils around the FDNPP. It also provides a basis for understanding forest transfers in future potential nuclear disasters.

  10. Nutrient Status in Composts and Changes in Radioactive Cesium Following the Fukushima Daiichi Nuclear Power Plant Accident

    Directory of Open Access Journals (Sweden)

    Dikkumburage Jasintha Jayasanka

    2016-12-01

    Full Text Available Following the Fukushima Daiichi Nuclear Power Plant (FDNPP accident, the forests in the Fukushima area were highly contaminated with radiocesium (137Cs and 134Cs. Therefore, there is a need to develop strategies for remediation of the contaminated forests. We assessed changes in radioactive cesium (134Cs and 137Cs contamination and nutrient status in composts derived from wood chip, bamboo leaf and bamboo powder using rice bran and wheat meal as sub-materials. Changes in soil properties and Komatsuna (Brassica rapa var. perviridis growth were also investigated due the application of composts and initial materials at 0, 2.5, 5 and 10 kg·m−2 input levels. Mixing of sub-materials significantly reduced the concentration of radioactive Cs and improved compost quality. The effectiveness of three composts on soil quality improvement varied depending on their types and rates of applications. Amendments of bamboo leaf composts at 10 kg·m−2 resulted in the significantly highest soil inorganic N, available P and exchangeable K contents. Amendments of final composts also enhanced Komatsuna growth. Furthermore, radioactive Cs contaminations of the Komatsuna plants grown in these composts were below 0.1 Bq·kg−1. This study may help to remediate the forests contaminated with radiocesium in the Fukushima area while improving the soil organic matter content to enhance soil sustainability.

  11. Leaching of 60Co and 137Cs from spent ion exchange resins in cement–bentonite clay matrix

    Indian Academy of Sciences (India)

    I B Plecas; R S Pavlovic; S D Pavlovic

    2003-12-01

    The leaching rate of 60Co and 137Cs from the spent cation exchange resins in cement–bentonite matrix has been studied. The solidification matrix was a standard Portland cement mixed with 290–350 (kg/m3) spent cation exchange resins, with or without 2–5% of bentonite clay. The leaching rates from the cement–bentonite matrix for 60Co: (4,2–7,0) × 10-5 (cm/d) and 137Cs: (3,2–6,6) × 10-4 (cm/d), after 125 days were measured. From the leaching data the apparent diffusivity of cobalt and cesium in cement–bentonite clay matrix with a waste load of 290–350 (kg/m3) spent cation exchange resins, was measured for 60Co: (1,1–4,0) × 10-6 (cm2/d) and 137Cs: (0,5–2,6) × 10-4 (cm2/d), after 125 days. The results presented in this paper are part of the results obtained in a 20-year mortar and concrete testing project which will influence the design of radioactive waste management for a future Serbian radioactive waste disposal centre.

  12. Selective extraction of cesium: from compound to process; Extraction selective du cesium: de la molecule au procede

    Energy Technology Data Exchange (ETDEWEB)

    Simon, N.; Eymard, S.; Tournois, B.; Dozol, J.F. [CEA Cadarache, Dept. d' Entreposage et de Stockage des Dechets (DCC/DESD/SEP), 13 - Saint-Paul-lez-Durance (France)

    2000-07-01

    Under the French law of 30 December 1991 on nuclear waste management, research is conducted to recover long-lived fission products from high-level radioactive effluents generated by spent fuel reprocessing, in order to destroy them by transmutation or encapsulate them in specific matrices. Cesium extraction with mono and bis-crown calix(4)arenes (Frame 1) is a candidate for process development. These extractants remove cesium from highly acidic or basic pH media even with high salinity. A real raffinate was treated in 1994 in a hot cell to extract cesium with a calix-crown extractant. The success of this one batch experiment confirmed the feasibility of cesium decontamination from high-level liquid waste. It was then decided to develop a process flowchart to extract cesium selectively from high-level raffinate, to be included in the general scheme of long-lived radionuclide partitioning. It was accordingly decided to develop a process based on liquid-liquid extraction and hence optimize a calixarene/diluent solvent according to: - hydraulic properties: density, viscosity, interfacial tension, - chemical criteria: sufficient cesium extraction (depending on the diluent), kinetics, third phase elimination... New mono-crown-calixarenes branched with long aliphatic groups (Frame 2) were designed to be soluble in aliphatic diluents. To prevent third phase formation associated with nitric acid extraction, the addition of modifiers (alcohol, phosphate and amide) in the organic phase was tested (Frame 3). Table 1 shows examples of calixarene/diluent systems suitable for a process flowchart, and Figure 2 provides data on cesium extraction with these new systems. Alongside these improvements, a system based on a modified 1,3-di(n-octyl-oxy)2,4-calix[4]arene crown and a modified diluent was also developed, considering a mixed TPH/NPHE system as the diluent, where TPH (hydrogenated tetra propylene) is a common aliphatic industrial solvent and NPHE is nitrophenyl

  13. Solvent-free synthesis and application of nano-Fe/Ca/CaO/[PO4] composite for dual separation and immobilization of stable and radioactive cesium in contaminated soils.

    Science.gov (United States)

    Mallampati, Srinivasa Reddy; Mitoma, Yoshiharu; Okuda, Tetsuji; Simion, Cristian; Lee, Byeong Kyu

    2015-10-30

    This study assessed the synthesis and application of nano-Fe/Ca/CaO-based composite material for use as a separation and immobilizing treatment of dry soil contaminated by stable ((133)Cs) and radioactive cesium species ((134)Cs and (137)Cs). After grinding with nano-Fe/CaO, nano-Fe/Ca/CaO, and nano-Fe/Ca/CaO/[PO4], approximately 31, 25, and 22 wt% of magnetic fraction soil was separated. Their resultant (133)Cs immobilization values were about 78, 81, and 100%, respectively. When real radioactive cesium contaminated soil obtained from Fukushima was treated with nano-Fe/Ca/CaO/[PO4], approximately 27.3 wt% of magnetic and 72.75% of non-magnetic soil fractions were separated. The highest amount of entrapped (134)Cs and (137)Cs was found in the lowest weight of the magnetically separated soil fraction (i.e., 80% in 27.3% of treated soil). Results show that (134)Cs and (137)Cs either in the magnetic or non-magnetic soil fractions was 100% immobilized. The morphology and mineral phases of the nano-Fe/Ca/CaO/[PO4] treated soil were characterized using SEM-EDS, EPMA, and XRD analysis. The EPMA and XRD patterns indicate that the main fraction of enclosed/bound materials on treated soil included Ca/PO4 associated crystalline complexes. These results suggest that simple grinding treatment with nano-Fe/Ca/CaO/[PO4] under dry conditions might be an extremely efficient separation and immobilization method for radioactive cesium contaminated soil.

  14. Psalm 137 en die beryming van wraakpsalms

    Directory of Open Access Journals (Sweden)

    H. F. van Rooy

    2009-07-01

    Full Text Available Psalm 137 and metrical versions of imprecatory psalms This article discusses seven metrical versions of the im- precatory section of Psalm 137, two in Dutch (1773 and 1968, two in English (in the “Psalter hymnal” of the Christian Re- formed Church and in “Sing psalms” of the Free Church of Scotland and three Afrikaans versions (J.D. du Toit, T.T. Cloete and Lina Spies, looking at the way in which these versions treated this section. This is done in the light of recent research on Psalm 137, and especially the imprecatory section. In the literature questions are asked about the singing of this kind of psalm in the church, but also about the omission or softening of this part of Psalm 137 in the versions of Cloete and Spies. The choice of melody, the number of strophes used and the division of the contents of the psalm in strophes play an important role in determining most of the omissions or alle- viations in the metrical versions. All seven the versions dis- cussed took the imprecatory section seriously. The problems raised against these versions can be ascribed to these choices, and not to a deliberate attempt to circumvent the problem of such an imprecatory section. The version of Spies is the only exception, with the omission of the last line of the psalm.

  15. 7 CFR 1150.137 - Procedure.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order National Dairy Promotion and Research Board § 1150.137 Procedure. (a) A majority of the...

  16. 42 CFR 137.280 - Construction Definitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Construction Definitions § 137... environmental assessment nor an environmental impact statement is required. Any procedures under this section... environmental effect. CEQ means Council on Environmental Quality in the Office of the President....

  17. Dose response curve of induction of MN in lymphocytes for energies Cs-137; Curva dosis respuesta de induccion de micronucleos en linfocitos para las energias Cs-137

    Energy Technology Data Exchange (ETDEWEB)

    Serna Berna, A.; Alcaraz, M.; Acevedo, C.; Vicente, V.; Fuente, I. de la; Canteras, M.

    2006-07-01

    The determination of the dose-response curve is a crucial step to use the Micronucleus assay in Lymphocytes as a biological dosimeters. The most widely used fitting function is the linear-quadratic function. The coefficients are fitted by calibration data provided by irradiations of blood from healthy donors. In our case we performed the calibration curve corresponding to gamma radiation from Cesium-137 (660 keV). Doses ranged from 0 to 16 Gy. The fitting procedure used was the iteratively re weighted least square algorithm implemented in a Matlab routine. The results of the analysis of our data show that the dose-effect curve does not follow a linear-quadratic curve at high radiation doses, diminishing the quadratic parameters as dose increases. This can be interpreted as a micronucleus saturation effect beyond a certain dose level. We conclude that the MN assay with lymphocytes can be well characterized as a biological dosimeters up to a maximum dose of 4.5 Gy. (Author)

  18. Radiological protection and calibration of an activity meter with cesium and barium sources in a nuclear medicine center; Proteccion radiologica y calibracion de un activimetro con fuentes de cesio y bario en un centro de medicina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Morales L, M.E. [IPEN INEN Centro de Medicina Nuclear, Av. Aviacion 3799, Lima 34 (Peru)

    2005-07-01

    Presently work is shown the results when gauging a team Deluxe Isotope (Caliper 11) with some sources of Cesium 137 and Barium 133, in a Center of Medicine Nuclear that operates from the anus 1983 in a modern building inside the one Institute of Illnesses Neoplasia (Inn). This Center was equipped initially with teams donated by the International Organism of Atomic Energy (Oa) with those that it develops assistance, educational works and of investigation, giving services to patient of the Inn and other public and private medical centers. (Author)

  19. Sorption capacity studies of Scheldt sediments for /sup 60/Co, /sup 85/Sr, and /sup 137/Cs

    Energy Technology Data Exchange (ETDEWEB)

    Meeussen, M.A.; Willems, G.J.; De Ranter, C.J.

    1975-01-01

    Using /sup 60/Co, /sup 85/Sr and /sup 137/Cs as tracer ions the sorption capacity of Scheldt sediments for Co/sup 2 +/, Sr/sup 2 +/ and Cs/sup +/ was studied and their distribution coefficients between sediment and Scheldt water were determined. It is found that clay and silt samples show relatively high sorption capacities for cobalt and cesium, compared with the low fixation rate for strontium. The selectivity of the sediments for a particular ion, in competition with other ions, was studied and the sequence found is in accordance with the distribution coefficients. From these experiments it may be concluded that the high salt concentrations, present in normal Scheldt water, will limit the risks of radioactive isotopes accumulation in the sediments.

  20. Reactive barriers for 137Cs retention.

    Science.gov (United States)

    Krumhansl, J L; Brady, P V; Anderson, H L

    2001-02-01

    137Cs was dispersed globally by cold war activities and, more recently, by the Chernobyl accident. Engineered extraction of 137Cs from soils and groundwaters is exceedingly difficult. Because the half-life of 137Cs is only 30.2 years, remediation might be more effective (and less costly) if 137Cs bioavailability could be demonstrably limited for even a few decades by use of a reactive barrier. Essentially permanent isolation must be demonstrated in those few settings where high nuclear level wastes contaminated the environment with 135Cs (half-life 2.3 x 10(6) years) in addition to 137Cs. Clays are potentially a low-cost barrier to Cs movement, though their long-term effectiveness remains untested. To identify optimal clays for Cs retention, Cs desorption was measured for five common clays: Wyoming Montmorillonite (SWy-1), Georgia Kaolinites (KGa-1 and KGa-2), Fithian Illite (F-Ill), and K-Metabentonite (K-Mbt). Exchange sites were pre-saturated with 0.16 M CsCl for 14 days and readily exchangeable Cs was removed by a series of LiNO3 and LiCl washes. Washed clays were then placed into dialysis bags and the Cs release to the deionized water outside the bags measured. Release rates from 75 to 139 days for SWy-1, K-Mbt and F-Ill were similar; 0.017% to 0.021% sorbed Cs released per day. Both kaolinites released Cs more rapidly (0.12% to 0.05% of the sorbed Cs per day). In a second set of experiments, clays were Cs-doped for 110 days and subjected to an extreme and prolonged rinsing process. All the clays exhibited some capacity for irreversible Cs uptake. However, the residual loading was greatest on K-Mbt (approximately 0.33 wt.% Cs). Thus, this clay would be the optimal material for constructing artifical reactive barriers.

  1. AFCF and clinoptilolite use in reduction of {sup 137}Cs deposition in several days' contaminated broiler chicks

    Energy Technology Data Exchange (ETDEWEB)

    Mitrovic, B. [Faculty of Veterinary Medicine, Department of Radiology, 18 Bulevar JA, 11 000 Belgrade (Serbia)]. E-mail: radijacija@vet.bg.ac.yu; Vitorovic, G. [Faculty of Veterinary Medicine, Department of Radiology, 18 Bulevar JA, 11 000 Belgrade (Serbia); Vitorovic, D. [Faculty of Agriculture, Department of Animal Science, 6 Nemanjina, 11 080 Belgrade (Serbia); Dakovic, A. [Institute for Technology of Nuclear and Other Raw Materials, 86 Franche D' Epere, 11 000 Belgrade (Serbia); Stojanovic, M. [Institute for Technology of Nuclear and Other Raw Materials, 86 Franche D' Epere, 11 000 Belgrade (Serbia)

    2007-06-15

    The objective of this study was to investigate the binding efficiency of AFCF and clinoptilolite, mixed to the feed and administered orally using gastric tube to chronically {sup 137}Cs alimentary contaminated broiler chicks. Seventy-five male Hybro broiler chicks, between 35 and 47 days of age were divided into five groups (15 birds per group) reared in cages (five birds in a cage) and fed a standard diet. Every day during 13 days of the experimental period all chicks received orally 1 ml CsCl water solution with activity of 1310 Bq ml{sup -1} {sup 137}Cs (gastric tube). Group 1 was the control group and received no binders. The experimental groups received the binders. Group 2 received 0.2 g of AFCF in the form of water solution (gastric tube); group 3 received 0.2% AFCF in the feed; group 4 received 2 g clinoptilolite in the form of water suspension (gastric tube) and group 5 received 2% clinoptilolite in the feed. Five chicks from each group were sacrificed on days 4, 10 and 13 of the experimental period. Using gamma spectrometric methods specific activity of {sup 137}Cs was determined in the samples of breast meat, liver and gizzard. The results obtained showed that administering binders to the chronically contaminated broiler chicks significantly (p < 0.01) reduced {sup 137}Cs transfer and deposition in breast meat, liver and gizzard. Decreasing deposition of {sup 137}Cs in breast meat and internal organs increased with time of contamination and binders' administration. With AFCF as a cesium binder, on day 13 of measuring the {sup 137}Cs activity in breast meat was 80-83% lower than that in the control group, 89% in liver and 83-84% in gizzard. Natural clinoptilolite demonstrated lower binding efficiency. On day 13 of measuring the {sup 137}Cs activity in breast meat was 53-69% lower than that in the control group, 67-60% in liver and 59-71% in gizzard.

  2. Kelvin Probe Studies of Cesium Telluride Photocathode for AWA Photoinjector

    CERN Document Server

    Wisniewski, Eric; Yusof, Zikri; Spentzouris, Linda; Terry, Jeff; Harkay, Katherine

    2012-01-01

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (~50 nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin Probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating.

  3. Nutrients and cancer: an introduction to cesium therapy.

    Science.gov (United States)

    Sartori, H E

    1984-01-01

    A brief overview on the relevance in dietary factors in both development and prevention of cancer is presented. The pharmacologic properties of various food ingredients are discussed. Establishing of a special diet for the cancer patient is suggested. In addition, avoidance of certain foods is recommended to counteract mucus production of cancer cells. Evaluation of the nutrient content of certain diets in regions with low incidence of cancer has advanced the use of certain alkali metals, i.e., rubidium and cesium, as chemotherapeutic agents. The rationale for this approach termed the "high pH" therapy resides in changing the acidic pH range of the cancer cell by cesium towards weak alkalinity in which the survival of the cancer cell is endangered, and the formation of acidic and toxic materials, normally formed in cancer cells, is neutralized and eliminated.

  4. Fiber laser system for cesium and rubidium atom interferometry

    CERN Document Server

    Diboune, Clément; Bidel, Yannick; Cadoret, Malo; Bresson, Alexandre

    2016-01-01

    We present an innovative fiber laser system for both cesium and rubidium manipulation. The architecture is based on frequency conversion of two lasers at 1560 nm and 1878 nm. By taking advantage of existing fiber components at these wavelengths, we demonstrate an all fiber laser system delivering 350 mW at 780 nm for rubidium and 210 mW at 852 nm for cesium. This result highlights the promising nature of such laser system especially for Cs manipulation for which no fiber laser system has been reported. It offers new perspectives for the development of atomic instruments dedicated to onboard applications and opens the way to a new generation of atom interferometers involving three atomic species $^{85}$Rb, $^{87}$Rb and $^{133}$Cs for which we propose an original laser architecture.

  5. New thermodynamic regularity for cesium over the whole liquid range

    CERN Document Server

    Ghatee, M H

    2001-01-01

    In this paper we derive an equation of state for liquid cesium based on a suggested potential function in accord to the characteristics large attraction and soft repulsion at the asymptotes of interaction potentials. By considering the interaction of nearest adjacent atoms in dense fluid, the equation of state predicts that the isotherm is linear function of, where is the compression factor, is the molar volume, and is the molar density. The linear parameters are identified as interaction coefficients related to attraction and repulsion, and are used to evaluate the molecular parameters with interesting implications. The isotherm is intended to resolve the particular thermodynamic properties of alkali metals, which have been known for their unusual change of the nature of intermolecular force as the characteristic metal-nonmetal transition range is approached. When applied to liquid cesium, the isotherms persist linear over the whole liquid range including the metal non-metals transition range and at the crit...

  6. Spectrally selective optical pumping in Doppler-broadened cesium atoms

    Science.gov (United States)

    Zhang, Jun-Hai; Zeng, Xian-Jin; Li, Qing-Meng; Huang, Qiang; Sun, Wei-Min

    2013-05-01

    The D1 line spectrally selective pumping process in Doppler-broadened cesium is analyzed by solving the optical Bloch equations. The process, described by a three-level model with the Λ scheme, shows that the saturation intensity of broadened atoms is three orders of magnitude larger than that of resting atoms. The |Fg = 3> → |Fe = 4> resonance pumping can result in the ground state |Fg = 4, mF = 4> sublevel having a maximum population of 0.157 and the population difference would be about 0.01 in two adjacent magnetic sublevels of the hyperfine (HF) state Fg = 4. To enhance the anisotropy in the ground state, we suggest employing dichromatic optical HF pumping by adding a laser to excite D1 line |Fg = 4> → |Fe = 3> transition, in which the cesium magnetometer sensitivity increases by half a magnitude and is unaffected by the nonlinear Zeeman effect even in Earth's average magnetic field.

  7. Test procedures and instructions for Hanford tank waste supernatant cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W., Westinghouse Hanford

    1996-05-31

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test using Hanford Double-Shell Slurry Feed supernatant liquor from tank 251-AW-101 in a bench-scale column.Cesium sorbents to be tested include resorcinol-formaldehyde resin and crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-022, Hanford Tank Waste Supernatant Cesium Removal Test Plan.

  8. Test procedures and instructions for Hanford complexant concentrate supernatant cesium removal using CST

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W.

    1997-01-08

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Complexant Concentrate supernatant liquor from tank 241-AN-107, in a bench-scale column. The cesium sorbent to be tested is crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-023, Hanford Complexant Concentrate Supernatant Cesium Removal Test Plan.

  9. Fatal Cesium Chloride Toxicity After Alternative Cancer Treatment

    OpenAIRE

    Sessions, Daniel; Heard, Kennon; Kosnett, Michael

    2013-01-01

    Background: Cesium chloride (CsCl) is sold as a treatment for several types of cancers. The purported mechanism of action is alkalinization of relatively acidic neoplastic cells. The efficacy of CsCl has not been demonstrated in controlled experiments. Oral and intravenous CsCl use has been associated with seizures, cardiotoxicity, syncope, and death. Although intratumoral treatment with various antineoplastic agents is described, no cases of intratumoral cancer treatment with CsCl have been ...

  10. Cesium pentazolate: A new nitrogen-rich energetic material

    Science.gov (United States)

    Steele, Brad A.; Stavrous, Elissaios; Prakapenka, Vitali B.; Radousky, Harry; Zaug, Joseph; Crowhurst, Jonathan C.; Oleynik, Ivan I.

    2017-01-01

    We report theoretical and experimental evidence for a new class of high-nitrogen content energetic material compounds consisting of molecular pentazoles, which are stabilized in the crystal phase upon introduction of elemental cesium. First-principles structural predictions show that the material with composition CsN5 is thermodynamically stable above 15 GPa. Indexing of the measured X-ray diffraction spectra indicate the synthesis of this material at 60 GPa as well its stability upon decompression down to 24 GPa.

  11. MECHANISM OF CESIUM EXCHANGE WITH POTASSIUM TITANIUM HEXACYANOFERRATE

    Institute of Scientific and Technical Information of China (English)

    XuShiping; SunYongxia; 等

    1998-01-01

    The mechanism of cesium exchange on potassium titanium hexacyanoferrate (KTiFC) is described in this paper.The dependence of the exchange rate on temperature,particle granule size,and shaking frequency is studied.The results show that ion exchange process is controlled by liquid film diffusion in granule particle.An exchange reaction occurs mainly between K+ in the exchanger and Cs+ in the solution.

  12. Studies on the Separation of Cesium From Fission Products

    Institute of Scientific and Technical Information of China (English)

    QIANLi-juan; ZHANGSheng-dong; GUOJing-ru; CUIAn-zhi; YANGLei; WUWang-suo

    2003-01-01

    135Cs is a long-life fission product. When measuring its thermal cross section, we must separate radiochemical purity cesium from fission products. Except for decontaminating radio- nuclides, others which can be activated must be avoided to come into solution. So ion exchanger is used. Inorganic ion exchangers have received increased attention because of their high resistance to radiation and their very efficient separation of alkali metal ions.

  13. Distribution of the 134Cs/137Cs ratio around the Fukushima Daiichi nuclear power plant using an unmanned helicopter radiation monitoring system

    Science.gov (United States)

    Torii, T.; Nishizawa, Y.

    2015-12-01

    Many radioactive substances were released by the Fukushima Daiichi nuclear power plant accident occurred on March 11, 2011 in the atmosphere. A lot of short half-life nuclides which are 131I, 132Te (132I) and 133I, etc., in addition to longer half-lived nuclides such as 134Cs and 137Cs. The estimated release amount of these nuclides from the reactor 1st to 3rd unit is reported, but it's found to be quite different in the short half-lived nuclides by the reactor units. Because the radioactivity ratio of 134Cs and 137Cs was slight different between the reactor units, it can be considered that the valuable source is obtained by the measurement of 134Cs/137Cs ratio in the environment around the Fukushima Daiichi nuclear power station at the present stage when the nuclides with short half-lives had already decayed. We have measured high-resolution gamma-ray spectrum using an unmanned helicopter equipped with LaBr3(Ce) detector in a 3-km range from the power station which was near to the release source of the radioactive cesium. Because the LaBr3(Ce) detector has high resolution of gamma rays, the discrimination of many nuclides is possible. In addition, there is extremely much number of the data provided by the distribution measurement with the unmanned helicopter. Because a new map was illustrated by the analysis of the 134Cs/137Cs ratio, we report the outline.

  14. High-resolution historical records from Pettaquamscutt River basin sediments: 1. 210Pb and varve chronologies validate record of 137Cs released by the Chernobyl accident

    Science.gov (United States)

    Lima, Ana Lúcia; Hubeny, J. Bradford; Reddy, Christopher M.; King, John W.; Hughen, Konrad A.; Eglinton, Timothy I.

    2005-04-01

    Cesium-137 derived from the explosion of the Chernobyl reactor in 1986 was preserved in anoxic sediments from a coastal environment in southern Rhode Island. Although the radioactive plume was detected in surface air samples at several locations in the United States, this is the first known record of a Chernobyl 137Cs peak in sediments from North America. The inventory of Chernobyl 137Cs that was preserved in the Pettaquamscutt River is small compared to European counterparts and should only be detectable for the next 15-20 yr. However, the presence of two 137Cs peaks (1963 and 1987) identifies a well-dated segment of the sediment column that could be exploited in understanding the decomposition and preservation of terrestrial and aquatic organic matter. Different methods for calculating the 210Pb chronology were also evaluated in this study and checked against independent varve counting. The end result is a detailed chronology of a site well suited for reconstruction of historical records of environmental change.

  15. Cesium chloride protects cerebellar granule neurons from apoptosis induced by low potassium.

    Science.gov (United States)

    Zhong, Jin; Yao, Weiguo; Lee, Weihua

    2007-10-01

    Neuronal apoptosis plays a critical role in the pathogenesis of neurodegenerative disorders, and neuroprotective agents targeting apoptotic signaling could have therapeutic use. Here we report that cesium chloride, an alternative medicine in treating radiological poison and cancer, has neuroprotective actions. Serum and potassium deprivation induced cerebellar granule neurons to undergo apoptosis, which correlated with the activation of caspase-3. Cesium prevented both the activation of caspase-3 and neuronal apoptosis in a dose-dependent manner. Cesium at 8 mM increased the survival of neurons from 45 +/- 3% to 91 +/- 5% of control. Cesium's neuroprotection was not mediated by PI3/Akt or MAPK signaling pathways, since it was unable to activate either Akt or MAPK by phosphorylation. In addition, specific inhibitors of PI3 kinase and MAP kinase did not block cesium's neuroprotective effects. On the other hand, cesium inactivated GSK3beta by phosphorylation of serine-9 and GSK3beta-specific inhibitor SB415286 prevented neuronal apoptosis. These data indicate that cesium's neuroprotection is likely via inactivating GSK3beta. Furthermore, cesium also prevented H(2)O(2)-induced neuronal death (increased the survival of neurons from 72 +/- 4% to 89 +/- 3% of control). Given its relative safety and good penetration of the brain blood barrier, our findings support the potential therapeutic use of cesium in neurodegenerative diseases.

  16. Radioactive cesium dynamics derived from hydrographic observations in the Abukuma River Estuary, Japan.

    Science.gov (United States)

    Kakehi, Shigeho; Kaeriyama, Hideki; Ambe, Daisuke; Ono, Tsuneo; Ito, Shin-ichi; Shimizu, Yugo; Watanabe, Tomowo

    2016-03-01

    Large quantities of radioactive materials were released into the air and the ocean as a result of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident, caused by the 2011 Tohoku earthquake and the subsequent major tsunami off the Pacific coast. There is much concern about radioactive contamination in both the watershed of the Abukuma River, which flows through Fukushima Prefecture, and its estuary, where it discharges into the sea in Miyagi Prefecture. We investigated radioactive cesium dynamics using mixing diagrams obtained from hydrographic observations of the Abukuma River Estuary. Particulate radioactive cesium dominates the cesium load in the river, whereas the dissolved form dominates in the sea. As the salinity increased from <0.1 to 0.1-2.3, the mixing diagram showed that dissolved radioactive cesium concentrations increased, because of desorption. Desorption from suspended particles explained 36% of dissolved radioactive cesium in estuarine water. However, the dissolved and particulate radioactive cesium concentrations in the sea decreased sharply because of dilution. It is thought that more than 80% of the discharged particulate radioactive cesium was deposited off the river mouth, where the radioactive cesium concentrations in sediment were relatively high (217-2440 Bq kg(-1)). Radioactive cesium that was discharged to the sea was transported southward by currents driven by the density distribution.

  17. Cesium Toxicity Alters MicroRNA Processing and AGO1 Expressions in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Il Lae Jung

    Full Text Available MicroRNAs (miRNAs are short RNA fragments that play important roles in controlled gene silencing, thus regulating many biological processes in plants. Recent studies have indicated that plants modulate miRNAs to sustain their survival in response to a variety of environmental stimuli, such as biotic stresses, cold, drought, nutritional starvation, and toxic heavy metals. Cesium and radio-cesium contaminations have arisen as serious problems that both impede plant growth and enter the food chain through contaminated plants. Many studies have been performed to define plant responses against cesium intoxication. However, the complete profile of miRNAs in plants during cesium intoxication has not been established. Here we show the differential expression of the miRNAs that are mostly down-regulated during cesium intoxication. Furthermore, we found that cesium toxicity disrupts both the processing of pri-miRNAs and AGONOUTE 1 (AGO1-mediated gene silencing. AGO 1 seems to be especially destabilized by cesium toxicity, possibly through a proteolytic regulatory pathway. Our study presents a comprehensive profile of cesium-responsive miRNAs, which is distinct from that of potassium, and suggests two possible mechanisms underlying the cesium toxicity on miRNA metabolism.

  18. MODELING RESULTS FROM CESIUM ION EXCHANGE PROCESSING WITH SPHERICAL RESINS

    Energy Technology Data Exchange (ETDEWEB)

    Nash, C.; Hang, T.; Aleman, S.

    2011-01-03

    Ion exchange modeling was conducted at the Savannah River National Laboratory to compare the performance of two organic resins in support of Small Column Ion Exchange (SCIX). In-tank ion exchange (IX) columns are being considered for cesium removal at Hanford and the Savannah River Site (SRS). The spherical forms of resorcinol formaldehyde ion exchange resin (sRF) as well as a hypothetical spherical SuperLig{reg_sign} 644 (SL644) are evaluated for decontamination of dissolved saltcake wastes (supernates). Both SuperLig{reg_sign} and resorcinol formaldehyde resin beds can exhibit hydraulic problems in their granular (nonspherical) forms. SRS waste is generally lower in potassium and organic components than Hanford waste. Using VERSE-LC Version 7.8 along with the cesium Freundlich/Langmuir isotherms to simulate the waste decontamination in ion exchange columns, spherical SL644 was found to reduce column cycling by 50% for high-potassium supernates, but sRF performed equally well for the lowest-potassium feeds. Reduced cycling results in reduction of nitric acid (resin elution) and sodium addition (resin regeneration), therefore, significantly reducing life-cycle operational costs. These findings motivate the development of a spherical form of SL644. This work demonstrates the versatility of the ion exchange modeling to study the effects of resin characteristics on processing cycles, rates, and cold chemical consumption. The value of a resin with increased selectivity for cesium over potassium can be assessed for further development.

  19. A study of Cs-137 spatial distribution in soil thin sections by digital autoradiography

    Science.gov (United States)

    Korobova, Elena; Dogadkin, Nikolay; Shiryaev, Andrey; Kolotov, Vladimir; Turkov, Victor

    2013-04-01

    Recent studies have proved autoradiography to have high potential in detection of radiation in particles including geological objects [1-3]. We applied digital autoradiography based on usage of image plates to study Cs-137 microdistribution in thin sections of the podzolic sandy soil typical for the Chernobyl remote impact zone 25 years after the accident. The zone is noted for contamination of the so-called condensation type where the contribution of the "hot" fuel particles has been comparatively low. The initial 137Cs contamination level of the study plot approximated 40 Ci/km2. According to the soil core data twenty five years after the accident the main portion of cesium radioisotopes is still concentrated in the 10-20 cm thick surface layer. Thin sections have been prepared from the top 0-10 cm soil layer of the soil profile located on the shoulder of the relatively steep northern slope of the forested hill formed on the Iput river terrace ca 20 km to the east of the town of Novozybkov, Bryansk region. Undisturbed soil sample was impregnated with epoxy resin, then dissected in vertical triplicates and polished to obtain open surface. Autoradiography of the thin sections has clearly shown different patterns of Cs-137 distribution related to its concentration in organic material and on the surface of soil particles. High sensitivity and resolution of the applied technique enables to reveal concentration and dispersion zones on microscale level. Soil micro-morphology has shown to be helpful in deciphering soil components and properties responsible for Cs-137 retention in the soil top layer. References 1. Mihoko Hareyama, Noriyoshi Tsuchiya, Masahiro Takebe and Tadashi Chida. Two-dimensional measurement of natural radioactivity of granitic rocks by photostimulated luminescence technique Geochemical Journal, 2000, 34, 1- 9. 2. Zeissler C. J., R. M. Lindstrom, J. P. McKinley. Radioactive particle analysis by digital autoradiography. Journal of Radioanalytical and

  20. Taking into account absorbed doses in tooth enamel due to internal irradiation of human body by radioactive cesium isotopes at analysis EPR dosimetry data: Calculation by Monte-Carlo method

    Energy Technology Data Exchange (ETDEWEB)

    Borysheva, N. [Medical Radiological Research Center, Korolyov str., 4, Obninsk 249020 (Russian Federation); Ivannikov, A. [Medical Radiological Research Center, Korolyov str., 4, Obninsk 249020 (Russian Federation)], E-mail: Ivannikov-Alexander@yandex.ru; Tikunov, D.; Orlenko, S.; Skvortsov, V.; Stepanenko, V. [Medical Radiological Research Center, Korolyov str., 4, Obninsk 249020 (Russian Federation); Hoshi, M. [Research Institute for Radiation Biology and Medicine, Hiroshima University, 1-2-3 Kasumi, Minami-ku, Hiroshima 734-8553 (Japan)

    2007-07-15

    By Monte-Carlo simulation of ionizing particles transport, for a realistic mathematical phantom of a man supplemented by a dental region, absorbed doses in teeth enamel and whole body doses are calculated for cases of internal irradiation by {sup 137}Cs and {sup 134}Cs isotopes incorporated in the human body resulted from staying in radioactive contaminated territory. It is shown that dose in enamel constitutes (40{+-}4)% and (59{+-}6)% of whole body dose resulted from the decay of {sup 137}Cs and {sup 134}Cs isotopes, respectively. The results of calculations may be used for conversion of absorbed dose in enamel obtained by the tooth enamel EPR spectroscopy method to whole body dose for dosimetric investigation of population of territories contaminated by the radioactive cesium, which is specific for the Chernobyl accident.

  1. Oceanic dispersion of radioactive cesium in the western North Pacific - Eastward dispersion in surface water and southward intrusion with mode water

    Energy Technology Data Exchange (ETDEWEB)

    Kaeriyama, Hideki; Ambe, Daisuke; Shigenobu, Yuya; Fujimoto, Ken; Ono, Tsuneo; Watanabe, Tomowo [National Research Institute of Fisheries Science, Fisheries Research Agency, 2-12-4, Fukuura, Kanazawa, Yokohama, Kanagawa 236-8648 (Japan); Morita, Takami [Fisheries Research Agency, 2-3-3, Minato Mirai, Nishi-ku, Yokohama, Kanagawa 220-6115 (Japan)

    2014-07-01

    The Fukushima Dai-ichi Nuclear Power Plant (FNPP) accident after the Great East Japan Earthquake and tsunami on 11 March 2011 resulted in elevation of the level of anthropogenic radioactivity in the marine environment in the western North Pacific from atmospheric fallout and direct discharges of highly radioactive liquid waters. Intensive monitoring on iodine-131, cesium-134 (Cs-134) and cesium-137 (Cs-137) in seawater near offshore FNPP, and those in marine organisms in the broad area around Japan were conducted, while the information of radioactive contamination in the North Pacific is still limited due to the limitation of the observational data. In this study, we report the concentrations of Cs-134 and Cs-137 in seawater collected from western North Pacific during June 2011 and November 2012. The eastward dispersion of FNPP-derived radioactive cesium in the surface water has been observed with prevention of southward dispersion due to the strong eastward current (Kuroshio Extension; KE) in the North Pacific. Although the concentrations of Cs-134 and Cs-137 were remarkably decreased between 2011 and 2012 at 145 deg. E and 155 deg. E, they were almost comparable between these two years at 175 deg. E. The inventories of Cs-137 between 0-500 m around KE at 147 deg. E were ranged from 3800 to 11000 Bq/m{sup 2} in October 2011, and from 1000 to 2400 Bq/m{sup 2} in November 2012. Surface water had the highest concentration of radioactive Cs at northern part of KE, subsurface peak of radioactive Cs were observed at KE and south of KE in both years. Furthermore, the southward dispersion of FNPP-derived radioactive Cs in the subsurface waters were also observed south of Japan Islands. We found the FNPP-derived Cs-134 (1.8-6.8 mBq/kg) at southernmost 18 deg. N, 135 deg. deg. E in September 2012. The potential density at the subsurface peaks of Cs-134 and increase of water column inventories of Cs-137 after the winter season of 2011-2012, suggested that the main water mass

  2. 29 CFR 102.137 - Public observation of Board meetings.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Public observation of Board meetings. 102.137 Section 102.137 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.137 Public observation of Board meetings. Every portion of every meeting of...

  3. 7 CFR 4280.137 - Repurchase from holder.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Repurchase from holder. 4280.137 Section 4280.137... Efficiency Improvements Program Section B. Guaranteed Loans § 4280.137 Repurchase from holder. Any repurchase from a holder must be in accordance with § 4279.78 of this chapter....

  4. Quantitative Model for Estimating Soil Erosion Rates Using 137Cs

    Institute of Scientific and Technical Information of China (English)

    YANGHAO; GHANGQING; 等

    1998-01-01

    A quantitative model was developed to relate the amount of 137Cs loss from the soil profile to the rate of soil erosion,According th mass balance model,the depth distribution pattern of 137Cs in the soil profile ,the radioactive decay of 137Cs,sampling year and the difference of 137Cs fallout amount among years were taken into consideration.By introducing typical depth distribution functions of 137Cs into the model ,detailed equations for the model were got for different soil,The model shows that the rate of soil erosion is mainly controlled by the depth distrbution pattern of 137Cs ,the year of sampling,and the percentage reduction in total 137Cs,The relationship between the rate of soil loss and 137Cs depletion i neither linear nor logarithmic,The depth distribution pattern of 137Cs is a major factor for estimating the rate of soil loss,Soil erosion rate is directly related with the fraction of 137Cs content near the soil surface. The influences of the radioactive decay of 137Cs,sampling year and 137Cs input fraction are not large compared with others.

  5. 25 CFR 137.2 - Availability of water.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Availability of water. 137.2 Section 137.2 Indians BUREAU... COSTS, SAN CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.2 Availability of water. Pursuant to section... notice to announce when water is actually available for lands in private ownership under the project...

  6. Selective cesium removal from radioactive liquid waste by crown ether immobilized new class conjugate adsorbent

    Energy Technology Data Exchange (ETDEWEB)

    Awual, Md. Rabiul, E-mail: awual.rabiul@jaea.go.jp [Actinide Coordination Chemistry Group, Quantum Beam Science Centre (QuBS), Japan Atomic Energy Agency (SPring-8), Hyogo 679-5148 (Japan); Yaita, Tsuyoshi [Actinide Coordination Chemistry Group, Quantum Beam Science Centre (QuBS), Japan Atomic Energy Agency (SPring-8), Hyogo 679-5148 (Japan); Taguchi, Tomitsugu [Nano-Structure Synthesis Research Group, Quantum Beam Science Centre (QuBS), Japan Atomic Energy Agency, Tokai-mura, Ibaraki-ken 319-1195 (Japan); Shiwaku, Hideaki; Suzuki, Shinichi; Okamoto, Yoshihiro [Actinide Coordination Chemistry Group, Quantum Beam Science Centre (QuBS), Japan Atomic Energy Agency (SPring-8), Hyogo 679-5148 (Japan)

    2014-08-15

    Graphical abstract: - Highlights: • DB24C8 crown ether was functionalized for preparation of conjugate adsorbent. • Radioactive {sup 137}Cs can be selectively removed by the conjugate adsorbent. • Adsorbent can effectively capture Cs even in the presence of a high amount Na and K. • Adsorbent is reversible and able to be reused without significant deterioration. - Abstract: Conjugate materials can provide chemical functionality, enabling an assembly of the ligand complexation ability to metal ions that are important for applications, such as separation and removal devices. In this study, we developed ligand immobilized conjugate adsorbent for selective cesium (Cs) removal from wastewater. The adsorbent was synthesized by direct immobilization of dibenzo-24-crown-8 ether onto inorganic mesoporous silica. The effective parameters such as solution pH, contact time, initial Cs concentration and ionic strength of Na and K ion concentrations were evaluated and optimized systematically. This adsorbent was exhibited the high surface area-to-volume ratios and uniformly shaped pores in case cavities, and its active sites kept open functionality to taking up Cs. The obtained results revealed that adsorbent had higher selectivity toward Cs even in the presence of a high concentration of Na and K and this is probably due to the Cs–π interaction of the benzene ring. The proposed adsorbent was successfully applied for radioactive Cs removal to be used as the potential candidate in Fukushima nuclear wastewater treatment. The adsorbed Cs was eluted with suitable eluent and simultaneously regenerated into the initial form for the next removal operation after rinsing with water. The adsorbent retained functionality despite several cycles during sorption-elution-regeneration operations.

  7. Electrochemical assessment of water|ionic liquid biphasic systems towards cesium extraction from nuclear waste.

    Science.gov (United States)

    Stockmann, T Jane; Zhang, Jing; Montgomery, Anne-Marie; Ding, Zhifeng

    2014-04-22

    A room temperature ionic liquid (IL) composed of a quaternary alkylphosphonium (trihexyltetradecylphosphonium, P66614(+)) and tetrakis(pentafluorophenyl)borate anion (TB(-)) was employed within a water|P66614TB (w|P66614TB or w|IL) biphasic system to evaluate cesium ion extraction in comparison to that with a traditional water|organic solvent (w|o) combination. (137)Cs is a major contributor to the radioactivity of spent nuclear fuel as it leaves the reactor, and its extraction efficiency is therefore of considerable importance. The extraction was facilitated by the ligand octyl(phenyl)-N,N'-diisobutylcarbamoylphosphine oxide (CMPO) used in TRans-Uranium EXtraction processes and investigated through well established liquid|liquid electrochemistry. This study gave access to the metal ion to ligand (1:n) stoichiometry and overall complexation constant, β, of the interfacial complexation reaction which were determined to be 1:3 and 1.6×10(11) at the w|P66614TB interface while the study at w|o elicited an n equal to 1 with β equal to 86.5. Through a straightforward relationship, these complexation constant values were converted to distribution coefficients, δ(α), with the ligand concentrations studied for comparison to other studies present in the literature; the w|o and w|IL systems gave δ(α) of 2 and 8.2×10(7), respectively, indicating a higher overall extraction efficiency for the latter. For the w|o system, the metal ion-ligand stoichiometries were confirmed through isotopic distribution analysis of mass spectra obtained by the direct injection of an emulsified water-organic solvent mixture into an electron spray ionization mass spectrometer.

  8. Foliar uptake of cesium from the water column by aquatic macrophytes.

    Science.gov (United States)

    Pinder, J E; Hinton, T G; Whicker, F W

    2006-01-01

    The probable occurrence and rate of foliar absorption of stable cesium (133Cs) from the water column by aquatic macrophyte species was analyzed following the addition of 133Cs into a small reservoir near Aiken, South Carolina, USA. An uptake parameter u (10(3)Lkg(-1)d(-1)) and a loss rate parameter k (d(-1)) were estimated for each species using time series of 133Cs concentrations in the water and plant tissues. Foliar uptake, as indicated by rapid increases in plant concentrations following the 133Cs addition, occurred in two floating-leaf species, Brasenia schreberi and Nymphaea odorata, and two submerged species, Myriophyllum spicatum and Utricularia inflata. These species had values of u> or =0.75 x 10(3)Lkg(-1)d(-1). Less evidence for foliar uptake was observed in three emergent species, including Typha latifolia. Ratios of u to k for B. schreberi, M. spicatum, N. odorata and U. inflata can be used to estimate concentration ratios (CR) at equilibrium, and these estimates were generally within a factor of 2 of the CR for 137Cs for these species in the same reservoir. This correspondence suggests that foliar uptake of Cs was the principal absorption mechanism for these species. Assessments of: (1) the prevalence of foliar uptake of potassium, rubidium and Cs isotopes by aquatic macrophytes and (2) the possible importance of foliar uptake of Cs in other lentic systems are made from a review of foliar uptake studies and estimation of comparable u and k values from lake studies involving Cs releases.

  9. Foliar uptake of cesium from the water column by aquatic macrophytes

    Energy Technology Data Exchange (ETDEWEB)

    Pinder, J.E. [Savannah River Ecology Laboratory, University of Georgia, Drawer E, Aiken, SC 29801 (United States); Hinton, T.G. [Savannah River Ecology Laboratory, University of Georgia, Drawer E, Aiken, SC 29801 (United States)]. E-mail: thinton@srel.edu; Whicker, F.W. [Department of Environmental and Radiological Health Sciences, Colorado State University, Fort Collins, CO 80523-1618 (United States)

    2006-07-01

    The probable occurrence and rate of foliar absorption of stable cesium ({sup 133}Cs) from the water column by aquatic macrophyte species was analyzed following the addition of {sup 133}Cs into a small reservoir near Aiken, South Carolina, USA. An uptake parameter u (10{sup 3} L kg{sup -1} d{sup -1}) and a loss rate parameter k (d{sup -1}) were estimated for each species using time series of {sup 133}Cs concentrations in the water and plant tissues. Foliar uptake, as indicated by rapid increases in plant concentrations following the {sup 133}Cs addition, occurred in two floating-leaf species, Brasenia schreberi and Nymphaea odorata, and two submerged species, Myriophyllum spicatum and Utricularia inflata. These species had values of u {>=} 0.75 x 10{sup 3} L kg{sup -1} d{sup -1}. Less evidence for foliar uptake was observed in three emergent species, including Typha latifolia. Ratios of u to k for B. schreberi, M. spicatum, N. odorata and U. inflata can be used to estimate concentration ratios (CR) at equilibrium, and these estimates were generally within a factor of 2 of the CR for {sup 137}Cs for these species in the same reservoir. This correspondence suggests that foliar uptake of Cs was the principal absorption mechanism for these species. Assessments of: (1) the prevalence of foliar uptake of potassium, rubidium and Cs isotopes by aquatic macrophytes and (2) the possible importance of foliar uptake of Cs in other lentic systems are made from a review of foliar uptake studies and estimation of comparable u and k values from lake studies involving Cs releases.

  10. Plutonium, (137)Cs and uranium isotopes in Mongolian surface soils.

    Science.gov (United States)

    Hirose, K; Kikawada, Y; Igarashi, Y; Fujiwara, H; Jugder, D; Matsumoto, Y; Oi, T; Nomura, M

    2017-01-01

    Plutonium ((238)Pu and (239,240)Pu), (137)Cs and plutonium activity ratios ((238)Pu/(239,240)Pu) as did uranium isotope ratio ((235)U/(238)U) were measured in surface soil samples collected in southeast Mongolia. The (239,240)Pu and (137)Cs concentrations in Mongolian surface soils (surface soils (0.013-0.06) coincided with that of global fallout. The (235)U/(238)U atom ratios in the surface soil show the natural one. There was a good correlation between the (239,240)Pu and (137)Cs concentrations in the surface soils. We introduce the migration depth to have better understanding of migration behaviors of anthropogenic radionuclides in surface soil. We found a difference of the migration behavior between (239,240)Pu and (137)Cs from (137)Cs/(239,240)Pu - (137)Cs plots for the Mongolian and Tsukuba surface soils; plutonium in surface soil is migrated easier than (137)Cs.

  11. Uptake of 137Cs by Leafy Vegetables and Grains from Calcareous Soils

    Energy Technology Data Exchange (ETDEWEB)

    Robison, W; Hamilton, T; Conrado, C; Kehl, S

    2004-04-19

    Cesium-137 was deposited on Bikini Island at Bikini Atoll in 1954 as a result of nuclear testing and has been transported and cycled in the ecosystem ever since. Atoll soils are of marine origin and are almost pure CaCO{sub 3} with high concentrations of organic matter in the top 40 cm. Data from previous experiments with mature fruit trees show very high transfer factors (TF's), [Bq g{sup -1} plant/ Bq g{sup -1} soil, both in dry weight] into fruits from atoll calcareous soil. These TF's are much higher than reported for continental, silica-based soils. In this report TF's for 5 types of leafy vegetable crops and 2 types of grain crops are provided for use in predictive dose assessments and for comparison with other data from other investigators working with other types of soil in the IAEA CRP ''The Classification of Soil Systems on the Basis of Transfer Factors of Radionuclides from Soil to Reference Plants''. Transfer factors for plants grown on calcareous soil are again very high relative to clay-containing soils and range from 23 to 39 for grain crops and 21 to 113 for leafy vegetables. Results from these experiments, in this unique, high pH, high organic content, low potassium (K) soil, provide a boundary condition for models relating soil properties to TF.

  12. Distribution and ratios of {sup 137}Cs and K in control and K-treated coconut trees at Bikini Island where nuclear test fallout occurred: effects and implications

    Energy Technology Data Exchange (ETDEWEB)

    Robison, William L. [Lawrence Livermore National Laboratory, 7000 East Avenue, L-642, Livermore, CA 94550-9234 (United States)], E-mail: robison1@llnl.gov; Brown, Patrick H. [University of California, Department of Plant Sciences, Davis, CA 95819 (United States); Stone, Earl L. [University of Florida (United States); Hamilton, Terry F.; Conrado, Cynthia L.; Kehl, Steven [Lawrence Livermore National Laboratory, 7000 East Avenue, L-642, Livermore, CA 94550-9234 (United States)

    2009-01-15

    Coconut trees growing on atolls of the Bikini Islands are on the margin of K deficiency because the concentration of exchangeable K in coral soil is very low, ranging from only 20 to 80 mg kg{sup -1}. When provided with additional K, coconut trees absorb large quantities of K and this uptake of K significantly alters the patterns of distribution of {sup 137}Cs within the plant. Following a single K fertilization event, mean total K in trunks of K-treated trees is 5.6 times greater than in trunks of control trees. In contrast, {sup 137}Cs concentration in trunks of K-treated and control trees is statistically the same while {sup 137}Cs is significantly lower in edible fruits of K-treated trees. Within one year after fertilization (one rainy season), K concentration in soil is back to naturally low concentrations. However, the tissue concentrations of K in treated trees stays very high internally in the trees for years while {sup 137}Cs concentration in treated trees remains very low in all tree compartments except for the trunk. Potassium fertilization did not change soil Cs availability. Mass balance calculations suggest that the fertilization event increased above ground plant K content by at least a factor of 5 (2.2 kg). Potassium concentrations and content were higher in all organs of K-fertilized trees with the greatest increases seen in organs that receive a portion of tissue K through xylem transport (trunk, fronds and fruit husks) and lowest in organs supplied predominantly with K via the phloem (palm heart, spathe, coco meat and fluid). The {sup 137}Cesium concentrations and contents were dramatically lower in all organs of K-treated trees with greatest proportional reductions observed in organs supplied predominantly with K via the phloem (palm heart, spathe, coco meat and fluid). All trees remobilize both K and {sup 137}Cs from fronds as they proceed toward senescence. In control trees the reduction in concentration of K and {sup 137}Cs in fronds as they

  13. Distribution and Ratios of 137Cs and K in Control and K-treated Coconut Trees at Bikini Island where Nuclear Test Fallout Occurred: Effects and Implications

    Energy Technology Data Exchange (ETDEWEB)

    Robison, W L; Brown, P H; Stone, E L; Hamilton, T F; Conrado, C L; Kehl, S R

    2008-05-19

    Coconut trees growing on atolls of the Bikini Islands are on the margin of K deficiency because the concentration of exchangeable K in coral soil is very low ranging from only 20 to 80 mg kg{sup -1}. When provided with additional K, coconut trees absorb large quantities of K and this uptake of K significantly alters the patterns of distribution of {sup 137}Cs within the plant. Following a single K fertilization event, mean total K in trunks of K-treated trees is 5.6 times greater than in trunks of control trees. In contrast, {sup 137}Cs concentration in trunks of K-treated and control trees is statistically the same while {sup 137}Cs is significantly lower in edible fruits of K treated trees. Within one year after fertilization (one rainy season), K concentration in soil is back to naturally, low concentrations, however, the tissue concentrations of K in treated trees stays very high internally in the trees for years while {sup 137}Cs concentration in treated trees remains very low in all tree compartments except for the trunk. Potassium fertilization did not change soil Cs availability. Mass balance calculations suggest that the fertilization event increased above ground plant K content by at least a factor of 5 or 2.2 kg. Potassium concentrations and content were higher in all organs of K fertilized trees with the greatest increases seen in organs that receive a portion of tissue K through xylem transport (trunk, fronds and fruit husks) and lowest in organs supplied predominantly with K via the phloem (palm heart, spathe, coco meat and fluid). {sup 137}Cesium concentrations and contents were dramatically lower in all organs of K treated trees with greatest proportional reductions observed in organs supplied predominantly with K via the phloem (palm heart, spathe, coco meat and fluid). All trees remobilize both K and {sup 137}Cs from fronds as they proceed toward senescence. In control trees the reduction in concentration of K and {sup 137}Cs in fronds as they age

  14. Beef contamination by Cs-134 and Cs-137 in Japan, from the Fukushima Dai-ichi NPP accident

    Energy Technology Data Exchange (ETDEWEB)

    Kelecom, Alphonse; Cruz, Camila Oliveira da; Paulo Filho, Guilherme de Souza, E-mail: lararapls@hotmail.com, E-mail: camilabiouff@gmail.com, E-mail: akelecom@id.uff.br [Universidade Federal Fluminense (LARARA-PLS/UFF), Niteroi, RJ (Brazil). Lab. de Radiobiologia e Radiometria Pedro Lopes dos Santos; Pereira, Wagner de S., E-mail: pereiraws@gmail.com [Industrias Nucleares do Brasil (UNB), Pocos de Caldas, MG (Brazil). Servico de Radioprotecao. Grupo Multidisciplinar de Radioprotecao

    2013-07-01

    The most serious earthquake ever registered in Japan occurred on March 11, 2011; it was followed by a tsunami that flowed over the Prefectures of Miyagi and Fukushima destroying roads, cities and rice fields, but also knocking several nuclear power plants. The Dai-ichi plant was seriously damaged and considerable amounts of radioactivity were release contaminating atmosphere, soil, ocean and associated fauna and flora. A major environmental monitoring program started covering the Japanese territory and the sea along the coasts of Miyagi, Fukushima and Ibaraki. Thousands of measurements were released every day by Japanese authorities, the plant operator and Universities principally looking for the presence of I-131, C{sub s}-134 and C{sub s}-137. Drinking water and aliments were seriously contaminated. We here analyze data released during one year on I-131 and C{sub s}-134,137 radioactive concentrations in cattle meat. Along this period I-131, when observed, was present only in trace amounts, but the contamination by cesium isotopes exceeded legal Japanese limit in several Japanese prefectures, and became an acute national and international economic problem. (author)

  15. Rational Design of Cesium-Selective Ionophores and Chemosensors: Dihydrocalix[4]arene Crown-6 Ethers

    Energy Technology Data Exchange (ETDEWEB)

    Sachleben, Richard A.; Bryan, Jeffrey C.; Brown, Gilbert M.; Engle, Nancy L.; Haverlock, Tamara J.; Hay, Benjamin P.; Urvoas, Agathe; Moyer, Bruce A.

    2003-12-15

    Molecular mechanics calculations performed on calix[4]arene crown-6 ethers predict that the 1,3-dihydro derivatives will exhibit greater complementarity for potassium and cesium ions than the parent 1,3-dialkoxy calix crowns. The X-ray crystal structures of 1,3-alt bis-octyloxycalix[4]arene benzocrown-6 ether, dihydrocalix[4]arene benzocrown-6 ether, and the cesium nitrate complex of dihydrocalix[4]arene benzocrown-6 ether were determined. The cesium complex structure corresponds closely to the structure predicted by molecular mechanics. The dihydrocalix[4]arene crown-6 ethers exhibit enhanced cesium selectivity in the extraction of alkali metal salts and provide a platform for a highly sensitive and selective cesium chemosensor.

  16. [Variation in amount of radioactive cesium before and after cooking dry shiitake and beef].

    Science.gov (United States)

    Nabeshi, Hiromi; Tsutsumi, Tomoaki; Hachisuka, Akiko; Matsuda, Rieko

    2013-01-01

    We investigated the change of radioactive cesium content in food due to cooking in order to estimate the internal radiation exposure due to from radioactive materials in food. Our results revealed that soaking dry shiitake in water decreased the radioactive cesium content by about 50%, compared with that present in uncooked shiitake. Radioactive cesium in beef was decreased by about 10%, 12%, 60-65% and 80% by grilling, frying, boiling and stewing, respectively, compared to uncooked beef. For cooked beef, the decrease in the ratio of radioactive cesium was significantly different among the types of cooking. The decrease ratio of radioactive cesium in boiled and stewed beef was 8 times higher than that in grilled and fried beef.

  17. Characterizing optical dipole trap via fluorescence of trapped cesium atoms

    Institute of Scientific and Technical Information of China (English)

    LIU Tao; GENG Tao; YAN Shubin; LI Gang; ZHANG Jing; WANG Junmin; PENG Kunchi; ZHANG Tiancai

    2006-01-01

    Optical dipole trap (ODT) is becoming an important tool of manipulating neutral atoms. In this paper ODT is realized with a far-off resonant laser beam strongly focused in the magneto-optical trap (MOT) of cesium atoms. The light shift is measured by simply monitoring the fluorescence of the atoms in the magneto-optical trap and the optical dipole trap simultaneously. The advantages of our experimental scheme are discussed, and the effect of the beam waist and power on the potential of dipole trap as well as heating rate is analyzed.

  18. Polymorphisms in MIR137HG and microRNA-137-regulated genes influence gray matter structure in schizophrenia.

    Science.gov (United States)

    Wright, C; Gupta, C N; Chen, J; Patel, V; Calhoun, V D; Ehrlich, S; Wang, L; Bustillo, J R; Perrone-Bizzozero, N I; Turner, J A

    2016-02-02

    Evidence suggests that microRNA-137 (miR-137) is involved in the genetic basis of schizophrenia. Risk variants within the miR-137 host gene (MIR137HG) influence structural and functional brain-imaging measures, and miR-137 itself is predicted to regulate hundreds of genes. We evaluated the influence of a MIR137HG risk variant (rs1625579) in combination with variants in miR-137-regulated genes TCF4, PTGS2, MAPK1 and MAPK3 on gray matter concentration (GMC). These genes were selected based on our previous work assessing schizophrenia risk within possible miR-137-regulated gene sets using the same cohort of subjects. A genetic risk score (GRS) was determined based on genotypes of these four schizophrenia risk-associated genes in 221 Caucasian subjects (89 schizophrenia patients and 132 controls). The effects of the rs1625579 genotype with the GRS of miR-137-regulated genes in a three-way interaction with diagnosis on GMC patterns were assessed using a multivariate analysis. We found that schizophrenia subjects homozygous for the MIR137HG risk allele show significant decreases in occipital, parietal and temporal lobe GMC with increasing miR-137-regulated GRS, whereas those carrying the protective minor allele show significant increases in GMC with GRS. No correlations of GMC and GRS were found in control subjects. Variants within or upstream of genes regulated by miR-137 in combination with the MIR137HG risk variant may influence GMC in schizophrenia-related regions in patients. Given that the genes evaluated here are involved in protein kinase A signaling, dysregulation of this pathway through alterations in miR-137 biogenesis may underlie the gray matter loss seen in the disease.

  19. Predicting the long-term (137)Cs distribution in Fukushima after the Fukushima Dai-ichi nuclear power plant accident: a parameter sensitivity analysis.

    Science.gov (United States)

    Yamaguchi, Masaaki; Kitamura, Akihiro; Oda, Yoshihiro; Onishi, Yasuo

    2014-09-01

    Radioactive materials deposited on the land surface of Fukushima Prefecture from the Fukushima Dai-ichi Nuclear Power Plant explosion is a crucial issue for a number of reasons, including external and internal radiation exposure and impacts on agricultural environments and aquatic biota. Predicting the future distribution of radioactive materials and their fates is therefore indispensable for evaluation and comparison of the effectiveness of remediation options regarding human health and the environment. Cesium-137, the main radionuclide to be focused on, is well known to adsorb to clay-rich soils; therefore its primary transportation mechanism is in the form of soil erosion on the land surface and transport of sediment-sorbed contaminants in the water system. In this study, we applied the Soil and Cesium Transport model, which we have developed, to predict a long-term cesium distribution in the Fukushima area, based on the Universal Soil Loss Equation and simple sediment discharge formulas. The model consists of calculation schemes of soil erosion, transportation and deposition, as well as cesium transport and its future distribution. Since not all the actual data on parameters is available, a number of sensitivity analyses were conducted here to find the range of the output results due to the uncertainties of parameters. The preliminary calculation indicated that a large amount of total soil loss remained in slope, and the residual sediment was transported to rivers, deposited in rivers and lakes, or transported farther downstream to the river mouths. Most of the sediment deposited in rivers and lakes consists of sand. On the other hand, most of the silt and clay portions transported to river were transported downstream to the river mouths. The rate of sediment deposition in the Abukuma River basin was three times as high as those of the other 13 river basins. This may be due to the larger catchment area and more moderate channel slope of the Abukuma River basin

  20. Cation exchange applications of synthetic tobermorite for the immobilization and solidification of cesium and strontium in cement matrix

    Indian Academy of Sciences (India)

    O P Shrivastava; Rashmi Shrivastava

    2000-12-01

    Immobilization and solidification of hazardous cations like Cs137 and Sr90 are required while handling the radioactive waste of nuclear power plants. Efforts are on to find a fail proof method of safe disposal of nuclear wastes. In this context, various materials like borosilicate glass, zeolites, cements and synthetic rocks have been tried by several workers. This communication deals with the synthesis, characterization, cesium uptake capacity and leaching behaviour of synthetic alumina-substituted calcium silicate hydroxy hydrate, which are close to that obtained for the natural mineral, 11 Å tobermorite. The synthetic mineral show cation selectivity for Cs+ in presence of 500–1000 times concentrated solutions of Na+ , K+ , Mg2+, Ca2+ , Ba2+ and Sr2+. Although the ordinary portland cement (OPC) which is often used in waste management operations alone holds negligible amounts of Cs+ and Sr2+, the addition of alumina-substituted tobermorite to OPC enhances the retention power of cement matrix by drastically lowering the leach rate of cations.

  1. Adsorption of sodium and cesium on aggregates of C60

    Science.gov (United States)

    Harnisch, Martina; Daxner, Matthias; Scheier, Paul; Echt, Olof

    2016-09-01

    We explore the formation of C60 sodium and C60 cesium complexes in superfluid helium nanodroplets. Anomalies in mass spectra of these doped droplets reveal anomalies in the stability of ions. (C60) m Cs+ n ions ( m ≤ 6) are particularly abundant if they contain n = 6 m + 1 cesium atoms; (C60) m Cs2+ n dications ( m ≤ 3 or 5) are abundant if n = 6 m + 2. These findings are consistent with the notion that alkali metal atoms (A) transfer their valence electrons into the three-fold degenerate lowest unoccupied orbital of C60, resulting in particularly stable C60A6 building blocks. However, (C60) 4CsCs2+ n dications display an entirely different pattern; instead of an expected anomaly at n = 6 × 4 + 2 = 26 we observe a strong odd-even alternation starting at n = 6. Also surprising is the effect of adding one H2O or CO2 molecule to (C60) m Cs n mono- or dications; anomalies shift by two units as if the impurity were acting as an acceptor for two valence electrons from the alkali metal atoms.

  2. Kelvin probe studies of cesium telluride photocathode for AWA photoinjector

    Energy Technology Data Exchange (ETDEWEB)

    Wisniewski, Eric E., E-mail: ewisniew@anl.gov [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Velazquez, Daniel [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Yusof, Zikri, E-mail: zyusof@hawk.iit.edu [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Spentzouris, Linda; Terry, Jeff [Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Sarkar, Tapash J. [Rice University, 6100 Main, Houston, TX 77005 (United States); Harkay, Katherine [Accelerator Science Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States)

    2013-05-21

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (≈50nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating. -- Highlights: ► The correlation between Quantum Efficiency (QE) and work function. ► How QE and work function evolve together. ► Rejuvenation of the photocathode via heating and the effect on work function. ► The effects on the work function due to exposure to UV light.

  3. Morphological and electrical properties of zirconium vanadate doped with cesium

    Directory of Open Access Journals (Sweden)

    Marwa F. Elkady

    2014-09-01

    Full Text Available Cesium doped zirconium vanadate ZrV2O7 with different Cs dopant content (Cs/Zr varied from 0 to 0.5 in weight ratio were fabricated by hydrothermal technique at 120 °C for 60 min. The synthesized materials are thermally treated using microwave technique. The structural and morphological properties of the synthesized materials and thermally treated samples were investigated using XRD and SEM respectively. It was evident that all synthesized specimens have cubic phase structural without any extra phase but after heat treatment Orthorhombic phase appear with doped samples. However, the morphological structure of the doped synthesized materials has transferred from nanoparticles into rods aspect with heat treatment for the different dopant ratio. Moreover, the electrical properties of both the synthesized and thermally treated materials are studied by AC impedance measurements. The results indicated that the ionic conductivity of Cs-doped ZrV2O7 materials decreased by increasing the dopant ratio while that thermally treated samples the ionic conductivity increase by increasing the dopant ratio. Finally, the concentration of cesium dopants is found to play crucial role in tuning the morphology and electrical properties of nanostructures.

  4. Structure and bonding in crystalline cesium uranyl tetrachloride under pressure.

    Science.gov (United States)

    Osman, Hussien H; Pertierra, Pilar; Salvadó, Miguel A; Izquierdo-Ruiz, F; Recio, J M

    2016-07-21

    A thorough investigation of pressure effects on the structural properties of crystalline cesium uranyl chloride was performed by means of first-principles calculations within the density functional theory framework. Total energies, equilibrium geometries and vibrational frequencies were computed at selected pressures up to 50 GPa. Zero pressure results present good agreement with available experimental and theoretical data. Our calculated equation of state parameters reveal that Cs2UO2Cl4 is a high compressible material, similar to other ionic compounds with cesium cations, and displays a structural anisotropic behavior guided by the uranyl moiety. An unexpected variation of the U-O bond length, dUO, is detected as pressure is applied. It leads to a dUO-stretching frequency relationship that cannot be described by the traditional Badger's rule. Interestingly enough, it can be explained in terms of a change in the main factor controlling dUO. At low pressure, the charge transferred to the uranyl cation induces an increase of the bond length and a red shift of the stretching frequencies, whereas it is the mechanical effect of the applied pressure above 10 GPa that is the dominant factor that leads to a shortening of dUO and a blue shift of the stretching frequencies.

  5. Spectrally selective optical pumping in Doppler-broadened cesium atoms

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun-Hai; Zeng Xian-Jin; Li Qing-Meng; Huang Qiang; Sun Wei-Min

    2013-01-01

    The D1 line spectrally selective pumping process in Doppler-broadened cesium is analyzed by solving the optical Bloch equations.The process,described by a three-level model with the A scheme,shows that the saturation intensity of broadened atoms is three orders of magnitude larger than that of resting atoms.The |Fg =3> → |Fe-4> resonance pumping can result in the ground state |Fg =4,mF =4> sublevel having a maximum population of 0.157 and the population difference would be about 0.01 in two adjacent magnetic sublevels of the hyperfine (HF) state Fg =4.To enhance the anisotropy in the ground state,we suggest employing dichromatic optical HF pumping by adding a laser to excite D1 line |Fg =4> → |Fe =3>transition,in which the cesium magnetometer sensitivity increases by half a magnitude and is unaffected by the nonlinear Zeeman effect even in Earth's average magnetic field.

  6. Rationale for anti-CD137 cancer immunotherapy.

    Science.gov (United States)

    Makkouk, Amani; Chester, Cariad; Kohrt, Holbrook E

    2016-02-01

    The consideration of the complex interplay between the tumour microenvironment (TME) and the immune response is the key for designing effective immunotherapies. Therapeutic strategies that harness co-stimulatory receptors have recently gained momentum in the clinic. One such strategy with promising clinical applications is the targeting of CD137, a member of the tumour necrosis factor receptor superfamily. Its expression on both innate and adaptive immune cells, coupled with its unique ability to potentiate antitumour responses through modulating the TME and to ameliorate autoimmune responses, has established it as an appealing target. In this review, we will discuss the various CD137-targeted immunotherapeutics that have reached clinical development, with a focus on recent advances and novel modalities such as CD137 chimeric antigen receptors and CD137 bispecific antibodies. We will also highlight the effect of CD137 targeting on the TME and discuss the importance of probing TME changes for predicting and testing the efficacy of CD137-mediated immunotherapy.

  7. Equilibrium, kinetic and thermodynamic study of cesium adsorption onto nanocrystalline mordenite from high-salt solution.

    Science.gov (United States)

    Lee, Keun-Young; Park, Minsung; Kim, Jimin; Oh, Maengkyo; Lee, Eil-Hee; Kim, Kwang-Wook; Chung, Dong-Yong; Moon, Jei-Kwon

    2016-05-01

    In this study, the equilibrium, kinetics and thermodynamics of cesium adsorption by nanocrystalline mordenite were investigated under cesium contamination with high-salt solution, simulating the case of an operation and decommissioning of nuclear facilities or an accident during the processes. The adsorption rate constants were determined using a pseudo second-order kinetic model. The kinetic results strongly demonstrated that the cesium adsorption rate of nano mordenite is extremely fast, even in a high-salt solution, and much faster than that of micro mordenite. In the equilibrium study, the Langmuir isotherm model fit the cesium adsorption data of nano mordenite better than the Freundlich model, which suggests that cesium adsorption onto nano mordenite is a monolayer homogeneous adsorption process. The obtained thermodynamic parameters indicated that the adsorption involved a very stable chemical reaction. In particular, the combination of rapid particle dispersion and rapid cesium adsorption of the nano mordenite in the solution resulted in a rapid and effective process for cesium removal without stirring, which may offer great advantages for low energy consumption and simple operation.

  8. Dicty_cDB: AFK137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK137 (Link to dictyBase) - - - Contig-U13893-1 AFK137E (Link... Clone ID AFK137 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dict...DIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSR ISFNDICTKLKFDGTTQDIMFIIAKTIKDGVIDATXNYEGGYLQSRENIDAYSTQEPLHA FSNRIDICLKIHN...fissygdcsi*hknyslsiiiknflll*fil*ndk*ss*s*iniiists ysnikt***rssnny*fiieklfri*fi*tsr*iigqytipricikqsictlfllsr*...LNSSHKQLEKHHKTLLVVSEELFINFYPIVQLLMGEIPERNTFSQKQLKIA LKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSR ISFNDICT

  9. Preliminary Evaluation of Cesium Distribution for Wet Sieving Process Planned for Soil Decontamination in Japan - 13104

    Energy Technology Data Exchange (ETDEWEB)

    Enokida, Y.; Tanada, Y.; Hirabayashi, D. [Graduate School of Engineering, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan); Sawada, K. [EcoTopia Science Institute, Nagoya University, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan)

    2013-07-01

    For the purpose of decontaminating radioactive cesium from a huge amount of soil, which has been estimated to be 1.2x10{sup 8} m{sup 3} by excavating to a 5-cm depth from the surface of Fukushima Prefecture where a severe nuclear accident occurred at TEPCO's power generating site and has emitted a significant amount of radioactive materials, mainly radioactive cesium, a wet sieving process was selected as one of effective methods available in Japan. Some private companies have demonstrated this process for soil treatment in the Fukushima area by testing at their plants. The results were very promising, and a full-fledged application is expected to follow. In the present study, we spiked several aqueous samples containing soil collected from an industrial wet sieving plant located near our university for the recycling of construction wastes with non-radioactive cesium hydroxide. The present study provides scientific data concerning the effectiveness in volume reduction of the contaminated soil by a wet sieving process as well as the cesium distribution between the liquid phase and clay minerals for each sub-process of the full-scale one, but a simulating plant equipped with a process of coagulating sedimentation and operational safety fundamentals for the plant. Especially for the latter aspect, the study showed that clay minerals of submicron size strongly bind a high content of cesium, which was only slightly removed by coagulation with natural sedimentation (1 G) nor centrifugal sedimentation (3,700 G) and some of the cesium may be transferred to the effluent or recycled water. By applying ultracentrifugation (257,000 G), most of submicron clay minerals containing cesium was removed, and the cesium amount which might be transferred to the effluent or recycled water, could be reduced to less than 2.3 % of the original design by the addition of a cesium barrier consisting of ultracentrifugation or a hollow fiber membrane. (authors)

  10. High voltage holding in the negative ion sources with cesium deposition

    Energy Technology Data Exchange (ETDEWEB)

    Belchenko, Yu.; Abdrashitov, G.; Ivanov, A.; Sanin, A.; Sotnikov, O., E-mail: O.Z.Sotnikov@inp.nsk.su [Budker Institute of Nuclear Physics, Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation)

    2016-02-15

    High voltage holding of the large surface-plasma negative ion source with cesium deposition was studied. It was found that heating of ion-optical system electrodes to temperature >100 °C facilitates the source conditioning by high voltage pulses in vacuum and by beam shots. The procedure of electrode conditioning and the data on high-voltage holding in the negative ion source with small cesium seed are described. The mechanism of high voltage holding improvement by depletion of cesium coverage is discussed.

  11. Historical Cost Curves for Hydrogen Masers and Cesium Beam Frequency and Timing Standards

    Science.gov (United States)

    Remer, D. S.; Moore, R. C.

    1985-01-01

    Historical cost curves were developed for hydrogen masers and cesium beam standards used for frequency and timing calibration in the Deep Space Network. These curves may be used to calculate the cost of future hydrogen masers or cesium beam standards in either future or current dollars. The cesium beam standards are decreasing in cost by about 2.3% per year since 1966, and hydrogen masers are decreasing by about 0.8% per year since 1978 relative to the National Aeronautics and Space Administration inflation index.

  12. The Diagnostics Of Hydrogen-Cesium Plasma Using Fully Relativistic Electron Impact Cross Sections

    Science.gov (United States)

    Priti, Priti; Dipti, Dipti; Gangwar, Reetesh; Srivastava, Rajesh

    2016-10-01

    Electron excitation cross-sections and rate coefficients have been calculated using fully relativistic distorted wave theory for several fine-structure transitions from the ground as well as excited states of cesium atom in the wide range of incident electron energy. These processes play dominant role in low pressure hydrogen-cesium plasma relevant to the negative ion based neutral beam injectors for the ITER project. The calculated cross-sections are used to construct a reliable collisional radiative (CR) model to characterize the hydrogen-cesium plasma. The calculated plasma parameters are compared with the available experimental and theoretical results.

  13. Fission of Multiply Charged Cesium and Potassium Clusters in Helium Droplets - Approaching the Rayleigh Limit

    OpenAIRE

    Renzler, Michael; Harnisch, Martina; Daxner, Matthias; Kranabetter, Lorenz; Kuhn, Martin; Scheier, Paul; Echt, Olof

    2016-01-01

    Electron ionization of helium droplets doped with cesium or potassium results in doubly and, for cesium, triply charged cluster ions. The smallest observable doubly charged clusters are $Cs_{9}^{2+}$ and $K_{11}^{2+}$; they are a factor two smaller than reported previously. The size of potassium dications approaches the Rayleigh limit nRay for which the fission barrier is calculated to vanish, i.e. their fissilities are close to 1. Cesium dications are even smaller than nRay, implying that th...

  14. Test procedures and instructions for single shell tank saltcake cesium removal with crystalline silicotitanate

    Energy Technology Data Exchange (ETDEWEB)

    Duncan, J.B.

    1997-01-07

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Single Shell Tank Saltcake from tanks 24 t -BY- I 10, 24 1 -U- 108, 24 1 -U- 109, 24 1 -A- I 0 1, and 24 t - S-102, in a bench-scale column. The cesium sorbent to be tested is crystalline siticotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-024, Hanford Single Shell Tank Saltcake Cesium Removal Test Plan.

  15. Effect of Rare Earth Elements on Exchange Performances of Cesium Ion-Sieve

    Institute of Scientific and Technical Information of China (English)

    张惠源; 王榕树; 林灿生; 张先业

    2003-01-01

    The exchange performances and the distribution coefficient of Cesium Ion-Sieve (Cs-IS) for cesium and for some rare earth elements were compared. In particular, the effects of neodymium on the cesium ion exchange and the Cs+ selectivity variation on Cs-IS owing to introduction of rare earth elements into HLLW were studied. Though rare earth elements exhibit a small influence on the distribution coefficient for Cs+, they impair Cs-exchange capacity of Cs-IS to some extent. This interruption on the selectivity to Cs+ can be significantly eliminated provided an appropriate ratio of liquid to solid V:m is used.

  16. Cesium leaching from {gamma}-irradiated CsA and CsX zeolites

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Enrique [Universidad Autonoma Metropolitana, Iztapalapa, A. P. 55-532, Av. San Rafael Atlixco No. 186 Col. Vicentina, 09340 Mexico, D.F. (Mexico)], E-mail: lima@xanum.uam.mx; Ibarra, Ilich A.; Lara, Victor [Universidad Autonoma Metropolitana, Iztapalapa, A. P. 55-532, Av. San Rafael Atlixco No. 186 Col. Vicentina, 09340 Mexico, D.F. (Mexico); Bosch, Pedro [Instituto de Investigaciones en Materiales, A. P. 70-360, Universidad Nacional Autonoma de Mexico, Circuito Exterior, Ciudad Universitaria, 04510 Mexico, D.F. (Mexico); Bulbulian, Silvia [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, Col. Escandon, Delegacion Miguel Hidalgo, 11801 Mexico, D.F. (Mexico)

    2008-12-30

    The present study discusses the effect of {gamma}-irradiation on Cs{sup +}-exchanged X and A zeolites. The incorporation of Cs{sup +} ions into A and X zeolites was performed using three different cesium salts (chloride, nitrate or acetate). Cs{sup +} ions immobilized into the vitrified zeolites by thermal treatment are located in different sites of the zeolite networks. It is found that {gamma}-irradiation favors cesium retention depending on the cesium precursor salt used in the cationic exchange step.

  17. First-principles study of cesium adsorption to weathered micaceous clay minerals

    Science.gov (United States)

    Okumura, Masahiko; Nakamura, Hiroki; Machida, Masahiko

    2014-05-01

    A large amount of radioactive nuclides was produced into environment due to the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident. Residents near FDNPP were suffering from radioactive cesium and then evacuated, because which has long half-life and is retained by surface soil for long time. The Japanese government has been decontaminating the cesium by removing the surface soil in order to return them to their home. This decontamination method is very effective, but which produces huge amount of waste soil. This becomes another big problem in Fukushima, because it is not easy to find large storage sites. Then effective and economical methods to reduce the volume of the waste soil are needed. However, it has not been invented yet. One of the reasons is lack of knowledge about microscopic process of adsorption/desorption of cesium to/from soil. It is known that weathered micaceous clay minerals play crucial role on adsorption and retention of cesium. They are expected to have special sorption sites, called frayed edge sites (FESs), which adsorb cesium selectively and irreversibly. Properties of FES have been intensely investigated by experiments. But microscopic details of the adsorption process on FES are still unclear. Because direct observation of the process with current experimental techniques is quite difficult. We investigated the adsorption of cesium to FES in muscovite, which is a typical micaceous clay mineral, via first-principles calculations (density functional theory). We made a minimal model of FES and evaluate the energy difference before and after cesium adsorption to FES. This is the first numerical modeling of FES. It was shown that FES does adsorb cesium if the weathering of muscovite has been weathered. In addition, we revealed the mechanism of cesium adsorption to FES, which is competition between ion radius of cesium and the degree of weathering. I plan to discuss volume reduction of the waste soil based on our result. Reference M. Okumura

  18. A New Pumping-Probing Scheme for the Optically Pumped Cesium Beam Frequency Standard

    Institute of Scientific and Technical Information of China (English)

    陈景标; 朱程锦; 王凤芝; 杨东海

    2001-01-01

    A new pumping-probing scheme for the optically pumped cesium beam frequency standard has been experimentally tested in our laboratory. The stability of the optically pumped cesium beam frequency standard was measured by comparing its 10 MHz output with an HP5071A commercial cesium atomic clock. The result shows that the frequency stability for the 1 s and 30000s sample times are 1.2 × 10-11 and 3.7 × 10-13, respectively. It was proved that the new pumping scheme works well.

  19. Adsorption mechanisms of radioactive cesium and selenium in rocks

    Energy Technology Data Exchange (ETDEWEB)

    Fujikawa, Yoko; Fukui, Masami [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.

    1996-04-01

    The effect of Cl{sup -}, SO{sub 4}{sup 2-}, HCO{sub 3}{sup -}, CO{sub 3}{sup 2-} and pH on adsorption kinetics of {sup 75}Se and {sup 137}Cs was studied. Surface chelate model was applied to interprete adsorption experiment. (J.P.N.)

  20. The effective and environmental half-life of {sup 137}Cs at Coral Islands at the former US nuclear test site

    Energy Technology Data Exchange (ETDEWEB)

    Robison, William L. E-mail: robison1@llnl.gov; Conrado, Cynthia L.; Bogen, Kenneth T.; Stoker, A. Carol

    2003-07-01

    The United States (US) conducted nuclear weapons testing from 1946 to 1958 at Bikini and Enewetak Atolls in the northern Marshall Islands. Based on previous detailed dose assessments for Bikini, Enewetak, Rongelap, and Utirik Atolls over a period of 28 years, cesium-137 ({sup 137}Cs) at Bikini Atoll contributes about 85-89% of the total estimated dose through the terrestrial food chain as a result of uptake of {sup 137}Cs by food crops. The estimated integral 30, 50, and 70-year doses were based on the radiological decay of {sup 137}Cs (30-year half-life) and other radionuclides. However, there is a continuing inventory of {sup 137}Cs and {sup 90}Sr in the fresh water portion of the groundwater at all contaminated atolls even though the turnover rate of the fresh groundwater is about 5 years. This is evidence that a portion of the soluble fraction of {sup 137}Cs and {sup 90}Sr inventory in the soil is lost by transport to groundwater when rainfall is heavy enough to cause recharge of the lens, resulting in loss of {sup 137}Cs from the soil column and root zone of the plants. This loss is in addition to that caused by radioactive decay. The effective rate of loss was determined by two methods: (1) indirectly, from time-dependent studies of the {sup 137}Cs concentration in leaves of Pisonia grandis, Guettarda specosia, Tournefortia argentea (also called Messerschmidia), Scaevola taccada, and fruit from Pandanus and coconut trees (Cocos nucifera L.), and (2) more directly, by evaluating the {sup 137}Cs/{sup 90}Sr ratios at Bikini Atoll. The mean (and its lower and upper 95% confidence limits) for effective half-life and for environmental-loss half-life (ELH) based on all the trees studied on Rongelap, Bikini, and Enewetak Atolls are 8.5 years (8.0 years, 9.8 years), and 12 years (11 years, 15 years), respectively. The ELH based on the {sup 137}Cs/{sup 90}Sr ratios in soil in 1987 relative to the{sup 137}Cs/{sup 90}Sr ratios at the time of deposition in 1954 is less

  1. Total Absorption Spectroscopy of the 137Xe, 137I, and 92Rb β-Decays

    Science.gov (United States)

    Rasco, B. C.; Fijałkowska, A.; Karny, M.; Rykaczewski, K. P.; Wolińska-Cichocka, M.; Goetz, K. C.; Grzywacz, R. K.; Gross, C. J.; Miernik, K.; Stracener, D.

    2015-10-01

    The NaI(Tl) based Modular Total Absorption Spectrometer (MTAS) was constructed to measure improved β-decay feeding patterns from neutron-rich nuclei. It is difficult to measure β-decay feeding intensities with high precision γ-ray measurements due to the low efficiency of high precision detectors. There are several important applications of improved measurements of β-decay feeding patterns by total absorption spectroscopy; improve understanding of elemental abundances in the universe, help with stockpile stewardship, contribute to understanding of underlying nuclear structure, and improve β-decay feeding measurements to calculate accurately the νe spectra needed to evaluate precisely reactor neutrino measurements. We present β-decay feeding results for two ``priority one'' measurements, 137Xe and 137I, and for 92Rb, which is a large individual contributor to the νe uncertainty of the reactor anomaly. In addition to β- γ decays, 137I has a β-neutron decay channel which is measurable in MTAS. We will demonstrate techniques for analyzing MTAS γ-decay data. We will also describe β and neutron spectroscopy in MTAS. This work was supported by the US DOE by Award No. DE-FG02- 96ER40978 and by US DOE, Office of Nuclear Physics.

  2. Ion microscopy based on laser-cooled cesium atoms.

    Science.gov (United States)

    Viteau, M; Reveillard, M; Kime, L; Rasser, B; Sudraud, P; Bruneau, Y; Khalili, G; Pillet, P; Comparat, D; Guerri, I; Fioretti, A; Ciampini, D; Allegrini, M; Fuso, F

    2016-05-01

    We demonstrate a prototype of a Focused Ion Beam machine based on the ionization of a laser-cooled cesium beam and adapted for imaging and modifying different surfaces in the few-tens nanometer range. Efficient atomic ionization is obtained by laser promoting ground-state atoms into a target excited Rydberg state, then field-ionizing them in an electric field gradient. The method allows obtaining ion currents up to 130pA. Comparison with the standard direct photo-ionization of the atomic beam shows, in our conditions, a 40-times larger ion yield. Preliminary imaging results at ion energies in the 1-5keV range are obtained with a resolution around 40nm, in the present version of the prototype. Our ion beam is expected to be extremely monochromatic, with an energy spread of the order of the eV, offering great prospects for lithography, imaging and surface analysis.

  3. Coherence properties of nanofiber-trapped cesium atoms.

    Science.gov (United States)

    Reitz, D; Sayrin, C; Mitsch, R; Schneeweiss, P; Rauschenbeutel, A

    2013-06-14

    We experimentally study the ground state coherence properties of cesium atoms in a nanofiber-based two-color dipole trap, localized ∼ 200 nm away from the fiber surface. Using microwave radiation to coherently drive the clock transition, we record Ramsey fringes as well as spin echo signals and infer a reversible dephasing time of T(2)(*) = 0.6 ms and an irreversible dephasing time of T(2)(') = 3.7 ms. By modeling the signals, we find that, for our experimental parameters, T(2)(*) and T(2)(') are limited by the finite initial temperature of the atomic ensemble and the heating rate, respectively. Our results represent a fundamental step towards establishing nanofiber-based traps for cold atoms as a building block in an optical fiber quantum network.

  4. Coherence properties of nanofiber-trapped cesium atoms

    CERN Document Server

    Reitz, D; Mitsch, R; Schneeweiss, P; Rauschenbeutel, A

    2013-01-01

    We experimentally study the ground state coherence properties of cesium atoms in a nanofiber-based two-color dipole trap, localized 200 nm away from the fiber surface. Using microwave radiation to coherently drive the clock transition, we record Ramsey fringes as well as spin echo signals and infer a reversible dephasing time $T_2^\\ast=0.6$ ms and an irreversible dephasing time $T_2^\\prime=3.7$ ms. By theoretically modelling the signals, we find that, for our experimental parameters, $T_2^\\ast$ and $T_2^\\prime$ are limited by the finite initial temperature of the atomic ensemble and the heating rate, respectively. Our results represent a fundamental step towards establishing nanofiber-based traps for cold atoms as a building block in an optical fiber quantum network.

  5. Morphological effects in the quantum yield of cesium iodide

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, J. [Ecole Politechnique Federale, Lausanne (Switzerland). DP-IPA PH-Ecublens; Barbo, F. [Sincrotrone Trieste SpA, Padriciano 99, 34012 Trieste (Italy); Bertolo, M. [Sincrotrone Trieste SpA, Padriciano 99, 34012 Trieste (Italy); Bianco, A. [Sincrotrone Trieste SpA, Padriciano 99, 34012 Trieste (Italy); Braem, A. [European Organization for Nuclear Research, Geneva (Switzerland). Div. Particle Physics Experiments; Cerasari, S. [Sincrotrone Trieste SpA, Padriciano 99, 34012 Trieste (Italy); Coluzza, C. [Ecole Politechnique Federale, Lausanne (Switzerland). DP-IPA PH-Ecublens; Dell`Orto, T. [Ecole Politechnique Federale, Lausanne (Switzerland). DP-IPA PH-Ecublens; Fontana, S. [Sincrotrone Trieste SpA, Padriciano 99, 34012 Trieste (Italy); Margaritondo, G. [Ecole Politechnique Federale, Lausanne (Switzerland). DP-IPA PH-Ecublens; Nappi, E. [Istituto Nazionale di Fisica Nucleare, Bari (Italy); Paic, G. [European Organization for Nuclear Research, Geneva (Switzerland). Div. Particle Physics Experiments; Piuz, F. [European Organization for Nuclear Research, Geneva (Switzerland). Div. Particle Physics Experiments; Sanjines, R. [Ecole Politechnique Federale, Lausanne (Switzerland). DP-IPA PH-Ecublens; Scognetti, T. [Istituto Nazionale di Fisica Nucleare, Bari (Italy); Sgobba, S. [European Organization for Nuclear Research, Geneva (Switzerland). Div. Particle Physics Experiments

    1995-07-15

    We demonstrated that polycrystalline cesium iodide (CsI) on large area Ni/Au coated printed board provides a quantum efficiency (QE) higher by a factor of 2 than the films deposited on the standard Cu/Au printed circuits. This is the most important result of the present systematic study of the QE lateral inhomogeneity for CsI on different substrates. We found a strong correlation between the QE lateral variation and the morphological homogeneity of the films. The QE was measured by UV photoelectron emission microscopy and spatially resolved X-ray photoemission, and the morphology studies were performed by secondary electron microscopy, X-ray diffraction and scanning tunneling microscopy. (orig.).

  6. Hyperfine relaxation of an optically pumped cesium vapor

    Energy Technology Data Exchange (ETDEWEB)

    Tornos, J.; Amare, J.C.

    1986-07-01

    The relaxation of hyperfine orientation indirectly induced by optical pumping with a sigma-polarized D/sub 1/-light in a cesium vapor in the presence of Ar is experimentally studied. The detection technique ensures the absence of quadrupole relaxation contributions in the relaxation signals. The results from the dependences of the hyperfine relaxation rate on the temperature and argon pressure are: diffusion coefficient of Cs in Ar, D/sub 0/ = 0.101 +- 0.010 cm/sup 2/s/sup -1/ at 0/sup 0/C and 760 Torr; relaxation cross section by Cs-Ar collisions, sigma/sub c/ = (104 +- 5) x 10/sup -23/ cm/sup 2/; relaxation cross section by Cs-Cs (spin exchange) collisions, sigma/sub e//sub x/ = (1.63 +- 0.13) x 10/sup -14/ cm/sup 2/.

  7. New Efimov resonances in an ultracold cesium gas

    Energy Technology Data Exchange (ETDEWEB)

    Zenesini, Alessandro; Berninger, Martin; Besler, Stefan; Naegerl, Hanns-Christoph; Ferlaino, Francesca [Institut fuer Experimentalphysik, Universitaet Innsbruck, 6020 Innsbruck (Austria); Huang, Bo; Grimm, Rudolf [Institut fuer Experimentalphysik, Universitaet Innsbruck, 6020 Innsbruck (Austria); Institut fuer Quantenoptik und Quanteninformation, Oesterreichische Akademie der Wissenschaften, 6020 Innsbruck (Austria)

    2011-07-01

    Efimov trimer states represent the paradigm of universality in few-body physics. Although these exotic three-body weakly-bound states have been experimentally investigated in an increasing number of ultracold atomic systems, many fundamental aspects remain unclear. An intriguing open question is related to how short-range physics influences the Efimov effect in real systems. Short range contributions are commonly included in universal theory via a single parameter, known as ''three-body parameter''. An open question is whether this parameter is constant or whether it can vary significantly when Feshbach resonances are employed for interaction tuning. Cesium is a very promising candidate to address this issue because of the many broad and narrow Feshbach resonances with different partial-wave character. Our experimental results reveal new Efimov features close to different Feshbach resonances and shed new light on the three-body parameter.

  8. Trade study for the disposition of cesium and strontium capsules

    Energy Technology Data Exchange (ETDEWEB)

    Claghorn, R.D.

    1996-03-01

    This trade study analyzes alternatives for the eventual disposal of cesium and strontium capsules currently stored at the Waste Encapsulation and Storage Facility as by-product. However, for purposes of this study, it is assumed that at some time in the future, the capsules will be declared high-level waste and therefore will require disposal at an offsite geologic repository. The study considered numerous alternatives and selected three for detailed analysis: (1) overpack and storage at high-level waste canister storage building, (2) overpack at the high-level waste vitrification facility followed by storage at a high-level waste canister storage building, and (3) blend capsule contents with other high-level waste feed streams and vitrify at the high-level waste vitrification facility.

  9. 21 CFR 133.137 - Washed curd cheese for manufacturing.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Washed curd cheese for manufacturing. 133.137... Standardized Cheese and Related Products § 133.137 Washed curd cheese for manufacturing. Washed curd cheese for manufacturing conforms to the definition and standard of identity prescribed for washed curd cheese by §...

  10. 14 CFR 21.137 - Location of manufacturing facilities.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Location of manufacturing facilities. 21.137 Section 21.137 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... manufacturing facilities. The Administrator does not issue a production certificate if the...

  11. Distribution and behavior of {sup 137}Cs in undisturbed soil

    Energy Technology Data Exchange (ETDEWEB)

    Satta, Naoya [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.

    1996-04-01

    The depth distribution of {sup 137}Cs in soils which has not been artificially disturbed for 100 years was compared to fallout history. The model of {sup 137}Cs distribution rate was established to estimate fallout history from soil samples. (J.P.N.)

  12. Identification of 137Cs Reference Sites in Southeastern China

    Institute of Scientific and Technical Information of China (English)

    TANG Xiang-Yu; YANG Hao; DU Ming-Yuan; ZHAO Qi-Guo; LI Ren-Ying

    2006-01-01

    The 137Cs vertical distributions in uncultivated and cultivated soils, developed from Quaternary red clay, granite,argillaceous shale, and red sandstone, were studied to develop reliable guidelines for selecting reference sites in southeastern China, which is dominated by strong acidic and/or clay-textured soils, and examine their reliability by comparing them to the reported 137Cs reference inventory data to see whether they agreed with the global distribution pattern. It was observed that a relatively high proportion of 137Cs was concentrated in the surface layers of soils with relatively high clay content. In the paddy soils developed from granite more 137Cs penetrated to depths below the plow layer (about 45.3%),when compared to those from the other three parent materials. The relatively low soil 137Cs inventories on crests excluded using the crest as the 137Cs reference site; instead the paddy field on the hillock plain was selected. Furthermore, within a specific county characterized by great systematic spatial variations of rainfall and topography across the landscape,a significant (P < 0.01) and positive linear relationship (r2 = 0.81) between local 137Cs inventory and corresponding local annual rainfall was observed. Thus, for areas with large variations in rainfall, a single uniform value of local 137Cs reference inventory should be used with caution.

  13. 21 CFR 146.137 - Frozen orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen orange juice. 146.137 Section 146.137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR..., except that it is frozen. (b) The name of the food is “Frozen orange juice”. Such name may be preceded...

  14. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing... metabolites. (b) Performance testing and quality control requirements for validity screening tests....

  15. 49 CFR 229.137 - Sanitation, general requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, general requirements. 229.137 Section... Cab Equipment § 229.137 Sanitation, general requirements. (a) Sanitation compartment. Except as provided in paragraph (b) of this section, all lead locomotives in use shall be equipped with a...

  16. The Multifarious Hippocampal Functions of MicroRNA-137

    NARCIS (Netherlands)

    Kos, A.; Aschrafi, A.; Nadif Kasri, N.

    2016-01-01

    MicroRNAs (miRs) have emerged as a powerful class of endogenous noncoding RNAs involved in posttranscriptional gene expression regulation. miR-137 has repeatedly been associated with schizophrenia and intellectual disability. Recent studies describe the mechanisms of miR-137 in mediating basic synap

  17. 49 CFR 37.137 - Paratransit plan development.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Paratransit plan development. 37.137 Section 37... WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.137 Paratransit plan... the plan to identify any person or entity (public or private) which provides a paratransit or...

  18. 40 CFR 49.137 - Rule for air pollution episodes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Rule for air pollution episodes. 49.137... of an air pollution emergency within the Indian reservation due to the effects of these air... Application to Indian Reservations in Epa Region 10 § 49.137 Rule for air pollution episodes. (a) What is...

  19. Accumulation and distribution 137Сs in predators’ organism

    Directory of Open Access Journals (Sweden)

    A. V. Gulakov

    2007-10-01

    Full Text Available Data of the long-term research of accumulation and distribution 137Cs radionuclide in organisms of predatory wild animals from the alienation zone of the Chernobyl nuclear power station are presented. Essential fluctuations of the 137Cs contents in muscular tissue are noted. The results have large practical value for management of the hunting facilities on the radioactively polluted territories.

  20. Fission of Multiply Charged Cesium and Potassium Clusters in Helium Droplets - Approaching the Rayleigh Limit

    CERN Document Server

    Renzler, Michael; Daxner, Matthias; Kranabetter, Lorenz; Kuhn, Martin; Scheier, Paul; Echt, Olof

    2016-01-01

    Electron ionization of helium droplets doped with cesium or potassium results in doubly and, for cesium, triply charged cluster ions. The smallest observable doubly charged clusters are $Cs_{9}^{2+}$ and $K_{11}^{2+}$; they are a factor two smaller than reported previously. The size of potassium dications approaches the Rayleigh limit nRay for which the fission barrier is calculated to vanish, i.e. their fissilities are close to 1. Cesium dications are even smaller than nRay, implying that their fissilities have been significantly overestimated. Triply charged cesium clusters as small as $Cs_{19}^{3+}$ are observed; they are a factor 2.6 smaller than previously reported. Mechanisms that may be responsible for enhanced formation of clusters with high fissilities are discussed.

  1. MODELING AN ION EXCHANGE PROCESS FOR CESIUM REMOVAL FROM ALKALINE RADIOACTIVE WASTE SOLUTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Smith, F; Luther Hamm, L; Sebastian Aleman, S; Johnston Michael, J

    2008-08-26

    The performance of spherical Resorcinol-Formaldehyde ion-exchange resin for the removal of cesium from alkaline radioactive waste solutions has been investigated through computer modeling. Cesium adsorption isotherms were obtained by fitting experimental data using a thermodynamic framework. Results show that ion-exchange is an efficient method for cesium removal from highly alkaline radioactive waste solutions. On average, two 1300 liter columns operating in series are able to treat 690,000 liters of waste with an initial cesium concentration of 0.09 mM in 11 days achieving a decontamination factor of over 50,000. The study also tested the sensitivity of ion-exchange column performance to variations in flow rate, temperature and column dimensions. Modeling results can be used to optimize design of the ion exchange system.

  2. Cold cesium molecules produced directly in a magneto-optical trap

    Institute of Scientific and Technical Information of China (English)

    Zhang Hong-Shan; Ji Zhong-Hua; Yuan Jin-Peng; Zhao Yan-Ting; Ma Jie; Wang Li-Rong; Xiao Lian-Tuan; Jia Suo-Tang

    2011-01-01

    We report on the observation of ultracold ground electric-state cesium molecules produced directly in a magnetooptical trap with a good signal-to-noise ratio.These molecules arise from the photoassociation of magneto-optical trap lasers and they are detected by resonantly enhanced multiphoton ionization technology.The production rate of ultracold cesium molecules is up to 4× 104 s-1.We measure the characteristic time of the ground electric-state cesium molecules generated in the experiment and investigate the Cs2+ molecular ion intensity as a function of the trapping laser intensity and the ionization pulse laser energy.We conclude that the production of cold cesium molecules may be enhanced by using appropriate experimental parameters,which is useful for future experiments involving the production and trapping of ultracold ground electric-state molecules.

  3. Synthesis of novel calix[4]crown telomers and selective extraction of cesium ions

    Institute of Scientific and Technical Information of China (English)

    Hai Bing Li; Yuan Yin Chen; De Jun Xiong; Jun Yan Zhan; Cui Ping Han

    2007-01-01

    p-tert-Butylcalix[4]diazacrown-4 telomer, which contains hard and soft ion binding sites, was synthesized. It exhibited high selectivity toward cesium ions. The binding sites may complex alkali metal ions selectively.

  4. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium.

    Science.gov (United States)

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru

    2012-05-30

    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  5. Cesium in Arctic char lakes - effects of the Chernobyl accident. Radioaktivt cesium i roedingsjoear - effekter av Tjernobylkatastrofen

    Energy Technology Data Exchange (ETDEWEB)

    Hammar, J. (Fiskeriverkets Soetvattenslaboratorium, Drottningholm (Sweden)); Notter, M.; Neumann, G. (Statens Naturvaardesverks Miljoekontrollaboratorium, Drottningholm (Sweden))

    1991-01-01

    Fallout radiocesium from the Chernobyl accident caused extensive contamination in a region of previously well studied alpine lake ecosystems in northern Sweden. Levels of Cs-137 in the barren catchment basins reached 20-50 kBq/m[sup 2] during 1986. The distribution, pathways and major transport mechanisms of radiocesium through the lake ecosystems were studied during 1986-1990. Levels of Cs-137, Cs-134 and K-40 in water, surface sediment, detritus (sediment traps) and different trophic levels of the food chains of Arctic char (Salvelinus alpinus) and brown trout (Salmo trutta) were monitored in a series of lakes forming a matrix of 4 natural lakes and 3 lake reservoirs, with or without the introduced new fish food organism, Mysis relicta. The reservoirs were found to act as sinks for radiocesium with extensive accumulation recorded in water, detritus, sediment, invertebrates and salmonids. Whereas concentrations in water and biota have declined from the extreme peak levels in 1986-1987, the levels in surface sediment increased extensively until fall of 1988. The concentration of Cs-137 in fish populations feeding on benthic invertebrates, i.e. mysids and amphipods, were significantly higher than in planktivorous fish. During the three first winters a significant increase in levels of Cs-137 in winter active Arctic char were recorded, whereas the levels declined during the succeeding summers. The introduced Mysis relicta were found to enhance the transport of Cs-137 from zooplankton and settling particles to Arctic char and brown trout. The results suggest a successive change in transport of radiocesium from water via zooplankton to planktivorous fish during the early summer of 1986 to post-depositional mobilization via benthic organisms to benthic fish in successive years. (213 refs.) (au).

  6. The behaviour of sup 137 Cs in some edible fruits

    Energy Technology Data Exchange (ETDEWEB)

    Monte, L.; Quaggia, S.; Pompei, F.; Fratarcangeli, S. (ENEA, Casaccia (Italy). Centro Ricerche Energia)

    1990-01-01

    The aim of this research was to study the behaviour of {sup 137}Cs in fruit-bearing plants following the Chernobyl accident. Samples of hazel-nuts were collected over a period of three years after the accident. The {sup 137}Cs content of the fruit shows an exponential decrease with time. Evaluation of the {sup 134}Cs/{sup 137}Cs ratios in samples of atmospheric particulates, soils and fruit suggests that foliar translocation is the main pathway for {sup 137}Cs migration to the fruit. In addition, estimates of the effective half-times of {sup 137}Cs in hazel-nuts, walnuts, olives and apples and of the 'translocation factors' for hazel-nuts, walnuts, olives, apples and chestnuts have been made. (author).

  7. Sediment environmental capacity of 137Cs in Daya Bay

    Institute of Scientific and Technical Information of China (English)

    ZHANG Junli; CHEN Jiajun; XU Jialin; LI Yuanxin; HUANG Naiming

    2007-01-01

    Sediment environmental capacity of pollutants is very important for marine environmental management.Based on the methodology of a study on water,soil environmental capacity,and mass conservation theory in a system,the concept and model on sediment environmental capacity for 137Cs in Daya Bay were developed.The static capacity for 137Cs in the upper sediment near the shore at a shallow area was calculated,and the annual dynamic capacity and total dynamic capacity were also calculated through determination of the typical biomass in the sediment.The results showed that the estimated environmental capacity for 137Cs in sediments was approximately equal to the current input of 137Cs into the sediments.Controlling the input of 137Cs in the sediments within the environmental capacity guarantees the sustainability of the current situation of the Daya Bay ecosystem and avoidance of a significant degradation of the system.

  8. Calculation of fully relativistic cross sections for electron excitation of cesium atom and its application to the diagnostics of hydrogen-cesium plasma

    Science.gov (United States)

    Priti; Dipti; Gangwar, R. K.; Srivastava, R.

    2017-01-01

    Electron impact excitation cross-sections and rate coefficients have been calculated using fully relativistic distorted wave theory for several fine-structure transitions from the ground as well as excited states of cesium atom in the wide range of incident electron energy. These processes play dominant role in low pressure hydrogen-cesium plasma, which is relevant to the negative ion based neutral beam injectors for the ITER project. As an application, the calculated detailed cross-sections are used to construct a reliable collisional radiative (CR) model to characterize the hydrogen-cesium plasma. Other processes such as radiative population transfer, electron impact ionization and mutual neutralization of Cs+ ion with negative hydrogen ion along with their reverse processes are also taken into account. The calculated cross-sections and the extracted plasma parameters from the present model are compared with the available experimental and theoretical results.

  9. Synergistically strengthened 3D micro-scavenger cage adsorbent for selective removal of radioactive cesium

    Science.gov (United States)

    Jang, Sung-Chan; Kang, Sung-Min; Haldorai, Yuvaraj; Giribabu, Krishnan; Lee, Go-Woon; Lee, Young-Chul; Hyun, Moon Seop; Han, Young-Kyu; Roh, Changhyun; Huh, Yun Suk

    2016-12-01

    A novel microporous three-dimensional pomegranate-like micro-scavenger cage (P-MSC) composite has been synthesized by immobilization of iron phyllosilicates clay onto a Prussian blue (PB)/alginate matrix and tested for the removal of radioactive cesium from aqueous solution. Experimental results show that the adsorption capacity increases with increasing the inactive cesium concentration from 1 ppm to 30 ppm, which may be attributed to greater number of adsorption sites and further increase in the inactive cesium concentration has no effect. The P-MSC composite exhibit maximum adsorption capacity of 108.06 mg of inactive cesium per gram of adsorbent. The adsorption isotherm is better fitted to the Freundlich model than the Langmuir model. In addition, kinetics studies show that the adsorption process is consistent with a pseudo second-order model. Furthermore, at equilibrium, the composite has an outstanding adsorption capacity of 99.24% for the radioactive cesium from aqueous solution. This may be ascribed to the fact that the AIP clay played a substantial role in protecting PB release from the P-MSC composite by cross-linking with alginate to improve the mechanical stability. Excellent adsorption capacity, easy separation, and good selectivity make the adsorbent suitable for the removal of radioactive cesium from seawater around nuclear plants and/or after nuclear accidents.

  10. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Baiyang [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Fugetsu, Bunshi, E-mail: hu@ees.hokudai.ac.jp [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Yu, Hongwen [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Abe, Yoshiteru [Kyoei Engineering Corporation, Niigata 959-1961 (Japan)

    2012-05-30

    Highlights: Black-Right-Pointing-Pointer Prussian blue was sealed in cavities of diatomite using carbon nanotubes. Black-Right-Pointing-Pointer The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. Black-Right-Pointing-Pointer Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  11. Review and assessment of technologies for the separation of cesium from acidic media

    Energy Technology Data Exchange (ETDEWEB)

    Orth, R.J.; Brooks, K.P.; Kurath, D.E.

    1994-09-01

    A preliminary literature survey has been conducted to identify and evaluate methods for the separation of cesium from acidic waste. The most promising solvent extraction, precipitation, and ion exchange methods, along with some of the attributes for each method, are listed. The main criteria used in evaluating the separation methods were as follows: (1) good potential for cesium separation must be demonstrated (i.e., cesium decontamination factors on the order of 50 to 100). (2) Good selectivity for cesium over bulk components must be demonstrated. (3) The method must show promise for evolving into a practical and fairly simple process. (4) The process should be safe to operate. (5) The method must be robust (i.e., capable of separating cesium from various acidic waste types). (6) Secondary waste generation must be minimized. (7) The method must show resistance to radiation damage. The most promising separation methods did not necessarily satisfy all of the above criteria, thus key areas requiring further development are suggested for each method. The report discusses in detail these and other areas requiring further development, as well as alternative solvent extraction, precipitation, ion exchange, and {open_quote}other{close_quote} technologies that, based on current information, show less promise for the separation of cesium from acidic wastes because of significant process limitations. When appropriate, the report recommends areas of future development.

  12. Enhanced electronic injection in organic light-emitting diodes by incorporating silver nanoclusters and cesium carbonate

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Ying-Chung; Gao, Chia-Yuan [Department of Electrical Engineering, National Sun Yat-Sen University, Kaohsiung, Taiwan (China); Chen, Kan-Lin [Department of Electronic Engineering, Fortune Institute of Technology, Kaohsiung, Taiwan (China); Sze, Po-Wen [Department of Electro-Optical Science and Engineering, Kao Yuan University, Kaohsiung, Taiwan (China); Huang, Chien-Jung, E-mail: chien@nuk.edu.tw [Department of Applied Physics, National University of Kaohsiung, Kaohsiung, Taiwan (China)

    2015-10-01

    Highlights: • The localized electric field around SNCs is enhanced. • When the cesium carbonate/silver nanoclusters/cesium carbonate electron-injection structure replaces the cesium carbonate electron-injection structure, higher electron-injection ability is obtained. • The structure for efficient electron injection is critical to characteristics of the device. - Abstract: The influence of the cesium carbonate/silver nanoclusters/cesium carbonate electron-injection structure (CSC-EIS) on the performance of organic light-emitting diodes is investigated in this study. The silver nanoclusters (SNCs) are introduced between the electron-injection layers by means of thermal evaporation. When the CSC-EIS replaces the cesium carbonate electron-injection structure, higher electron-injection ability is obtained because the electron-injection barrier between the cathode and the electron-transport layer is remarkably reduced from 1.2 to 0 eV. In addition, surface plasmon resonance effect will cause the enhanced localized electric field around the SNCs, resulting that electron-injection ability is further enhanced from the cathode to the emitting layer.

  13. Modeling Ion-Exchange Processing With Spherical Resins For Cesium Removal

    Energy Technology Data Exchange (ETDEWEB)

    Hang, T.; Nash, C. A.; Aleman, S. E.

    2012-09-19

    The spherical Resorcinol-Formaldehyde and hypothetical spherical SuperLig(r) 644 ion-exchange resins are evaluated for cesium removal from radioactive waste solutions. Modeling results show that spherical SuperLig(r) 644 reduces column cycling by 50% for high-potassium solutions. Spherical Resorcinol Formaldehyde performs equally well for the lowest-potassium wastes. Less cycling reduces nitric acid usage during resin elution and sodium addition during resin regeneration, therefore, significantly decreasing life-cycle operational costs. A model assessment of the mechanism behind ''cesium bleed'' is also conducted. When a resin bed is eluted, a relatively small amount of cesium remains within resin particles. Cesium can bleed into otherwise decontaminated product in the next loading cycle. The bleed mechanism is shown to be fully isotherm-controlled vs. mass transfer controlled. Knowledge of residual post-elution cesium level and resin isotherm can be utilized to predict rate of cesium bleed in a mostly non-loaded column. Overall, this work demonstrates the versatility of the ion-exchange modeling to study the effects of resin characteristics on processing cycles, rates, and cold chemical consumption. This evaluation justifies further development of a spherical form of the SL644 resin.

  14. The effects of K+ growth conditions on the accumulation of cesium by the bacterium Thermus sp. TibetanG6

    Institute of Scientific and Technical Information of China (English)

    WANG; Hailei; KONG; Fanjing; ZHENG; Mianping

    2006-01-01

    The accumulation of cesium by the bacterium Thermus sp. TibetanG6 was examined under different K+ growth conditions. The effects of external pH and Na+ on the accumulation of cesium were also studied, and the mechanism involved was discussed. K+ regimes played an important role in the accumulation of cesium by the strain TibetanG6. The quantity of cesium accumulated (24 h) was much higher in K+-deficient regime than that in K+-sufficient regime. The pH and Na+ had different effects on the accumulation of cesium in the two K+ regimes. IR spectra analyses indicated that the biosorption is a process of homeostasis with cesium initially accumulated on the cell wall.

  15. Atmospheric Dispersion Modeling of 137Cs generated from Nuclear Spent Fuel under Hypothetic Accidental Condition in the BNPP Area

    Science.gov (United States)

    Lee, Jongkuk; Lee, Kwan-Hee; Yook, Daesik; Kim, Sung Il; Lee, Byung Soo

    2016-04-01

    This study presents the results of atmosphere dispersion modeling using CALPUFF code that are based on computational simulation to evaluate the environmental characteristics of the Barakah nuclear power plant (BNPP) in west area of UAE. According to meteorological data analysis (2012~2013), the winds from the north(7.68%) and west(9.05%) including NNW(41.63%), NW(28.55%), and WNW(6.31%) winds accounted for more than 90% of the wind directions. East(0.2%) and south(0.6%) direction wind, including ESE(0.31%), SE(0.38%), and SSE(0.38%) were rarely distributed during the simulation period. Seasonal effects were not showed. However, a discrepancy in the tendency between daytime and night-time was observed. Approximately 87% of the wind speed was distributed below 5.4m/s (17%, 47% and 23% between the speeds of 0.5-1.8m/s 1.8-3.3m/s and 3.3-5.4m/s, respectively) during the annual period. Seasonal wind speed distribution results presented very similar pattern of annual distribution. Wind speed distribution of day and night, on the other hand, had a discrepancy with annual modeling results than seasonal distribution in some sections. The results for high wind speed (more than 10.8m/s) showed that this wind blew from the west. This high wind speed is known locally as the 'Shamal', which occurs rarely, lasting one or two days with the strongest winds experienced in association with gust fronts and thunderstorms. Six variations of cesium-137 (137Cs) dispersion test were simulated under hypothetic severe accidental condition. The 137Cs dispersion was strongly influenced by the direction and speed of the main wind. From the test cases, east-south area of the BNPP site was mainly influenced by 137Cs dispersion. A virtual receptor was set and calculated for observation of the 137Cs movement and accumulation. Surface roughness tests were performed for the analysis of topographic conditions. According to the surface condition, there are various surface roughness length. Four types

  16. The transfer of {sup 137}Cs from barley to beer

    Energy Technology Data Exchange (ETDEWEB)

    Proehl, G.; Mueller, H.; Voigt, G. [Institut fuer Strahlenschutz, Oberschleibheim (Germany)] [and others

    1997-01-01

    Beer has been brewed from barley contaminated with {sup 137}Cs as a consequence of the Chernobyl accident. The {sup 137}Cs activity has been measured in all intermediate steps and in the by-products of the production process. About 35 % of the {sup 137}Cs in barley were recovered in beer. Processing factors defined as the concentration ratio of processed and raw products were determined to be 0.61, 3.3, 0.1 and 0.11 for malt, malt germs, spent grains and beer, respectively. 4 refs., 2 tabs.

  17. 33 CFR 137.1 - Purpose and applicability.

    Science.gov (United States)

    2010-07-01

    ... ALL APPROPRIATE INQUIRIES UNDER THE INNOCENT LAND-OWNER DEFENSE Introduction § 137.1 Purpose and... their functions as sovereigns under 33 U.S.C. 2703(d)(2)(B). Involuntary acquisition of properties...

  18. Removal efficiency of radioactive cesium and iodine ions by a flow-type apparatus designed for electrochemically reduced water production.

    Directory of Open Access Journals (Sweden)

    Takeki Hamasaki

    Full Text Available The Fukushima Daiichi Nuclear Power Plant accident on March 11, 2011 attracted people's attention, with anxiety over possible radiation hazards. Immediate and long-term concerns are around protection from external and internal exposure by the liberated radionuclides. In particular, residents living in the affected regions are most concerned about ingesting contaminated foodstuffs, including drinking water. Efficient removal of radionuclides from rainwater and drinking water has been reported using several pot-type filtration devices. A currently used flow-type test apparatus is expected to simultaneously provide radionuclide elimination prior to ingestion and protection from internal exposure by accidental ingestion of radionuclides through the use of a micro-carbon carboxymethyl cartridge unit and an electrochemically reduced water production unit, respectively. However, the removability of radionuclides from contaminated tap water has not been tested to date. Thus, the current research was undertaken to assess the capability of the apparatus to remove radionuclides from artificially contaminated tap water. The results presented here demonstrate that the apparatus can reduce radioactivity levels to below the detection limit in applied tap water containing either 300 Bq/kg of 137Cs or 150 Bq/kg of 125I. The apparatus had a removal efficiency of over 90% for all concentration ranges of radio-cesium and -iodine tested. The results showing efficient radionuclide removability, together with previous studies on molecular hydrogen and platinum nanoparticles as reactive oxygen species scavengers, strongly suggest that the test apparatus has the potential to offer maximum safety against radionuclide-contaminated foodstuffs, including drinking water.

  19. Characteristics of 137Cs deposition in steppe area

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Soil wind erosion in the semiarid steppe area was studied using the 137Cs tracing technique. Comparisons of 137Cs deposition characteristics between different soil profiles indicated that slight aeolian activities occurred on sandy grasslands and semi-fixed dunes with erosion/deposition rates of less than 0.108 cm/a, whereas they were intense on semi-shifting dunes with erosion/deposition rates of higher than 1.35 cm/a.

  20. Obsah Cs-137 v houbách

    OpenAIRE

    ČADOVÁ, Michaela

    2015-01-01

    The aim of this work is to compare the presence of Cs-137 in different kinds of mushrooms in selected locations using semiconductor gamma-ray spectrometry. Research question was determined: Does Cs-137 content amount vary depending on the fungal species? The first part deals with basic knowledge of ionizing radiation, which is important for the complex understanding of thematic problems. This concerns basic radiobiological terms such as radioactivity, ionizing radiation, its biological effect...

  1. Chromatic instabilities in cesium-doped tungsten bronze nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Adachi, Kenji, E-mail: kenji-adachi@ni.smm.co.jp; Ota, Yosuke; Tanaka, Hiroyuki; Okada, Mika; Oshimura, Nobumitsu; Tofuku, Atsushi [Ichikawa Research Laboratories, Sumitomo Metal Mining Co., Ltd., Ichikawa 272-8588 (Japan)

    2013-11-21

    Nanoparticles of alkali-doped tungsten bronzes are an excellent near-infrared shielding material, but exhibit slight chromatic instabilities typically upon applications of strong ultra-violet light or heating in humid environment, which acts detrimentally to long-life commercial applications. Origin of the chromatic instabilities in cesium-doped tungsten bronze has been investigated, and it has been found that the coloration and bleaching processes comprised electronic exchanges which accelerate or depress the polaron excitation and the localized surface plasmon resonance. Coloration on UV illumination is evidenced by electron diffraction as due to the formation of H{sub x}WO{sub 3}, which is considered to take place in the surface Cs-deficient WO{sub 3} region via the double charge injection mechanism. On the other hand, bleaching on heating in air and in humid environment is shown to accompany the extraction of Cs and electrons from Cs{sub 0.33}WO{sub 3} by X-ray photoelectron spectroscopy and X-ray diffraction analysis and is concluded to be an oxidation of Cs{sub 0.33}WO{sub 3} on the particle surface.

  2. The crystal structures of potassium and cesium trivanadates

    Science.gov (United States)

    Evans, H.T.; Block, S.

    1966-01-01

    Potassium and cesium trivanadates are monoclinic and isomorphous, space group P21/m, with the following dimensions (Z = 2): KV3O8, a = 7.640 A, b = 8.380 A, c = 4.979 A, ??= 96?? 57???; CsV3O8, a = 8.176 A, b = 8.519 A, c = 4.988 A, ?? = 95?? 32???. The crystal structure of KV3O8 has been determined from hk0, 0kl, and h0l Weissenberg data with an R factor of 0.15. The structure of CsV3O8 has been refined with 1273 hkl Weissenberg data to an R factor of 0.089. The structures consist of corrugated sheets based on a linkage of distorted VO6, octahedra. Two of the vanadium atoms lie in double, square-pyramid groups V2O8, which are linked through opposite basal corners into chains along the b axis. The chains are joined laterally along the c axis into sheets by the third vanadium atom in VO groups, also forming part of a square-pyramid coordination. Various aspects of these structures are compared with other known oxovanadate structures.

  3. Photoionization spectroscopy of excited states of cold cesium dimers

    CERN Document Server

    Bouloufa, Nadia; Viteau, Matthieu; Chotia, Amodsen; Fioretti, Andrea; Gabbanini, Carlo; Allegrini, Maria; Aymar, Mireille; Comparat, Daniel; Dulieu, Olivier; Pillet, Pierre

    2010-01-01

    Photoionization spectroscopy of cold cesium dimers obtained by photoassociation of cold atoms in a magneto-optical trap is reported here. In particular, we report on the observation and on the spectroscopic analysis of all the excited states that have actually been used for efficient detection of cold molecules stabilized in the triplet a^3Sigma_u^+ ground state. They are: the (1)^3Sigma_g^+ state connected to the 6s+6p asymptote, the (2)^3Sigma_g^+ and (2)^3Pi_g states connected to the 6s+5d asymptote and finally the (3)^3Sigma_g^+ state connected to the 6s + 7s asymptote. The detection through these states spans a wide range of laser energies, from 8000 to 16500 cm-1, obtained with different laser dyes and techniques. Information on the initial distribution of cold molecules among the different vibrational levels of the a^3Sigma_u^+ ground state is also provided. This spectroscopic knowledge is important when conceiving schemes for quantum manipulation, population transfer and optical detection of cold cesi...

  4. Ion exchange performance of commercial crystalline silicotitanates for cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Braun, R.; Dangieri, T.J.; Fennelly, D.J. [and others

    1996-03-01

    A new class of inorganic ion exchangers called crystalline silicotitanates (CST), invented by researchers at Sandia National Laboratories and Texas A&M University, has been commercialized in a joint Sandia-UOP effort. The original developmental materials exhibited high selectivity for the ion exchange of cesium, strontium, and several other radionuclides from highly alkaline solutions containing molar concentrations of Na{sup +}. The materials also showed excellent chemical and radiation stability. Together, the high selectivity and stability of the CSTs made them excellent candidates for treatment of solutions such as the Hanford tank supernates and other DOE radwastes. Sandia National Laboratories and UOP have teamed under a Cooperative Research and Development Agreement (CRADA) to develop CSTs in the powdered form and in an engineered form suitable for column ion exchange use. A continuous-flow, column ion exchange process is expected to be used to remove Cs and other radionuclides from the Hanford supernatant. The powder material invented by the Sandia and Texas A&M team consists of submicron-size particles. It is not designed for column ion exchange but may be used in other applications.

  5. Chromatic instabilities in cesium-doped tungsten bronze nanoparticles

    Science.gov (United States)

    Adachi, Kenji; Ota, Yosuke; Tanaka, Hiroyuki; Okada, Mika; Oshimura, Nobumitsu; Tofuku, Atsushi

    2013-11-01

    Nanoparticles of alkali-doped tungsten bronzes are an excellent near-infrared shielding material, but exhibit slight chromatic instabilities typically upon applications of strong ultra-violet light or heating in humid environment, which acts detrimentally to long-life commercial applications. Origin of the chromatic instabilities in cesium-doped tungsten bronze has been investigated, and it has been found that the coloration and bleaching processes comprised electronic exchanges which accelerate or depress the polaron excitation and the localized surface plasmon resonance. Coloration on UV illumination is evidenced by electron diffraction as due to the formation of HxWO3, which is considered to take place in the surface Cs-deficient WO3 region via the double charge injection mechanism. On the other hand, bleaching on heating in air and in humid environment is shown to accompany the extraction of Cs and electrons from Cs0.33WO3 by X-ray photoelectron spectroscopy and X-ray diffraction analysis and is concluded to be an oxidation of Cs0.33WO3 on the particle surface.

  6. Radiological protection and routinary controls of an activimeter with a cesium and barium sources in an nuclear medicine center; Proteccion radiologica y controles rutinarios de un activimetro con fuentes de cesio y bario en un centro de medicina nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Morales L, M.E. [IPEN INEN, Centro de Medicina Nuclear, Av. Aviacion 3799, Lima 34 (Peru)]. e-mail: toyoco3000@hotmail.com

    2006-07-01

    In the present work the results when carrying out the routine controls in a Deluxe Isotope (Calibrator II) equipment, with some sources of Cesium 137 and Barium 133, in a Nuclear Medicine Center that operates from the year 1983 in a modern one construction inside the Institute of Neoplastic Illnesses (INEN) are shown. Taking in account the Radiological Protection measures to verify if the equipment responds to the personnel's demands in the measurements of activities of the diverse radionuclides that are used in different types of exams that are carried out in this Nuclear Medicine Center are the objectives of this work. This Center was equipped initially with donated equipment by the International Atomic Energy Agency (IAEA) with those that it develops assistance, educational works and of research, giving services to patients of the INEN and other public and private medical centers. (Author)

  7. Removal of cesium from simulated liquid waste with countercurrent two-stage adsorption followed by microfiltration

    Energy Technology Data Exchange (ETDEWEB)

    Han, Fei; Zhang, Guang-Hui [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Gu, Ping, E-mail: guping@tju.edu.cn [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China)

    2012-07-30

    Highlights: Black-Right-Pointing-Pointer The adsorption isotherm of cesium by copper ferrocyanide followed a Freundlich model. Black-Right-Pointing-Pointer Decontamination factor of cesium was higher in lab-scale test than that in jar test. Black-Right-Pointing-Pointer A countercurrent two-stage adsorption-microfiltration process was achieved. Black-Right-Pointing-Pointer Cesium concentration in the effluent could be calculated. Black-Right-Pointing-Pointer It is a new cesium removal process with a higher decontamination factor. - Abstract: Copper ferrocyanide (CuFC) was used as an adsorbent to remove cesium. Jar test results showed that the adsorption capacity of CuFC was better than that of potassium zinc hexacyanoferrate. Lab-scale tests were performed by an adsorption-microfiltration process, and the mean decontamination factor (DF) was 463 when the initial cesium concentration was 101.3 {mu}g/L, the dosage of CuFC was 40 mg/L and the adsorption time was 20 min. The cesium concentration in the effluent continuously decreased with the operation time, which indicated that the used adsorbent retained its adsorption capacity. To use this capacity, experiments on a countercurrent two-stage adsorption (CTA)-microfiltration (MF) process were carried out with CuFC adsorption combined with membrane separation. A calculation method for determining the cesium concentration in the effluent was given, and batch tests in a pressure cup were performed to verify the calculated method. The results showed that the experimental values fitted well with the calculated values in the CTA-MF process. The mean DF was 1123 when the dilution factor was 0.4, the initial cesium concentration was 98.75 {mu}g/L and the dosage of CuFC and adsorption time were the same as those used in the lab-scale test. The DF obtained by CTA-MF process was more than three times higher than the single-stage adsorption in the jar test.

  8. Potential of Calendula alata for phytoremediation of stable cesium and lead from solutions.

    Science.gov (United States)

    Borghei, Mehdi; Arjmandi, Reza; Moogouei, Roxana

    2011-10-01

    Calendula alata plants were tested for their potential to remove stable cesium and lead from solutions in a 15-day period. The plants were grown hydroponically and placed in solutions containing CsCl and Pb(C₂H₃O₂)₂ at different concentrations (0.6, 2 and 5 mg l⁻¹). When plants were incubated in CsCl solutions 46.84 ± 2.12%, 41.35 ± 1.59%, and 52.06 ± 1.02% cesium was found to be remediated after 15 days. Moreover, more than 99% lead was removed from the Pb(C₂H₃O₂)₂ solution in all three concentrations after 15 days during the same period. When both CsCl and Pb(C₂H₃O₂)₂ were supplemented together in the solution, 9.92 ± 1.22%, 45.56 ± 3.52%, and 46.16 ± 1.48% cesium and 95.30 ± 0.72%, 96.64 ± 0.30%, and 99.02 ± 0.04% lead were removed after 15 days. The present study suggests that hydroponically grown C. alata could be used as a potential candidate plant for phytoremediation of cesium and lead from solutions; however, plants were found to be more efficient for the remediation of lead than cesium.

  9. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    Directory of Open Access Journals (Sweden)

    Houssni El-Saied

    2013-01-01

    Full Text Available In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+ on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the kaolin. Paper handsheets were prepared containing various percentages of the modified kaolin. The mechanical and optical properties of paper handsheets were studied. The prepared paper handsheets were irradiated by gamma irradiation using different doses. Fourier transform infrared (FTIR spectroscopy was used to study the effect of kaolin modification by cesium and gamma irradiation on paper handsheets properties. The results indicated that modified kaolin enhanced the mechanical and optical properties of paper handsheets. Electron spin resonance (ESR spectroscopy and laser-induced breakdown spectroscopy (LIBS were also used. They provided rapid, sensitive and nondestructive techniques in differentiating between different questioned documents. This study presents a new concept in manufacturing security papers and anticounterfeiting applications.

  10. PLANTS AS BIO-MONITORS FOR 137CS, 238PU, 239, 240PU AND 40K AT THE SAVANNAH RIVER SITE

    Energy Technology Data Exchange (ETDEWEB)

    Caldwell, E.; Duff, M.; Ferguson, C.

    2010-12-16

    The nuclear fuel cycle generates a considerable amount of radioactive waste, which often includes nuclear fission products, such as strontium-90 ({sup 90}Sr) and cesium-137 ({sup 137}Cs), and actinides such as uranium (U) and plutonium (Pu). When released into the environment, large quantities of these radionuclides can present considerable problems to man and biota due to their radioactive nature and, in some cases as with the actinides, their chemical toxicity. Radionuclides are expected to decay at a known rate. Yet, research has shown the rate of elimination from an ecosystem to differ from the decay rate due to physical, chemical and biological processes that remove the contaminant or reduce its biological availability. Knowledge regarding the rate by which a contaminant is eliminated from an ecosystem (ecological half-life) is important for evaluating the duration and potential severity of risk. To better understand a contaminants impact on an environment, consideration should be given to plants. As primary producers, they represent an important mode of contamination transfer from sediments and soils into the food chain. Contaminants that are chemically and/or physically sequestered in a media are less likely to be bio-available to plants and therefore an ecosystem.

  11. Comparison of organic and inorganic ion exchange materials for removal of cesium and strontium from tank waste

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G. [Pacific Northwest National Lab., Richland, WA (United States)

    1996-10-01

    This work is part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. Pacific Northwest National Laboratory (PNNL) staff are investigating novel ion exchangers for use in nuclear waste remediation (groundwater, high-level waste (HLW), and low-level waste (LLW)). Waste components targeted for remediation include cesium, strontium, and technetium.

  12. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms; Sympathetisches Kuehlen in einer Rubidium-Caesium-Mischung: Erzeugung ultrakalter Caesiumatome

    Energy Technology Data Exchange (ETDEWEB)

    Haas, M.

    2007-07-01

    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m{sub f}=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m{sub f}=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m{sub f}=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The

  13. Continuous Separation of Cesium Based on NiHCF/PTCF Electrode by Electrochemically Switched Ion Exchange

    Institute of Scientific and Technical Information of China (English)

    孙斌; 郝晓刚; 王忠德; 张忠林; 刘世斌; 官国清

    2012-01-01

    Nickel hexacyanoferrate (NiHCF) film was synthesized on porous three-dimensional carbon felt (PTCF) substrate by repetitious batch chemical depositions, and the NiHCF/PTCF electrode was used as electrochemically switched ion exchange (ESIX) electrode in a packed bed for continuous separation for cesium ions. The morphologies of the prepared electrodes were characterized by scanning electron microscopy and the effects of solution concentration on the ion-exchange capacity of the electrodes were investigated by cyclic voltammetry technique. Cycling stability and long-term storage stability of NiHCF/PTCF electrodes were also studied. The NiHCF/PTCF electrodes with excellent ion-exchange ability were used to assemble a diaphragm-isolated ESIX reactor for cesium separation. Continuous separation of cesium and regeneration of NiHCF/PTCF electrode based on the diaphragm-isolated reactor were performed in a laboratory-scale two-electrode system.

  14. Phosphate ceramic solidification and stabilization of cesium-containing crystalline silicotitanate resins.

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C. A.

    1999-05-11

    This paper reports on the fabrication and testing of magnesium potassium phosphate (MKP)-bonded cesium-loaded crystalline silicotitanate (CST) resins. Typical waste loading of CST resins in the final waste forms was 50 wt.%. Physical and chemical characterization of the MKP materials has shown them to be physically, chemically, and mineralogically stable. Long-term durability studies (using the AN 16.1 standard test) showed a leachability index of {approx}18 for cesium in the phosphate matrix when exposed to deionized water under ambient and elevated temperatures. Leaching of cesium was somewhat higher than in glass waste forms as per PCT and MCC-1 tests. MKP-based final waste forms showed no significant weight changes after exposure to aqueous media for {approx}90 days, indicating the highly insoluble nature of the phosphate matrix. In addition, durability of the CST-MKP waste forms was further established by freeze-thaw cycling tests.

  15. Selection of chemotherapy for metastatic mammary cancer by effect on cesium-131 uptake.

    Science.gov (United States)

    Ferguson, D J; Harper, P V

    1977-09-01

    Cesium-131 was administered intravenously to 39 patients with superficial metastases of mammary carcinoma and the concentration in tumor was compared with that in normal tissue by application of a detector in vivo, before and after 1 to 5 days of chemotherapy with cyclophosphamide (CP), 5-fluorouracil (FU), or diethylstilbestrol. A change of the cesium concentration ratio (tumor/normal tissue) greater than 15% after brief treatment correctly predicted the therapeutic effect after 1 to 39 months on the tumors that were tested in 30 of 33 tests. No reliable correlation could be made in the remaining 21 tests in which the change of ratio was less than 15%. The concentration of cesium-131 in the skin, fat, and skeletal muscle of mice was not appreciably altered by treatment for 5 days with CP or FU.

  16. Method of Preparation for High-Purity Nanocrystalline Anhydrous Cesium Perrhenate

    Directory of Open Access Journals (Sweden)

    Katarzyna Leszczyńska-Sejda

    2017-03-01

    Full Text Available This paper is devoted to the preparation of high-purity anhydrous nanocrystalline cesium perrhenate, which is applied in catalyst preparation. It was found that anhydrous cesium perrhenate with a crystal size <45 nm can be obtained using cesium ion sorption and elution using aqueous solutions of perrhenic acid with subsequent crystallisation, purification, and drying. The following composition of the as-obtained product was reported: 34.7% Cs; 48.6% Re and <2 ppm Bi; <3 ppm Zn; <2 ppm As; <10 ppm Ni; < 3 ppm Mg; <5 ppm Cu; <5 ppm Mo; <5 ppm Pb; <10 ppm K; <2 ppm Na; <5 ppm Ca; <3 ppm Fe.

  17. Cesium removal from liquid acidic wastes with the primary focus on ammonium molybdophosphate as an ion exchanger: A literature review

    Energy Technology Data Exchange (ETDEWEB)

    Miller, C.J.

    1995-03-01

    Many articles have been written concerning the selective removal of cesium from both acidic and alkaline defense wastes. The majority of the work performed for cesium removal from defense wastes involves alkaline feed solutions. Several different techniques for cesium removal from acidic solutions have been evaluated such as precipitation, solvent extraction, and ion exchange. The purpose of this paper is to briefly review various techniques for cesium removal from acidic solutions. The main focus of the review will be on ion exchange techniques, particularly those involving ammonium molybdophosphate as the exchanger. The pertinent literature sources are condensed into a single document for quick reference. The information contained in this document was used as an aid in determining techniques to evaluate cesium removal from the acidic Idaho Chemical Processing Plant waste matrices. 47 refs., 2 tabs.

  18. Cesium and Strontium Specific Exchangers for Nuclear Waste Effluent Remediation

    Energy Technology Data Exchange (ETDEWEB)

    A. Clearfield; A. I. Bortun; L. A. Bortun; E. A. Bhlume; P. Sylvester; G. M. Graziano

    2000-09-01

    During the past 50 years, nuclear defense activities have produced large quantities of nuclear waste that now require safe and permanent disposal. The general procedure to be implemented involves the removal of cesium and strontium from the waste solutions for disposal in permanently vitrified media. This requires highly selective sorbents or ion exchangers. Further, at the high radiation doses present in the solution, organic exchangers or sequestrants are likely to decompose over time. Inorganic ion exchangers are resistant to radiation damage and can exhibit remarkably high selectivities. We have synthesized three families of tunnel-type ion exchangers. The crystal structures of these compounds as well as their protonated phases, coupled with ion exchange titrations, were determined and this information was used to develop an understanding of their ion exchange behavior. The ion exchange selectivities of these phases could be regulated by isomorphous replacement of the framework metals by larger or smaller radius metals. In the realm of layered compounds, we prepared alumina, silica, and zirconia pillared clays and sodium micas. The pillared clays yielded very high Kd values for Cs+ and were very effective in removing Cs+ from groundwaters. The sodium micas also had a high affinity for Cs+ but an even greater attraction for S42+. They also possess the property of trapping these ions permanently as the layers slowly decrease their interlayer distance as loading occurs. Sodium nonatitanate exhibited extremely high Kd values for Sr2+ in alkaline tank wastes and should be considered for removal of Sr2+ in such cases. For tank wastes containing complexing agents, we have found that adding Ca2+ to the solution releases the complexed Sr2+ which may then be removed with the CST exchanger.

  19. Investigations into the transfer of cesium 137 and strontium 90 in selected exposure pathways. Final report; Untersuchungen ueber den Transfer von Caesium 137 und Strontium 90 in ausgewaehlten Belastungspfaden. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Roemmelt, R.; Hiersche, L.; Wirth, E.

    1991-12-01

    This research project investigates the behaviour of radiocesium and strontium 90 in natural conifer forest sites and derives corresponding transfer factors for radioecological calculations. As a point of particular interest the question was investigated in how far the requirements of the different mushroom species and the properties of the forest soil bear on the dynamics and transfer rate of radiocesium and strontium 90. To complement the investigations, autotrophic plants were included. The results of these studies are compared with the behaviour of the same radionuclides on farmland. The differences are discussed. (orig./HP). [Deutsch] Im Forschungsvorhaben wurde das Verhalten von Radiocaesium und Strontium 90 in den natuerlichen Nadelstandorten untersucht und entsprechende Transferfaktoren fuer radiooekologische Berechnungen abgeleitet. Besondere Aufmerksamkeit galt der Frage, inwieweit die Lebensweise der verschiedenen Pilzspezies und die Waldbodeneigenschaften die Dynamik und die Transferrate von Radiocaesium und Strontium 90 beeinflussen. Als Ergaenzung wurden autotrophe Pflanzen in die Untersuchungen einbezogen. Die Ergebnisse dieser Untersuchungen werden mit dem Verhalten dieser Radionuklide auf landwirtschaftlich genutzten Flaechen verglichen und die Unterschiede diskutiert. (orig./HP).

  20. In-vivo determination of strontium 90 and cesium 137 in exposed persons in the Tscheljabinsk region (southern Ural); In-vivo-Bestimmung von Strontium 90 und Caesium 137 an exponierten Personen in der Region Tscheljabinsk (Suedural)

    Energy Technology Data Exchange (ETDEWEB)

    Schoeffmann, E. [Bayerisches Landesamt fuer Umweltschutz, Muenchen (Germany). Referat Betrieb der LfU-Messnetzzentrale; Zeising, H. [Bayerisches Landesamt fuer Umweltschutz, Muenchen (Germany). Referat Radioaktivitaetsmesswesen

    1994-12-31

    While the Russians have been busy for decades determining the doses received by, and resulting health effects to, the concerned population - which falls into three groups: (a) workers at the Majak plutonium factory, (b) the population along the Techa river, and (c) the population from the area contaminated by the Kyschtym accident - it is also true that the integral strontium 90 exposure has been, and is being, determined subsequently via whole-body bremsstrahlung measurement (both on the part of the Russians and as a German scheme in 1993). In accordance with what was indicated by the Russian side, the Majak workers were found to have a distinctly higher risk of cancer. The population along the Techa river, too, with an average dose of 0.4 Gy for the red bone marrow, showed a significant increase in the rate of leukemia. By contrast, the persons affected by the Kyschtym accident, with a distinctly lower mean dose of about 0.02 Gy, so far have not shown any long-term effects.- As yet no exact quantitative statement regarding the cancer risks can be made, for two reasons: the comprehensive data material collected by the Russians has not yet been sufficiently evaluated, and suitable control persons need yet to be found. (orig./HP) [Deutsch] An einer Bestimmung der Dosen und der daraus resultierenden gesundheitlichen Effekte der betroffenen Bevoelkerung - naemlich der drei Gruppen (a) Arbeiter der Plutoniumfabrik Majak, (b) die Bevoelkerung entlang des Flusses Techa und (c) die Bevoelkerung aus dem durch den Kyschtym-Unfall kontaminierten Gebiet, wird zwar von russischer Seite seit Jahrzehnten gearbeitet, aber die integrale Sr 90-Exposition wurde und wird nachtraeglich ueber die Messung von Bremsstrahlung im Ganzkoerper (neben russischer Messung auch die deutsche Messaktion im Jahre 1993) bestimmt. Wie von russischer Seite angegeben, fand sich bei den Majak-Arbeitern eine deutliche Erhoehung des Krebsrisikos, ebenso wurde bei der Bevoelkerungsgruppe entlang des Flusses Techa mit einer durchschnittlichen Dosis von 0,4 Gy fuer das rote Knochenmark eine signifikante Erhoehung der Leukaemierate festgestellt. Bei den durch den Kyschtym-Unfall betroffenen Personen mit einer deutlich niedrigeren mittleren Dosis von ca. 0,02 Gy wurden bisher dagegen keine Langzeiteffekte festgestellt. Eine genaue quantitative Aussage zu den Krebsrisiken kann vorerst noch nicht gegeben werden, da zum einen das von russischer Seite gesammelte umfangreiche Datenmaterial noch nicht ausreichend ausgewertet ist und zum anderen noch geeignete Kontrollpersonen gefunden werden muessen. (orig./HP)

  1. The great fear of 1987: a rereading of the accident with Cesium-137 in Goiania, Brazil; O grande medo de 1987: uma releitura do acidente com o Cesio-137 em Goiania

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira Junior, Euripedes Monteiro de

    2016-11-01

    The works that take as object of study the radioactive accident in Goiania, and I have found to date, have tried to give special importance to its legal, psychosocial and clinical trials of radiation patients. Here in this text, I will try to understand this event from its historical dimension of fear, emphasizing its historicity from the social and cultural practices of some people, groups and entities involved with the issue. In other words, the focus of this study will be in the memories of those social relations that have been built while unfolding the event, both past and present. In this sense, we find our main concerns contained in a number of issues that are constantly alluded to discussions in which the central concepts refer to the event, memory and narrative in this case will be worked out by building the fear contained in people's memories, in groups involved in the event as well as the narratives constructed by official agencies involved in the event along with the film and the news media. (author)

  2. A direct frequency comb for two-photon transition spectroscopy in a cesium vapor

    Institute of Scientific and Technical Information of China (English)

    Zhang Yi-Chi; Wu Ji-Zhou; Li Yu-Qing; Jin Li; Ma Jie; Wang Li-Rong; Zhao Yan-Ting; Xiao Lian-Tuan; Jia Suo-Tang

    2012-01-01

    A phase-stabilized femtosecond frequency comb is used to measure high-resolution spectra of two-photon transition 62S1/2-62P1/2,3/2-82S1/2 in a cesium vapor.The broadband laser output from a femtosecond frequency comb is split into counter-propagating parts,shaped in an original way,and focused into a room-temperature cesium vapor.We obtain high-resolution two-photon spectroscopy by scanning the repetition rate of femtosecond frequency comb,and through absolute frequency measurements.

  3. Safety evaluation for packaging (onsite) for cesium chloride capsules with type W overpacks

    Energy Technology Data Exchange (ETDEWEB)

    McCoy, J.C.

    1997-09-15

    This Safety Evaluation for Packaging (SEP) documents the evaluation of a new basket design and overpacked cesium chloride capsule payload for the Beneficial Uses Shipping System (BUSS) Cask in accordance with the onsite transportation requirements of the Hazardous Material Packaging and Shipping manual, WHC-CM-2-14. This design supports the one-time onsite shipment of 16 cesium chloride capsules with Type W overpacks from the 324 Building to the 224T Building at the Waste Encapsulation and Storage Facility (WESF). The SEP is valid for a one-time onsite shipment or until August 1, 1998, whichever occurs first.

  4. Synthesis of novel calixcrown derivatives with selective complexation towards cesium ions

    Institute of Scientific and Technical Information of China (English)

    Lu Zhang; Juan Du; Li Hua Yuan; Dong Zhang; Gui Ping Dan; Yuan You Yang; Wen Feng

    2011-01-01

    A series of novel calix [4]arenecrown-6 derivatives with an alkenyl loop of various sizes 5-8 were synthesized via intramolecular ring closing olefin metathesis and characterized by 1H NMR, 13C NMR and ESI-HRMS. Their complexation property towards cesium ion was studied by 'H NMR technique. Two-phase extraction of alkali metal ions using UV-vis spectroscopy revealed remarkably different extractabilities. These results indicate that the complexation capacities towards cesium ions can be tuned and controlled through cooperative regulation of the strain of the loop and conformational change of calixcrown skelton.

  5. Computational study of organo-cesium complexes and the possibility of lanthanide/actinide ions substitution

    Science.gov (United States)

    Rabanal-León, Walter A.; Martinez-Ariza, Guillermo; Roberts, Sue A.; Hulme, Christopher; Arratia-Pérez, Ramiro

    2015-11-01

    Relativistic DFT calculations suggest that two organo-cesium complexes studied herein afford large HOMO-LUMO gaps of around 2.4 eV with the PBE xc-functional, which accounts for their stability. Energy decomposition studies suggest these two complexes are largely ionic with about 20% covalency. However, when the Cs+ ions are substituted by the isoelectronic La3+ and Th4+, their predicted ionicity decreases significantly. The significant increase in covalence indicates that employing Ugi reaction cascades that afford tetramic acid-based organo-cesium complexes may be extended to La3+ and Th4+ organometallics.

  6. Heat Transfer During Evaporation of Cesium From Graphite Surface in an Argon Environment

    Directory of Open Access Journals (Sweden)

    Bespala Evgeny

    2016-01-01

    Full Text Available The article focuses on discussion of problem of graphite radioactive waste formation and accumulation. It is shown that irradiated nuclear graphite being inalienable part of uranium-graphite reactor may contain fission and activation products. Much attention is given to the process of formation of radioactive cesium on the graphite element surface. It is described a process of plasma decontamination of irradiated graphite in inert argon atmosphere. Quasi-one mathematical model is offered, it describes heat transfer process in graphite-cesium-argon system. Article shows results of calculation of temperature field inside the unit cell. Authors determined the factors which influence on temperature change.

  7. Filter Performance of a Cesium Faraday Optical Filter at 852 nm

    Institute of Scientific and Technical Information of China (English)

    掌蕴东; 贾晓玲; 毕勇; 马祖光; 王骐

    2002-01-01

    We have investigated a cesium Faraday filter at 852nm in relatively weak and strong magnetic fields, theoretically and experimentally. With a cesium cell of 0.02m length in an axial magnetic field of 0.06T, the line-centre operation has been achieved. The calculated peak transmission reached 99% with a full width at half maximum (FWHM) bandwidth of only 3.9 GHz. The measured FWHM bandwidth of the filter is 3.29 GHz, which is in general agreement with the theoretical result.

  8. {sup 137} Cs as a tracer of the Catalan current

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Cabeza, J.A.; Molero, J.; Merino, J.; Pujol, L. [Universidad Autonoma de Barcelona (Spain); Mitchell, P.I. [University Coll., Dublin (Ireland). Dept. of Physics

    1995-12-31

    A number of nuclear power installations located in the north-western Mediterranean (NWM) area are known to enhance {sup 137}Cs levels in various marine compartments. The nuclear fuel reprocessing plant at Marcoule (France) has been reported to originate a significant increase of {sup 137}Cs in Rhone river waters and sediments because of the discharge of low-level liquid radioactive waste. This radionuclide may be used as a tracer of oceanographic processes in the NWM; in fact, {sup 137}Cs of Rhone river origin has been detected in the Gulf of Lions by several authors. The results reported in this work correspond to various transect experiments in waters of the Catalan Sea and show that: (i) surface salinity measurements confirmed the presence of the Catalan current in the Cap de Creus area; (ii) the 1991 Cap de Creus transect showed clearly the presence of {sup 137}Cs above a baseline level of 4.3 {+-} 0.2 Bq.m{sup -3}; (iii) the Cap de Salou transect showed elevated levels towards the coast; (iv) the 1992 Cap de Creus transect showed no structure at all. Therefore, it was concluded that traces of {sup 137}Cs from the Marcoule nuclear fuel reprocessing plant were transported by the Catalan current and were detectable in the Catalan Sea with a complex spatio-temporal structure. (authors). 25 refs., 4 figs.

  9. Direct observation of 134Cs and 137Cs in surface seawater in the western and central North Pacific after the Fukushima Dai-ichi nuclear power plant accident

    Directory of Open Access Journals (Sweden)

    H. Kaeriyama

    2013-06-01

    Full Text Available The horizontal distribution of radioactive cesium (Cs derived from the Fukushima Dai-ichi nuclear power plant (FNPP in the North Pacific is still unclear due to the limitation of direct measurement of the seawater in the open ocean. We present the result of direct observation of radioactive Cs in surface seawater collected from a broad area in the western and central North Pacific in July 2011, October 2011 and July 2012. We also conducted a simple particle tracking experiment to estimate the qualitative spatial distribution of radioactive Cs in the North Pacific. 134Cs was detected at 94 stations out of 123 stations, and 137Cs was detected at all stations. High 134Cs and 137Cs concentrations more than 10 m Bq kg−1 were observed in the area of the northern part of Kuroshio Extension at 144° E and 155° E in July 2011, in the area 147–175° E around 40° N in October 2011, and the northern part of Kuroshio Extension at 155° E and 175°30´ E in July 2012. Combining the result of direct observations and particle tracking experiment, the radioactive Cs derived from the FNPP had been dispersed eastward to the central North Pacific during 2011. It was considered from the horizontal distribution that radioactive Cs was dispersed not only eastward but also north- and southward in the central North Pacific. Pronounced dilution process of radioactive Cs from the FNPP during study period is suggested from temporal change in the activity ratio of 134Cs / 137Cs, which was decay-corrected on 6 April 2011, and relationships between radioactive Cs and temperature.

  10. Direct observation of 134Cs and 137Cs in surface seawater in the western and central North Pacific after the Fukushima Dai-ichi nuclear power plant accident

    Directory of Open Access Journals (Sweden)

    S. Nakatsuka

    2013-02-01

    Full Text Available The horizontal distribution of radioactive cesium (Cs derived from the Fukushima Dai-ichi Nuclear Power Plant (FNPP in the North Pacific is still unclear due to the limitation of direct measurement of the seawater in the open ocean. We present the result of direct observation of radioactive Cs in surface seawater collected from broad area in the western and central North Pacific in July, October 2011 and July 2012. We also conducted a simple particle tracking experiment to estimate the qualitative spatial distribution of radioactive Cs in the North Pacific. 134Cs were detected at 94 stations out of 123 stations and 137Cs was detected at all stations. The high 134Cs and 137Cs concentrations more than 10 mBq kg−1 were observed in the area where the northern part of Kuroshio extension at 144° E and 155° E in July 2011, in the area 147° E–175° E around 40° N in October 2011, and the northern part of Kuroshio extension at 155° E and 175° 30´ E in July 2012. Combining the result of direct observations and particle tracking experiment, the radioactive Cs derived from FNPP had been dispersed eastward to the central North Pacific during 2011. It was considered from the horizontal distribution that radioactive Cs was dispersed not only eastward but also north- and southward in the central North Pacific. Pronounced dilution process of radioactive Cs from FNPP during study period is suggested from temporal change in the activity ratio of 134Cs/137Cs which was decay corrected at 6 April 2011, and relationships between radioactive Cs and temperature.

  11. Temperature and Salinity Effects on Bioaccumulation, Gill Structure, and Radiation Dose Estimation in the Milkfish Chanos chanos Exposed to 137Cs

    Directory of Open Access Journals (Sweden)

    W.R. Prihatiningsih

    2016-12-01

    Full Text Available The present trend of global warming has led to an increase in seawater temperature and salinity. The effects of increasing salinity and temperature on the accumulation of 137Cs by milkfish Chanos chanos was studied under laboratory conditions to obtain information on Chanos chanos adaptability under environmental changes. The uptake of radioactive cesium by Chanos chanos increased with temperature of seawater. The concentration factors (CF of 137Cs for temperatures of 25°C, 27°C, 29°C, and 31°C at steady state period were 5.25, 5.91, 6.78, and 9.98 mL g-1 for the whole-body of Chanos chanos. The concentration factors at steady state (CFss of 137Cs for salinities of 26‰, 29‰, 32‰, and 35‰ were 6.23, 9.93, 9.24, and 6.86 mL g-1, respectively. After temperature exposure to 31°C, the fish gills showed hyperplasia of epithelial cells in branchial secondary lamellae, congestion of blood vessels, and hypertrophy of pillar cells. The fish from the treatment group exhibited hemorrhage between the branchial secondary lamellae and an abundance of mucous substance in comparison with control group. This study links radionuclide bioaccumulation data and monitoring data obtained in the field and laboratory experiment with radiation dose determined by ERICA Tools, an approach that will enable better linkages to be made between exposure and dose in Chanos chanos and its marine food web.

  12. Removal of cesium from nuclear liquid waste using hybrid organic-inorganic membranes grafted by immobilized calixarenes; Synthese et caracterisation de membranes hybrides organo-minerales contenant des calixarenes. Application au traitement des effluents radioactifs

    Energy Technology Data Exchange (ETDEWEB)

    Duhart, A

    1998-07-01

    The aim of the Actinex program is to reduce massively the noxiousness of the vitrified wastes mainly due to actinides and other long-lived fission products such as {sup 129}I, {sup 99}Tc or {sup 135}Cs. Specific treatment means applicable to the industrial processes of spent fuel reprocessing have to be defined. The selective extraction of these radioelements for their transmutation or packaging in specific matrices is one of the research theme of this program. Different studies allowing the extraction of radioelements such as cesium, americium and plutonium by preferential diffusional transport through a supported liquid membrane of complexes (formed between a selective transport compound and the radioelements) are at the present time carried out in the ETPL (Effluents Treatment Processes Laboratory). Calix-4-arenes mono/bis-crown-6 are used as selective transport compounds. Meanwhile the possible losses of the selective transport compound by dissolution in the aqueous phases have oriented our researches towards a solid material in which the selective transport compound is chemically bound or trapped in the matrix. The transport compound is a calixarene, dissymmetrical and double grafted. It has been specifically synthesized for this study. It allows both to complex the cesium and to chemically bind a hetero-poly-siloxane. These monomers have poly-condensable groups which lead by sol-gel process to the formation of a three-dimensional bonds lattice. The matrix, thus obtained, can be supported either on a mineral material or on a porous organic material. Pre-polymers and the deposited layers have been characterized and correlations between the materials preparation and their properties, applied to cesium extraction, have been established. Experiments of cesium transfer through the solid membrane containing between 2 to 40% of selective transport compound, located between 2 compartments containing upstream, an acidic solution with strong salinity doped with Cs 137

  13. Conceptual Design of a Simplified Skid-Mounted Caustic-Side Solvent Extraction Process for Removal of Cesium from Savannah Rive Site High-Level Waste

    Energy Technology Data Exchange (ETDEWEB)

    Birdwell, JR.J.F.

    2004-05-12

    This report presents the results of a conceptual design of a solvent extraction process for the selective removal of {sup 137}Cs from high-level radioactive waste currently stored in underground tanks at the U.S. Department of Energy's Savannah River Site (SRS). This study establishes the need for and feasibility of deploying a simplified version of the Caustic-Side Solvent Extraction (CSSX) process; cost/benefit ratios ranging from 33 to 55 strongly support the considered deployment. Based on projected compositions, 18 million gallons of dissolved salt cake waste has been identified as having {sup 137}Cs concentrations that are substantially lower than the worst-case design basis for the CSSX system that is to be deployed as part of the Salt Waste Processing Facility (SWPF) but that does not meet the waste acceptance criteria for immobilization as grout in the Saltstone Manufacturing and Disposal Facility at SRS. Absent deployment of an alternative cesium removal process, this material will require treatment in the SWPF CSSX system, even though the cesium decontamination factor required is far less than that provided by that system. A conceptual design of a CSSX processing system designed for rapid deployment and having reduced cesium decontamination factor capability has been performed. The proposed accelerated-deployment CSSX system (CSSX-A) has been designed to have a processing rate of 3 million gallons per year, assuming 90% availability. At a more conservative availability of 75% (reflecting the novelty of the process), the annual processing capacity is 2.5 million gallons. The primary component of the process is a 20-stage cascade of centrifugal solvent extraction contactors. The decontamination and concentration factors are 40 and 15, respectively. The solvent, scrub, strip, and wash solutions are to have the same compositions as those planned for the SWPF CSSX system. As in the SWPF CSSX system, the solvent and scrub flow rates are equal. The system

  14. Household methods to reduce {sup 137}Cs contents of mushrooms

    Energy Technology Data Exchange (ETDEWEB)

    Kostiainen, E. [Radiation and Nuclear Safety Authority - STUK, Helsinki (Finland)

    2005-09-15

    High radiocaesium contents in different species of mushrooms have been observed in areas contaminated by radiocaesium deposition after the Chernobyl accident in 1986. There has been no significant reduction in the {sup 137}Cs contents of mushrooms during the past ten years, besides via radioactive decay. The internal radiation dose received via mushrooms can be reduced by processing mushrooms before consumption. Various household methods were studied to find out their efficiency to reduce {sup 137}Cs contents of mushrooms. The methods tested were the same as normally used in cooking. The tests were made for the species of edible mushrooms widely consumed. The retention factors for the treatments tested were in most cases 0.2-0.3. The efficiency of treatments in reducing the {sup 137}Cs contents increased with larger water volumes and prolonged treatment times.

  15. Nuclear structure and high-spin states of 137Pr

    Science.gov (United States)

    Dragulescu, E.; Ivascu, M.; Petrache, C.; Popescu, D.; Semenescu, G.; Gurgu, I.; Ionescu-Bujor, M.; Iordachescu, A.; Pascovici, G.; Meyer, R. A.; Lopac, V.; Brant, S.; Paar, V.; Vorkapić, D.; Vretenar, D.

    1992-10-01

    Levels in 137Pr were populated in the 126Te( 14N, 3n) and 122Sn( 19F, 4n) reactions and the subsequent radiation was studied using in-beam γ-ray spectroscopy methods including γ-ray excitation-function, angular-distribution, γγ( t) coincidence and γ( t) measurements. A level scheme with new states up to spin {35}/{2} belonging to 137Pr is given. The lifetime of the {11}/{21} state at 563.4 keV has been determined as T {1}/{2} = 2.66±0.07 μ s. The calculation of low-lying levels in 137Pr performed in IBFM has been compared to experimental data.

  16. Redox transformations and transport of cesium and iodine (-1, 0, +5) in oxidizing and reducing zones of a sand and gravel aquifer

    Science.gov (United States)

    Fox, P.M.; Kent, D.B.; Davis, J.A.

    2010-01-01

    Tracer tests were performed in distinct biogeochemical zones of a sand and gravel aquifer in Cape Cod, MA, to study the redox chemistry (I) and transport (Cs, I) of cesium and iodine in a field setting. Injection of iodide (I -) into an oxic zone of the aquifer resulted in oxidation of I - to molecular iodine (I2) and iodate (IO3-) over transport distances of several meters. Oxidation is attributed to Mn-oxides present in the sediment. Transport of injected IO 3- and Cs+ was retarded in the mildly acidic oxic zone, with retardation factors of 1.6-1.8 for IO3- and 2.3-4.4for Cs. Cs retardation was likely due to cation exchange reactions. Injection of IO3- into a Fe-reducing zone of the aquifer resulted in rapid and complete reduction to I- within 3 m of transport. The nonconservative behavior of Cs and I observed during the tracer tests underscores the necessity of taking the redox chemistry of I as well as sorption properties of I species and Cs into account when predicting transport of radionuclides (e.g., 129I and 137Cs) in the environment.

  17. Transport processes of Cs-137 in lake environments

    Energy Technology Data Exchange (ETDEWEB)

    Hilton, J.; Carrick, T.R.; Lishman, J.P.; Rigg, E. [Inst. of Freshwater Ecology, Windermere (United Kingdom); Davison, W.; Kelly, M.; Hamilton-Taylor, J. [Lancaster Univ. (United Kingdom). Inst. of Environmental and Biological Sciences

    1992-12-31

    Radiocesium levels in the waters of the Lake District dropped after the initial deposition following the Chernobyl reactor accident. However they continued to be measurable several years after the event. Caesium 137 concentrations were measured in the sediments of Esthwaite water and Windermere to determine the input of caesium 137 from the catchment area to the lakes. Experiments were conducted to ascertain the chemical conditions such as pH value, adsorption, competing ions which might contribute to maintaining caesium levels in the lakes. (U.K.).

  18. 134Cs: 137Cs and 106Ru: 137Cs ratios in intertidal sediments from the Cumbria and Lancashire coasts England

    Science.gov (United States)

    Stanners, D. A.; Aston, S. R.

    1981-10-01

    The distributions of 134Cs, 137Cs and 106Ru in intertidal surface sediments from the coasts of Cumbria and Lancashire, north-west England, are reported. The ratios of 134Cs: 137Cs and 106Ru: 137Cs activities have been used together with the isotopic composition of the Windscale radioactive effluents to examine the contamination history of sediments. Distinct differences between the activities and time of contamination of muds, silts and sands are found, and the apparent lag times of transport of radioactive wastes to different sediment localities are estimated. The relatively high activities in fine sediments reflect recent discharges indicating a rapid response to discharge, while the sands contain low levels of older contamination. Apparent lag times of up to 6 years are estimated for the study area; the transport to the south is generally more rapid than to the north. These results have consequences for the operation and interpretation of radiological monitoring in coastal areas.

  19. Electromagnetically-induced transparency in a multi-V-type system in cesium atomic vapour

    Institute of Scientific and Technical Information of China (English)

    赵建明; 尹王保; 汪丽蓉; 肖连团; 贾锁堂

    2002-01-01

    Electromagnetically-induced transparency is observed in a three-level multi-V-type system in cesium vapour atroom temperature. The absorption property is measured and the hyperfine structures of atomic states can be determined.The results of the experiment agree with the theoretical analysis.

  20. Cyclotron production of cesium radionuclides as analogues for francium-221 biodistribution

    Science.gov (United States)

    Finn, R.; McDevitt, M.; Sheh, Y.; Lom, C.; Qiao, J.; Cai, S.; Burnazi, E.; Nacca, A.; Pillarsetty, N.; Jaggi, J.; Scheinberg, D.

    2005-12-01

    In our clinical investigations focussing on improved therapeutic treatment of specific tumors we have concentrated on a targeted therapy approach utilizing designed radiolabeled monoclonal antibodies as the cytotoxic reagent. The physical characteristics of the alpha particle emitting radionuclide bismuth-213 including the short half-life of 45.6 min, has shown promise for the treatment of specific cancers such as leukemias and lymphomas or micrometastatic carcinomas. In an effort to increase the cytocidal effect of the HuM195, a humanized monoclonal antibody carrier to the CD33 antigen expressed on leukemia cells, our focus is directed toward an "internal" nano-generator composed of Ac-225 radionuclide, the parent of the bismuth-213. The actinium-225 radionuclide decays through several short-lived, alpha emitting daughters including francium-221, astatine-217 and bismuth-213. In order to study the biodistribution and the pharmacokinetics of the individual daughter nuclide, francium-221, the cyclotron production and separation of cesium radionuclides, specifically cesium-132, from a natural xenon gas target was undertaken. The choice of cesium as an analogue for francium was predicated upon both elements being in Group 1A alkali metals and cesium radionuclide possesses a sufficient half-life to allow biodistribution studies to be performed. The preliminary experimental results of this investigation are presented.

  1. Observation of microporous cesium salts of 12-tungstosilicic acid using scanning transmission electron microscopy.

    Science.gov (United States)

    Hiyoshi, Norihito; Kamiya, Yuichi

    2015-06-21

    Heteropolyanions and their arrays in microporous cesium salts of 12-tungstosilicic acid, Cs2.5H1.5[SiW12O40] and Cs4.0[SiW12O40], were observed by aberration-corrected scanning transmission electron microscopy. Microstructures that form micropores in the polyoxometalates were visualized.

  2. Physical barrier effect of geopolymeric waste form on diffusivity of cesium and strontium.

    Science.gov (United States)

    Jang, J G; Park, S M; Lee, H K

    2016-11-15

    The present study investigates the physical barrier effect of geopolymeric waste form on leaching behavior of cesium and strontium. Fly ash-based geopolymers and slag-blended geopolymers were used as solidification agents. The leaching behavior of cesium and strontium from geopolymers was evaluated in accordance with ANSI/ANS-16.1. The diffusivity of cesium and strontium in a fly ash-based geopolymer was lower than that in Portland cement by a factor of 10(3) and 10(4), respectively, showing significantly improved immobilization performance. The leaching resistance of fly ash-based geopolymer was relatively constant regardless of the type of fly ash. The diffusivity of water-soluble cesium and strontium ions were highly correlated with the critical pore diameter of the binder. The critical pore diameter of the fly ash-based geopolymer was remarkably smaller than those of Portland cement and slag-blended geopolymer; consequently, its ability physically to retard the diffusion of nuclides (physical barrier effect) was superior.

  3. Assessment of commercially available ion exchange materials for cesium removal from highly alkaline wastes

    Energy Technology Data Exchange (ETDEWEB)

    Brooks, K.P.; Kim, A.Y.; Kurath, D.E.

    1996-04-01

    Approximately 61 million gallons of nuclear waste generated in plutonium production, radionuclide removal campaigns, and research and development activities is stored on the Department of Energy`s Hanford Site, near Richland, Washington. Although the pretreatment process and disposal requirements are still being defined, most pretreatment scenarios include removal of cesium from the aqueous streams. In many cases, after cesium is removed, the dissolved salt cakes and supernates can be disposed of as LLW. Ion exchange has been a leading candidate for this separation. Ion exchange systems have the advantage of simplicity of equipment and operation and provide many theoretical stages in a small space. The organic ion exchange material Duolite{trademark} CS-100 has been selected as the baseline exchanger for conceptual design of the Initial Pretreatment Module (IPM). Use of CS-100 was chosen because it is considered a conservative, technologically feasible approach. During FY 96, final resin down-selection will occur for IPM Title 1 design. Alternate ion exchange materials for cesium exchange will be considered at that time. The purpose of this report is to conduct a search for commercially available ion exchange materials which could potentially replace CS-100. This report will provide where possible a comparison of these resin in their ability to remove low concentrations of cesium from highly alkaline solutions. Materials which show promise can be studied further, while less encouraging resins can be eliminated from consideration.

  4. Removal of cesium ion in aqueous solution using immobilized sericite beads

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Choong [Kwandong University, Gangneung (Korea, Republic of); Kim, Jong-Oh [Hanyang University, Seoul (Korea, Republic of); Lee, Seung-Mok [Gangneung-Wonju National University, Gangneung (Korea, Republic of)

    2014-07-15

    To apply sericite effectively in the adsorption process, it was immobilized by entrapment method using sodium alginate. Since the immobilized sericite beads have excellent mechanical strength and swelling characteristics, channeling of flow and the increase of pressure drop were not observed through column operations. In addition, it was also stable under pH 10 and 45 .deg. C of cesium solution. The maximum adsorption capacity and Langmuir adsorption constant was 1.430mg/g and 2.329 L/mg, respectively, at initial pH 5 of cesium solution in batch type and the Langmuir model with higher correlation coefficient of 0.997 fits experimental data better than Freundlich model. The breakthrough point emerged around 15 (1.0 mL/min) and 20 bed volumes (0.5 mL/min), and the cesium ions bound to the immobilized sericite beads were readily released and quantitatively recovered by a few bed volumes of 1.0M of HNO{sub 3} solution. Furthermore, bed volumes of cesium ions for firstly reused sericite beads can be still maintained as 18, which shows good regeneration ability.

  5. Carbon, cesium and iodine isotopes in Japanese cedar leaves from Iwaki, Fukushima

    DEFF Research Database (Denmark)

    Xu, Sheng; Cook, Gordon T.; Cresswell, Alan J.;

    2016-01-01

    Japanese cedar leaves from Iwaki, Fukushima were analyzed for carbon, cesium and iodine isotopic compositions before and after the 2011 nuclear accident. The Δ14C values reflect ambient atmospheric 14C concentrations during the year the leaves were sampled/defoliated, and also previous year...

  6. Mass selective separation applied to radioisotopes of cesium: Mass selective applied to radioisotopes

    Energy Technology Data Exchange (ETDEWEB)

    Dion, Michael [Pacific Northwest National Laboratory, 902 Battelle Boulevard Richland 99354 WA USA; Eiden, Greg [Pacific Northwest National Laboratory, 902 Battelle Boulevard Richland 99354 WA USA; Farmer, Orville [Pacific Northwest National Laboratory, 902 Battelle Boulevard Richland 99354 WA USA; Finch, Zach [Pacific Northwest National Laboratory, 902 Battelle Boulevard Richland 99354 WA USA; Liezers, Martin [Pacific Northwest National Laboratory, 902 Battelle Boulevard Richland 99354 WA USA

    2016-07-22

    A developed technique that uses the intrinsic mass-based separation capability of a quadrupole mass spectrometer has been used to resolve spectral radiometric interference of two isotopes of the same element. In this work the starting sample was a combination of 137Cs and 134Cs and was (activity) dominated by 137Cs and this methodology separated and “implanted” 134Cs that was later quantified for spectral features and ac- tivity with traditional radiometric techniques. This work demonstrated a 134Cs/137Cs activity ratio enhancement of >4 orders of magnitude and complete removal of 137Cs spectral features from the implanted target mass (i.e., 134).

  7. Ion exchange kinetics of cesium for various reaction designs using crystalline silicotitanate, UOP IONSIV IE-911

    Science.gov (United States)

    Kim, Sung Hyun

    Through collaborative efforts at Texas A&M University and Sandia National Laboratories, a crystalline silicotitanate (CST), which shows extremely high selectivity for radioactive cesium removal in highly concentrated sodium solutions, was synthesized. The effect of hydrogen peroxide on a CST under cesium ion exchange conditions has been investigated. The experimental results with hydrogen peroxide showed that the distribution coefficient of cesium decreased and the tetragonal phase, the major component of CST, slowly dissolved at hydrogen peroxide concentrations greater than 1 M. A simple and novel experimental apparatus for a single-layer ion exchange column was developed to generate experimental data for estimation of the intraparticle effective diffusivity. A mathematical model is presented for estimation of effective diffusivities for a single-layer column of CST granules. The intraparticle effective diffusivity for Cs was estimated as a parameter in the analytical solution. By using the least square method, the effective diffusivities of 1.56 +/- 0.14 x 10-11 m2/s and 0.68 +/- 0.09 x 10-11 m2/s, respectively, were obtained. The difference in the two values was due to the different viscosities of the solutions. A good fit of the experimental data was obtained which supports the use of the homogeneous model for this system. A counter-current ion exchange (CCIX) process was designed to treat nuclear waste at the Savannah River Site. A numerical method based on the orthogonal collocation method was used to simulate the concentration profile of cesium in the CCIX loaded with CST granules. To maximize cesium loading onto the CST and minimize the volume of CST, two design cases of a moving bed, where the fresh CST is pulsed into the column at certain periods or at certain concentration of cesium, were investigated. Simulation results showed that cesium removal behavior in the pilot-scale test of CCIX experiment, where the column length is 22 ft and the CST is pulsed

  8. Sorption and desorption of cesium on rapakivi granite and its minerals

    Energy Technology Data Exchange (ETDEWEB)

    Huitti, T.; Hakanen, M. [Helsinki Univ. (Finland); Lindberg, A. [Geological Survey of Finland, Espoo (Finland)

    2000-04-01

    Batch sorption experiments of cesium were performed for rapakivi granite and its main minerals, and also for some fracture minerals. The main minerals quartz, potassium feldspar, plagioclase, biotite and hornblende were magnetically separated from crushed rapakivi granite. The fracture minerals were chlorite, dolomite and kaolinite. Sorption was studied in fresh and saline reference waters containing cesium in the range of 10{sup -8} to 10{sup -3} mol/l. The distribution ratios for rapakivi granite generally decreased with an increasing Cs concentration and an increasing ionic strength. For fresh rapakivi granite, the sorption behaviour was rather complex in both fresh and saline reference waters, being complex for the other alteration stages only in saline water. Sorption increased unexpectedly when the initial cesium concentration was raised to 10{sup -5} - 10{sup -4} mol/l. The sorption on rapakivi granite was non-linear, especially in saline water. Sorption was reversible for rapakivi granite. The sorption on the minerals proved to be very non-linear, especially on biotite. Sorption was also reversible for biotite and kaolinite. For the other minerals, sorption was irreversible to some degree. As to the sorption of cesium investigated by studying thin sections of rapakivi granite and their autoradiograms, the most dominating mineral was biotite. The water analyses made during the sorption experiment revealed the exchange of potassium and cesium. The corresponding changes were difficult to detect in saline water. Calculation of the R{sub d} values for the rock, based on the R{sub d} values of minerals and the portions of minerals in the rock, yielded smaller distribution ratios than the values determined for the rock. (orig.)

  9. Phenotype abnormality: 137 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 137 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u643i decreased effic...iency during process named unidimensional cell growth ... decreased efficiency ... unidimensional cell growth ...

  10. 14 CFR 137.51 - Operation over congested areas: General.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Operation over congested areas: General... AGRICULTURAL AIRCRAFT OPERATIONS Operating Rules § 137.51 Operation over congested areas: General. (a) Notwithstanding part 91 of this chapter, an aircraft may be operated over a congested area at altitudes...

  11. 49 CFR 572.137 - Test conditions and instrumentation.

    Science.gov (United States)

    2010-10-01

    ... Hybrid III 5th Percentile Female Test Dummy, Alpha Version § 572.137 Test conditions and instrumentation. (a) The test probe for thoracic impacts, except for attachments, shall be of rigid metallic...-sec2) in yaw and pitch about the CG of the probe. One-third (1/3) of the weight of suspension...

  12. 40 CFR 1.37 - Office of External Affairs.

    Science.gov (United States)

    2010-07-01

    ... environmental impact statements, in relation to proposed legislation and reports on legislation. The Office... Section 1.37 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL STATEMENT OF ORGANIZATION... program manager for five major programs that include: (1) The review of other agency environmental...

  13. Cesium removal from aqueous solution by natural mineral clinoptilolite

    Directory of Open Access Journals (Sweden)

    Nenadović Snežana S.

    2014-01-01

    Full Text Available The aim of this study was to investigate the Cs+ ions sorption on natural minerals clinoptilolite. The analysis of clinoptilolite and clinoptilolite with adsorbed Cs+ ion was con- ducted by X-ray diffraction, scanning electron microscopy, X-ray fluorescence, and gamma spectrometry. The specific activity of naturally occurring radionuclides in clinoptilolite was determined by gamma spectrometry by using the HPGe semiconductor detector. Obtained activity concentrations ranged from 49 Bq/kg to 810 Bq/kg for 40K, 5.7 Bq/kg to 10 Bq/kg for 238U, 5.8 Bq/kg to 70 Bq/kg for 232Th(228Ac, and the presence of artificial radionuclides was not detected (137Cs < 0.02 Bq/kg. The study of the thermal decomposition of raw clinoptilolite and Cs adsorbed clinoptilolite by differential thermal analysis is presented in this paper. The activation energy of the reaction phase transformation of raw clinoptilolite is 156.7 kJ/mol, while Cs adsorbed clinoptilolite is 121.7 kJ/mol. The lower value of activation energy reaction of the phase transformation Cs adsorbed clinoptilolite indicates that Cs which is adsorbed destabilizes the crystal structure of clinoptilolite and thus facilitates the transition to the amorphous state. [Projekat Ministarstva nauke Republike Srbije, br. 45012

  14. HI-resolution gamma spectrometry measurements of U-238, TH-232, K-40 and CS-137 concentrations in soil samples from Capao Island at CTEx

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Luciano S.R.; Oliveira, Celio J.V.; Vilela, Paulo R.T.; Vital, Helio C., E-mail: vital@ctex.eb.br [Centro Tecnologico do Exercito (DDQBN/CTEX), Rio de Janeiro, RJ (Brazil). Div. de Defesa Quimica, Biologica e Nuclear. Secao de Defesa Nuclear

    2013-07-01

    Absolute soil concentrations of U-238, Th-232, K-40 and Cs-137 samples collected from Capao Island have been measured by using Hi-Resolution Gamma HPGe Spectrometry. The area of interest encompasses an embankment in a mangrove swamp in Guaratiba, Rio de Janeiro, where nuclear, chemical and biological defense laboratories of the Brazilian Army Technology Center (CTEx) are located. In order to ensure that no significant environmental impact has resulted from neutron physics experiments performed in a graphite subcritical assembly in addition to the operation of two cesium-driven irradiating facilities, routine monitoring of those isotopes have been regularly performed. A total of eight 250 ml samples of mangrove and embankment soils were extracted from four sites of known coordinates within an area of 300 x 300 m{sup 2} and remained stored for a minimum thirty-day period to allow equilibrium to be reached. Collection and preparation of samples were made according to previously established procedures. High purity germanium detectors were used to obtain high-resolution gamma spectra and counting times were required to exceed 30 hours in order to yield sufficient statistical accuracy. Energy and efficiency calibration curves of the counting system were determined by using the GENIE 2000 software for analysis of the gamma spectrum generated by nine standard sources with a total of 11 peak energies ranging from 0.05 to 1.3 MeV. The results, corrected for background, have been expressed as absolute specific activities. All experiments have been made in the Laboratory for Identification of Radiological Agents (LIAR) at CTEx. No trace of cesium-137 has been found and the measured levels of uranium-238, in the order of 10 Bq/kg, are close to the global mean. However, some data have been found to slightly exceed the expected normal range for thorium-232 (60% of samples) and potassium-40 (20% of samples). Since there is no handling of those isotopes in the site or others that

  15. Acquired long QT syndrome and monomorphic ventricular tachycardia after alternative treatment with cesium chloride for brain cancer.

    Science.gov (United States)

    Dalal, Anuj K; Harding, John D; Verdino, Ralph J

    2004-08-01

    Individuals searching for symptomatic relief or a potential cure are increasingly seeking and using nontraditional therapies for their various diseases. Little is known about the potential adverse effects that patients may encounter while undergoing these alternative treatments. Cesium chloride is an unregulated agent that has been reported to have antineoplastic properties. Cesium chloride is advertised as an alternative agent for many different types of cancers and can be purchased easily on the Internet. Recently, QT prolongation and polymorphic ventricular tachycardia were reported in several patients taking cesium chloride as alternative treatment for cancer. We report acquired QT prolongation and sustained monomorphic ventricular tachycardia in a patient who self-initiated and completed a course of cesium chloride as adjunctive treatment for brain cancer.

  16. Spin-dependent asymmetry functions in the elastic and inelastic electron-cesium scattering at intermediate energies

    CERN Document Server

    Roth, B

    2001-01-01

    In this thesis the measurements of the relative differential cross section, the exchange asymmetry, the spin-orbit asymmetry, and the interference asymmetry for the electron scattering on cesium atoms from 4 to 18 eV is described. (HSI)

  17. Cesium Platinide Hydride 4Cs2 Pt⋅CsH: An Intermetallic Double Salt Featuring Metal Anions.

    Science.gov (United States)

    Smetana, Volodymyr; Mudring, Anja-Verena

    2016-11-14

    With Cs9 Pt4 H a new representative of ionic compounds featuring metal anions can be added to this rare-membered family. Cs9 Pt4 H exhibits a complex crystal structure containing Cs(+) cations, Pt(2-) and H(-) anions. Being a red, transparent compound its band gap is in the visible range of the electromagnetic spectrum and the ionic type of bonding is confirmed by quantum chemical calculations. This cesium platinide hydride can formally be considered as a double salt of the "alloy" cesium-platinum, or better cesium platinide, Cs2 Pt, and the salt cesium hydride CsH according to Cs9 Pt4 H≡4 Cs2 Pt⋅CsH.

  18. Distribution of radioactive Cesium in trees and effect of decontamination of forest contaminated by the Fukushima nuclear accident

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, K.; Funaki, H.; Tokizawa, T.; Nakayama, S. [Fukushima Environmental Safety Center, Headquarters of Fukushima Partnership Operations, Japan Atomic Energy Agency, Fukushima (Japan)

    2013-07-01

    In decontamination pilot projects conducted by Japan Atomic Energy Agency (JAEA), many different techniques were tested to determine their applicability to remediate areas evacuated after the Fukushima Daiichi nuclear accident following the Great Tohoku earthquake and tsunami of March 11, 2011. In addition to buildings, roads and farmland, the forest adjacent to living areas was one of the main decontamination targets. The projects evaluated the radioactive contamination of trees and the effectiveness of decontaminating a highly contaminated evergreen forest. This forest was located 1.3 km southwest of the Fukushima Daiichi Nuclear Power Plant and is dominated by Japanese cedar trees and fir trees. As the first step, three Japanese cedar trees and three fir trees were cut down and the distributions of radioactive cesium (Cs) were measured in each. The total concentrations of {sup 134}Cs and {sup 137}Cs in the leaves and branches were about 1 MBq/kg for both cedar and fir trees, and were appreciably higher than in the bark for cedar. The concentrations in the outer part of the trunks (under the bark) were lower, on the order of 10 kBq/kg, and those in the core of the trunks were lower than 1 kBq/kg for both kinds of trees. The observation that the Cs concentrations are higher in the outer part of trees, is compatible with the assumption that radio-Cs was mostly adsorbed on the surface of trees and partly penetrated into the trunks through the bark. Evolution of air dose rates in a 100 x 60 m pasture adjacent to the forest was monitored during decontamination of the forest and of the pasture itself. The dose rates in the pasture decreased drastically after stripping contaminated topsoil from the pasture and decreased slightly more after stripping contaminated topsoil of the forest floor and pruning the trees. Cutting down and removing 84 trees in the outermost area (10- m width) of the forest also slightly decreased these dose rates. After decontamination, the

  19. Sugar-metal ion interactions: the complicated coordination structures of cesium ion with D-ribose and myo-inositol.

    Science.gov (United States)

    Hu, Haijian; Xue, Junhui; Wen, Xiaodong; Li, Weihong; Zhang, Chao; Yang, Limin; Xu, Yizhuang; Zhao, Guozhong; Bu, Xiaoxia; Liu, Kexin; Chen, Jia'er; Wu, Jinguang

    2013-11-18

    The novel cesium chloride-D-ribose complex (CsCl·C5H10O5; Cs-R) and cesium chloride-myo-inositol complex (CsCl·C6H12O6; Cs-I) have been synthesized and characterized using X-ray diffraction and FTIR, FIR, THz, and Raman spectroscopy. Cs(+) is eight-coordinated to three chloride ions, O1 and O2 from one D-ribose molecule, O1 from another D-ribose molecule, and O4 and O5 from the third D-ribose molecule in Cs-R. For one D-ribose molecule, the oxygen atom O1 in the ring is coordinated to two cesium ions as an oxygen bridge, O2 is cocoordinated with O1 to one of the two cesium ions, and O4 and O5 are coordinated to the third cesium ion, respectively. O3 does not coordinate to metal ions and only takes part in forming hydrogen bonds. One chloride ion is connected to three cesium ions. Thus, a complicated structure of Cs-D-ribose forms. For Cs-I, Cs(+) is 10-coordinated to three chloride ions, O1 and O2 from one myo-inositol molecule, O3 and O4 from another myo-inositol molecule, O5 and O6 from the third myo-inositol molecule, and O6 from the fourth myo-inositol molecule. One metal ion is connected to four ligands, and one myo-inositol is coordinated to four Cs(+) ions, which is also a complicated coordination structure. Crystal structure results, FTIR, FIR, THz, and Raman spectra provide detailed information on the structure and coordination of hydroxyl groups to metal ions in the cesium chloride-D-ribose and cesium chloride-myo-inositol complexes.

  20. The promotional effects of cesium promoter on higher alcohol synthesis from syngas over cesium-promoted Cu/ZnO/Al2O3 catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Jie; Cai, Qiuxia; Wan, Yan; Wan, Shaolong; Wang, Li; Lin, Jingdong; Mei, Donghai; Wang, Yong

    2016-09-02

    In this study, the promotional effects of cesium promoter on higher alcohol (C2+OH) synthesis from syngas over Cs-Cu/ZnO/Al2O3 catalysts were investigated using a combined experimental and theoretical density functional theory (DFT) calculation method. In the presence of cesium, the C2+OH productivity increases from 77.1 g•kgcat-1•h-1 to 157.3 g•kgcat-1•h-1 at 583 K due to the enhancement of the initial C–C bond formation. Detailed analysis of chain growth probabilities (CGPs) confirms that initial C–C bond formation is the rate-determining step in the temperature range of 543-583 K. Addition of cesium promoter significantly increases the productivities of 2-methyl-1-propanol, while the CGPs values (C3* to 2-methyl-C3*) is almost unaffected. With the assistance of cesium promoter, the CGPs of the initial C–C bond formation step (C1* to C2*) could be increased from 0.13 to 0.25 at 583 K. DFT calculations indicate that the initial C–C bond formation is mainly contributed by the HCO+HCO coupling reaction over the ZnCu(211) model surface. In the presence of the Cs2O, the stabilities of key reaction intermediates such as HCO and H2CO are enhanced which facilitates both HCO+HCO and HCO+H2CO coupling reaction steps with lower activation barriers over the Cs2O-ZnCu(211) surface. The promotional effects of cesium on the C2+OH productivity are also benefited from the competitive CH+HCO coupling reaction over CH hydrogenation that leads to lower alkane formation. In addition, Bader charge analysis suggests that the presence of cesium ions would facilitate the nucleophilic reaction between HCO and H2CO for initial C–C bond formation. This work was supported by the National Natural Science Foundation of China (No. 91545114 and No. 91545203). We appreciate the joint PhD scholarship support from the China Scholarship Council. The authors would also like to thank the support from Collaborative Innovation Center of Chemistry for Energy Materials (2011-iChEM). DM

  1. Distribution of 137Cs Radionuclide in Industrial Wastes Effluents of Gresik, East Java, Indonesia

    Directory of Open Access Journals (Sweden)

    Muslim

    2015-04-01

    Full Text Available The distribution of anthropogenic radionuclides 137Cs was measured from industrial waste effluent of Gresik to Gresik Sea in east Java, Indonesia. The activity of 37Cs detected at all stations was much lower than in northeast Japan both before and after NPP Fukushima accident. This indicated that in Gresik industrials waste did not consist of 137Cs. The lowest activity 137Cs occurred at the station nearest to the industrial waste effluent that contained some particle ions that were able to scavenge 137Cs and then precipate this radionuclide. Furthermore, the greatest 137Cs occured at the station that has high current speeds that stirred up sediment to release 137Cs in seawater as a secondary source. The lowest salinity did not effect on the activity of 137Cs even though the lowest salinity and activity 137Cs occured at the same station

  2. Experiments and simulations for the dynamics of cesium in negative hydrogen ion sources for ITER N-NBI

    Energy Technology Data Exchange (ETDEWEB)

    Gutser, Raphael

    2010-07-21

    The injection of fast neutral particles (NBI) into a fusion plasma is an important method for plasma heating and current drive. A source for negative deuterium ions delivering an 1 MeV beam that is accelerated to a specific energy and neutralized by a gas target is required for the ITER-NBI. Cesium seeding is required to extract high negative ion current densities from these sources. The optimization of the cesium homogeneity and control are major objectives to achieve the source requirements imposed by ITER. Within the scope of this thesis, the Monte Carlo based numerical transport simulation CsFlow3D was developed, which is the first computer model that is capable of simulating the flux and the accumulation of cesium on the surfaces of negative-ion sources. Basic studies that support the code development were performed at a dedicated experiment at the University of Augsburg. Input parameters of the ad- and desorption of cesium at ion source relevant conditions were taken from systematic measurements with a quartz micro balance, while the injection rate of the cesium oven at the ion source was determined by surface ionization detection. This experimental setup was used for further investigations of the work function of cesium-coated samples during plasma exposure. (orig.)

  3. Body concentration of caesium-137 in patients from Western Isles of Scotland.

    OpenAIRE

    Isles, C G; Robertson, I.; MacLeod, J A; Preston, T; East, B W; Hole, D J; Lever, A. F.

    1991-01-01

    OBJECTIVES--To compare caesium-137 concentrations in patients from the Western Isles Health Board, Glasgow area, and other parts of the Scottish mainland, and to investigate the source of 137Cs in patients from the Western Isles. DESIGN--Study of hypertensive patients having electrolyte concentrations measured, including 137Cs. Interview by questionnaire of island subjects about intake of foods likely to contain radiocaesium and the source of these foods. Measurement of 137Cs and 134Cs in foo...

  4. Bioaccumulation of Cs-137 and Co-57 by marine phytoplankton

    Energy Technology Data Exchange (ETDEWEB)

    Heldal, H.E. [Inst. of Marine Research, Bergen (Norway); Stupakoff, I.; Fisher, N.S. [State Univ. of New York, Marine Sciences Research Center, Stone Brook, NY (United States)

    1999-11-01

    Under controlled laboratory conditions we have examined the bioaccumulation of Cs-137 and Co-57 in three prymnesiophytes, the coccolithophorid Emiliania huxleyi and the non-calcareous species Isochrysis galbana and Phaeocystis globosa, and two diatoms Skeletonema costatum and Thalassiosira pseudonana. We measured uptake in growing and non-growing cells, and determined concentration factors on both volume and dry weight basis. For Co-57 uptake in non-growing cells, volume concentration factors (VCF) at equilibrium ranged from 0.2{sup *}10{sup 3} for Emiliana huxleyi to 4{sup *}10{sup 3} for the diatom Thalassiosira pseudonana. For Cs-137 uptake in non-growing cells the VCFs were close to zero. The results suggest that, in contrast to Co, the cycling and bioaccumulation in animals of Cs in marine systems is unlikely to be affected by primary producers. (au)

  5. Marine dispersion of caesium 137 released from Sellafield and Chernobyl

    Science.gov (United States)

    Prandle, D.; Beechey, J.

    1991-09-01

    This modelling study examines the dispersion within the shelf seas surrounding the UK, of 137Cs discharged from Sellafield between 1969 and 1988 together with the atmospheric deposition following Chernobyl (April 1986). The close agreement obtained between computed and observed distributions lends confidence to estimates of flushing times-fundamental parameters in determining pollutant concentrations. Moreover, this study confirms, to first-order, the estimates of Chernobyl fall-out provided by atmospheric dispersion models.

  6. Study on accumulation of 137Cs in aquatic organisms

    Institute of Scientific and Technical Information of China (English)

    FengDing-Hua; CheungT

    1998-01-01

    The organisms were cultivated for 7d in well water contaminated with 137Cs,The experimental results show that the accumulation level of tissues of carassius auratus had the order of gill>viscera>epidermis(including scales)>bone(including head and tail)>flesh.The concentration capability of them had the order of shrimp>carassius auratus>ophiocephalus argus,The concentration factors(CF) of shrimp was 12.6 times of that of ophiocephalus argus.

  7. 40 CFR 86.137-96 - Dynamometer test run, gaseous and particulate emissions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer test run, gaseous and particulate emissions. 86.137-96 Section 86.137-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... New Otto-Cycle Complete Heavy-Duty Vehicles; Test Procedures § 86.137-96 Dynamometer test run,...

  8. 47 CFR 101.137 - Interconnection of private operational fixed point-to-point microwave stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Interconnection of private operational fixed point-to-point microwave stations. 101.137 Section 101.137 Telecommunication FEDERAL COMMUNICATIONS....137 Interconnection of private operational fixed point-to-point microwave stations....

  9. 47 CFR 13.7 - Classification of operator licenses and endorsements.

    Science.gov (United States)

    2010-10-01

    ... endorsements. 13.7 Section 13.7 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL RADIO OPERATORS General § 13.7 Classification of operator licenses and endorsements. (a) Commercial radio operator... are eleven types of commercial radio operator licenses, certificates and permits (licenses)....

  10. 33 CFR 137.60 - Reviews of Federal, State, tribal, and local government records.

    Science.gov (United States)

    2010-07-01

    ..., and local government records. 137.60 Section 137.60 Navigation and Navigable Waters COAST GUARD... DEFENSE Standards and Practices § 137.60 Reviews of Federal, State, tribal, and local government records. (a) Federal, State, tribal, and local government records or databases of government records of...

  11. 42 CFR 137.32 - Is a compact required to participate in self-governance?

    Science.gov (United States)

    2010-10-01

    ...-governance? 137.32 Section 137.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.32 Is a compact required to participate in self-governance? Yes, Tribes must have...

  12. Estimating Cs-137 fallout inventories in Iceland from precipitation data

    Energy Technology Data Exchange (ETDEWEB)

    Palsson, S.E.; Sigurgeirsson, M.A.; Gudnason, K. [Icelandic Radiation Protection Inst., Reykjavik (Iceland); Arnalds, O. [Agricultural Research Inst., Reykjavik (Iceland); Howard, B.J.; Wright, S.M. [Centre for Ecology and Hydrology Merlewood, Cumbria, (United Kingdom); Palsdottir, I. [Iceland Meteorological Office, Reykjavik (Iceland)

    2002-12-01

    Iceland was identified in the Arctic Monitoring and Assessment Programme (AMAP) as one of the Arctic areas which received the most global fallout from atmospheric nuclear weapons tests, due to relatively high precipitation rates compared with much of the Arctic and sub arctic. Cs-137 in the Icelandic terrestrial ecosystem almost entirely originates from the nuclear weapons tests carried out in the atmosphere until the early sixties. Fallout was greatest in mid nineteen sixties. Additional fallout from the accident at the Chernobyl Nuclear Power Plant was relatively small. The study gave preliminary information on the spatial variation in {sup 137} Cs deposition in Iceland, especially in areas used for agriculture. The objectives of the study were (1) to measure the spatial variation of radiocaesium inventories in soils in Iceland and (2) to compare the results with different approaches to predicting {sup 137} Cs contents in soil. This quantification is a necessary first step in an evaluation of vulnerability to radiocaesium deposition in Iceland. It is anticipated that Icelandic soils could be highly vulnerable to radiocaesium due to their volcanic nature and consequent lack of illitic minerals, as has been suggested by initial chemical studies on the properties of soils in the Nordic countries. (ln)

  13. Cs-137 fallout in Iceland, model predictions and measurements

    Energy Technology Data Exchange (ETDEWEB)

    Palsson, S.E.; Sigurgeirsson, M.A.; Gudnason, K. [Icelandic Radiation Protection Inst. (Iceland); Arnalds, O.; Karlsdottir, I.A. [Agricultural Research Inst. (Iceland); Palsdottir, P. [Icelandic Meteorological Office (Iceland)

    2002-04-01

    Basically all the fallout Cs-137 in Iceland came from the atmospheric nuclear weapons tests in the late fifties and early sixties, the addition from the accident in the Chernobyl Nuclear Power Plant was relatively very small. Measurements of fallout from nuclear weapons tests started in Iceland over 40 years ago and samples of soil, vegetation and agricultural products have been collected from various places and measured during this period. Considerable variability has been seen in the results, even between places close to each other. This is understandable due to the mountainous terrain, changing strong winds and high levels of precipitation. This variability has been especially noticeable in the case of soil samples. The important role of uncultivated rangelands in Icelandic agriculture (e.g. for sheep farming) makes it necessary to estimate deposition for many remote areas. It has thus proven difficult to get a good overview of the distribution of the deposition and its subsequent transfer into agricultural products. Over a year ago an attempt was made to assess the distribution of Cs-137 fallout in Iceland. The approach is based on a model predicting deposition using precipitation data, in a similar manner as that used previously within the Arctic Monitoring and Assessment Programme (AMAP). 1999). One station close to Reykjavik has a time series of Cs-137 deposition data and precipitation data from 1960 onwards. The AMAP deposition model was calibrated for Iceland by using deposition and precipitation data from this station. (au)

  14. Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums; Biorremocao de Am-241 e Cs-137 de rejeitos radioativos liquidos por consorcios bacterianos

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-10-26

    This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137

  15. Kelvin probe studies of cesium telluride photocathode for the AWA photoinjector

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez, D.; Wisniewski, E. E.; Yusof, Z.; Harkay, K.; Spentzouris, L.; Terry, J. [Physics Department at Illinois Institute of Technology, Chicago, IL 60616 and High Energy Physics Division at Argonne National Laboratory, Lemont, IL 60439 (United States); High Energy Physics Division at Argonne National Laboratory, Lemont, IL 60439 (United States); Accelerator Science Division at Argonne National Laboratory, Lemont, IL 60439 (United States); Physics Department at Illinois Institute of Technology, Chicago, IL 60616 (United States)

    2012-12-21

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (> 1%), is robust in a photoinjector, and long lifetime. This photocathode is fabricated in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch ({approx}50 nC) in a long bunch train. We present some results from a study of the work function of cesium telluride photocathode using the Kelvin Probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV light exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating.

  16. Removal of cesium ions from aqueous solution by adsorption onto local Taiwan laterite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, T.-H. [Department of Engineering and System Science, National Tsing Hua University, Hsinchu 300, Taiwan (China); Li, M.-H. [Institute of Hydrological Sciences, National Central University, Jungli 320, Taiwan (China); Yeh, W.-C.; Wei, Y.-Y. [Nuclear Science and Technology Development Center, National Tsing Hua University, Hsinchu 300, Taiwan (China); Teng, S.-P. [Department of Engineering and System Science, National Tsing Hua University, Hsinchu 300, Taiwan (China); Institute of Nuclear Engineering and Science, National Tsing Hua University, Hsinchu 300, Taiwan (China)], E-mail: spteng@ess.nthu.edu.tw

    2008-12-30

    Utilization of local Taiwan laterite (LTL) to remove aqueous cesium was investigated in this work under the conditions of various contact time, cesium (Cs) loading and temperature. Experimental results show that adsorption is instantaneous. Freundlich and Langmuir simulation results demonstrate that local Taiwan laterite has high affinity and sorption capacity for Cs at low temperatures, which may be attributed to enhanced desorption as temperature increased. Thermodynamic parameters including {delta}H, {delta}G and {delta}S were calculated and it is indicated that Cs adsorption on LTL is an exothermic, spontaneous and physical adsorption reaction. Moreover, the adsorbed Cs is distributed evenly on the LTL surface, which is confirmed by SEM/EDS mapping images. Furthermore, the absence of apparent shifting or broadening of the kaolinite signal in XRD patterns after Cs adsorption is an indication of the non-expanding characteristic of kaolinite structure.

  17. Light storage via coherent population oscillation in a thermal cesium vapor

    CERN Document Server

    de Almeida, A J F; Maynard, M -A; Laupretre, T; Bretenaker, F; Felinto, D; Goldfarb, F; Tabosa, J W R

    2014-01-01

    We report on the storage of light via the phenomenon of Coherent Population Oscillation (CPO) in an atomic cesium vapor at room temperature. In the experiment the optical information of a probe field is stored in the CPO of two ground states of a Lambda three-level system formed by the Zeeman sublevels of the hyperfine transition F = 3 - F' = 2 of cesium D2 line. We show directly that this CPO based memory is very insensitive to stray magnetic field inhomogeneities and presents a lifetime which is mainly limited only by atomic motion. A theoretical simulation of the measured spectra was also developed and is in very good agreement with the experiment.

  18. Precision mass measurements of cesium isotopes—new entries in the ISOLTRAP chronicles

    Science.gov (United States)

    Atanasov, D.; Beck, D.; Blaum, K.; Borgmann, Ch; Cakirli, R. B.; Eronen, T.; George, S.; Herfurth, F.; Herlert, A.; Kowalska, M.; Kreim, S.; Litvinov, Yu A.; Lunney, D.; Manea, V.; Neidherr, D.; Rosenbusch, M.; Schweikhard, L.; Wienholtz, F.; Wolf, R. N.; Zuber, K.

    2017-04-01

    Alkali ion beams are among the most intense produced by the ISOLDE facility. These were the first to be studied by the ISOLTRAP mass spectrometer and ever since, new measurements have been regularly reported. Recently the masses of very neutron-rich and short-lived cesium isotopes were determined at ISOLTRAP. The isotope 148Cs was measured directly for the first time by Penning-trap mass spectrometry. Using the new results, the trend of two-neutron separation energies in the cesium isotopic chain is revealed to be smooth and gradually decreasing, similar to the ones of the barium and xenon isotopic chains. Predictions of selected microscopic models are employed for a discussion of the experimental data in the region.

  19. Stark spectra of Rydberg states in atomic cesium in the vicinity of n=18

    Institute of Scientific and Technical Information of China (English)

    Dong Hui-Jie; Wang Ting; Li Chang-Yong; Zhao Jian-Ming; Zhang Lin-Jie

    2013-01-01

    The Stark structures in a cesium atom around n =18 are numerically calculated.The results show that the components of 20D states with a small azimuthal quantum number |m| shift upward a lot,and those with a large |m| shift downward a little within 1100 V/cm.All components of P states shift downward.Experimental work has been performed in ultracold atomic cesium.Atoms initially in 6P3/2 state are excited to high-n Rydberg states by a polarization light perpendicular to the field,and Stark spectra with 丨m丨=1/2,3/2,5/2 are simultaneously observed with a large linewidth for the first time.The observed spectra are analyzed in detail.The relative transition probability is calculated.The experimental results are in good agreement with our numerical computation.

  20. Study on Growth and Optical, Scintillation Properties of Thallium Doped Cesium Iodide –Scintillator Crystal

    Directory of Open Access Journals (Sweden)

    B. Ravi

    2014-06-01

    Full Text Available Single crystal of Thallium doped cesium Iodide –Scintillator crystal was grown using vertical Bridgeman technique. The grown crystal was included for cutting and polishing for the characterization purpose and this crystal was studied by optical transmission properties, photo luminescence and thermally luminescence characteristics. Gamma-ray detectors were fabricated using the grown crystal that showed good linearity and nearly 7.5% resolution at 662 keV.

  1. Evaporative cooling of cesium atoms in the gravito-optical surface trap

    CERN Document Server

    Hammes, M; Grimm, R

    2000-01-01

    We report on cooling of an atomic cesium gas closely above an evanescent-wave. Our first evaporation experiments show a temperature reduction from 10muK down to 300nK along with a gain in phase-space density of almost two orders of magnitude. In a series of measurements of heating and spin depolarization an incoherent background of resonant photons in the evanescent-wave diode laser light was found to be the limiting factor at this stage.

  2. Strategic Design and Optimization of Inorganic Sorbents For Cesium, Strontium and Actinides

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, D.; Nyman, M.; Clearfield, A.; Maginn, E.

    2006-06-01

    The basic science goal in this project identifies structure/affinity relationships for selected radionuclides and existing sorbents. The task will apply this knowledge to the design and synthesis of new sorbents that will exhibit increased affinity for cesium, strontium and actinide separations. The target problem focuses on the treatment of high-level nuclear wastes. The general approach can likewise be applied to nonradioactive separations.

  3. Analysis of SubRamsey Patterns in Cesium Beam Frequency Standards

    Institute of Scientific and Technical Information of China (English)

    CHEN Jingbiao; WANG Fengzhi; YANG Donghai; WANG Yiqiu

    2001-01-01

    Using a precise probability expres-sion under excessive microwave power condition, theRamsey patterns in a cesium atomic beam frequencystandard with Ramsey separated oscillating fields havebeen carefully analyzed by numerical method. TwosubRamsey patterns are produced on both sides ofthe central Ramsey pattern. All factors, including mi-crowave power, excitation region length, drift regionlength and atomic velocity distribution, which affectthe subRamsey pattern have been analyzed, and someexplanations coming from approximated theory havebeen corrected in this paper.

  4. Mössbauer study on the gamma radiolysis of anhydrous cesium tris (oxalato) ferrate(III)

    Science.gov (United States)

    Ladriere, J.; Senterre, V.; Apers, D.

    1992-04-01

    The final product of the gamma radiolysis of anhydrous cesium tris(oxalato) ferrate(III) has been identified by Mössbauer spectroscopy as Cs2Fe(ox)2. The radiolytic decomposition proceeds as a first-order process due to the original compound depletion and to the radiolytic stability of the ferrous compound. Lamb-Mössbauer factors measurements indicate that the recoilless fractions of the iron species are practically unaffected by the radiolysis.

  5. The Effect of Cesium Vapour on the Bulk Conductivity of Plasma - Sprayed Alumina

    Science.gov (United States)

    2007-11-02

    from the NaK coolant channels by a 50 [tm gap filled with helium at around 100 Torr. Ideally there would be no contact between the outer metallic ...reservoir of the liquid metal . The reservoir consists of a one inch diameter stainless steel cylinder clamped between two copper blocks. Cartridge heaters...Cesium is contained within the inter-electrode gap by a metal -ceramic seal at each end of the TFE. Therefore under normal operating conditions the

  6. Photon Driven Transformation of Cesium Lead Halide Perovskites from Few-Monolayer Nanoplatelets to Bulk Phase.

    Science.gov (United States)

    Wang, Yue; Li, Xiaoming; Sreejith, Sivaramapanicker; Cao, Fei; Wang, Zeng; Stuparu, Mihaiela Corina; Zeng, Haibo; Sun, Handong

    2016-12-01

    Influence of light exposure on cesium lead halide nanostructures has been explored. A discovery of photon driven transformation (PDT) in 2D CsPbBr3 nanoplatelets is reported, in which the quantum-confined few-monolayer nanoplatelets will convert to bulk phase under very low irradiation intensity (≈20 mW cm(-2) ). Benefiting from the remarkable emission color change during PDT, the multicolor luminescence photopatterns and facile information photo-encoding are established.

  7. In vivo effects of a chronic contamination by uranium or cesium 137 on the pharmaceutical metabolism, of the vitamin D and cholesterol; Effets in vivo d'une contamination chronique par l'uranium ou le cesium 137 sur le metabolisme du medicament, de la vitamine D et du cholesterol

    Energy Technology Data Exchange (ETDEWEB)

    Souidi, M

    2006-11-15

    In conclusion, an animal model, miming the chronic contamination of the populations exposed to the uranium, was used for the first time to show that the chronic ingestion of a weak dose of depleted uranium can affect the level of active vitamin D without modifying the mineral homeostasis. This study shows that this radionuclide can lead molecular modifications of the CYPs and the nuclear receivers involved in the metabolism of the vitamin D not only at the level of the liver and kidney but also at the level of the independent metabolism in the brain. The deficiency in vitamin D can provoke osseous diseases such as the rickets at the child and the osteomalacia at the adult. The three categories of population the most exposed to this deficiency are the infants, the pregnant women and the old persons. Strong prevalence of the vitamin D deficiency associated with a chronic exposure to uranium could lead to osseous disorders. To verify this hypothesis, it will be necessary secondly to realize this study on individuals animal models predisposed to the rickets or to the osteomalacia. (N.C.)

  8. Divergence of Cs-137 sources fluence used in brachytherapy; Divergencia da fluencia de fontes de Cs-137 usadas em braquiterapia

    Energy Technology Data Exchange (ETDEWEB)

    Vianello, E.A.; Almeida, C.E. de [Laboratorio de Ciencias Radiologicas- LCR-DBB (UERJ). R. Sao Francisco Xavier, 524- Pav. HLC, sala 136 terreo- CEP 20.550- 013. Rio de Janeiro (Brazil)

    1998-12-31

    In this work the experimental determination of correction factor for fluence divergence (kln) of linear Cs-137 sources CDCS J4, with Farmer ionization chamber model 2571 in a central and perpendicular plan to source axis, for distances range from 1 to 7 cm., has been presented. The experimental results were compared to calculating by Kondo and Randolph (1960) isotropic theory and Bielajew (1990) anisotropic theory. (Author)

  9. Temperature and number evolution of cold cesium atoms inside a wall-coated glass cell

    Institute of Scientific and Technical Information of China (English)

    黄家强; 张建伟; 王时光; 王力军

    2015-01-01

    We report an experimental study on the temperature and number evolution of cold cesium atoms diffusively cooled inside a wall-coated glass cell by measuring the absorption profile of the 62S1/2 (F=4)→62P3/2(F0=5) transition line with a weak probe laser in the evolution process. We found that the temperature of the cold atoms first gradually decreases from 16 mK to 9 mK, and then rapidly increases. The number of cold atoms first declines slowly from 2.1 × 109 to 3.7 × 108 and then falls drastically. A theoretical model for the number evolution is built and includes the instantaneous temperature of the cold atoms and a fraction p, which represents the part of cold cesium atoms elastically reflected by the coated cell wall. The theory is overall in good agreement with the experimental result, and a nonzero value is obtained for the fraction p, which indicates that the cold cesium atoms are not all heated to the ambient temperature by a single collision with the coated cell wall. These results can provide helpful insight for precision measurements based on diffuse laser cooling.

  10. DFB-ridge laser diodes at 894 nm for Cesium atomic clocks

    Science.gov (United States)

    von Bandel, N.; Garcia, M.; Lecomte, M.; Larrue, A.; Robert, Y.; Vinet, E.; Driss, O.; Parrilaud, O.; Krakowski, M.; Gruet, F.; Matthey, R.; Mileti, G.

    2016-02-01

    Time and frequency applications are in need of high accuracy and high stability clocks. Optically pumped compact industrial Cesium atomic clocks are a promising approach that could satisfy these demands. However, the stability of these clocks relies, among others, on the performances of the laser diodes that are used. This issue has led the III-V Lab to commit to the European Euripides-LAMA project that aims to provide competitive compact optical Cesium clocks for ground applications. This work will provide key experience for further space technology qualification. III-V Lab is in charge of the design, fabrication and reliability of Distributed-Feedback diodes (DFB) at 894 nm (D1 line of Cesium) and 852 nm (D2 line). LTF-Unine is in charge of their spectral characterisation. The use of D1 line for pumping will provide simplified clock architecture compared to the D2 line pumping thanks to simpler atomic transitions and a larger spectral separation between lines in the 894 nm case. Also, D1 line pumping overcomes the issue of unpumped "idle states" that occur with D2 line. The modules should provide narrow linewidth (= 10 Hz and 109 Hz2/Hz @ f >= 10 Hz.

  11. Inhibition of sodium current by taurine magnesium coordination compound prevents cesium chloride-induced arrhythmias.

    Science.gov (United States)

    Yin, Yongqiang; Wen, Ke; Wu, Yanna; Kang, Yi; Lou, Jianshi

    2012-05-01

    The mechanism(s) by which taurine magnesium coordination compound (TMCC) inhibits experimental arrhythmias remains poorly understood. The purpose of this study was to observe the effects of TMCC against cesium chloride-induced arrhythmia in the rabbit heart and find whether the antiarrhythmic activity is related to inhibition of sodium current. Early afterdepolarization was induced by 1.5 mM cesium chloride (1 ml kg(-1)) through intravenous injection. The monophasic action potentials (MAP) and electrocardiograms were simultaneously recorded. The effect of TMCC on functional refractory periods (FRPs) in the left atrium was also observed in vitro. Arrhythmias onset was significantly retarded by TMCC. The number of ventricular premature contractions and incidence of monophasic ventricular tachycardia and polyphasic ventricular tachycardia in 10 min were decreased by TMCC. These effects can be abolished by veratridine (10 μg kg(-1)). MAP duration at 90% repolarization was significantly prolonged by TMCC, which can be prolonged even longer by veratridine (10 μg kg(-1)). In vitro experiments showed that FRPs was prolonged by TMCC which can be cancelled by veratridine (10 μg kg(-1)). TMCC prevents cesium chloride-induced arrhythmias, and inhibition of sodium current, in part, contributes to the antiarrhythmic effect of TMCC.

  12. Study on magnetic separation for decontamination of cesium contaminated soil by using superconducting magnet

    Energy Technology Data Exchange (ETDEWEB)

    Igarashi, Susumu, E-mail: igarashi@qb.see.eng.osaka-u.ac.jp; Nomura, Naoki; Mishima, Fumihito; Akiyama, Yoko, E-mail: yoko-ak@see.eng.osaka-u.ac.jp

    2014-09-15

    Highlights: • The method for the soil decontamination by the superconducting magnet is proposed. • Magnetic separation of clay minerals was performed by HGMS. • Soil separation ratio was evaluated by quantitative analysis using XRD. • It is expected that HGMS can be applied to the actual soil decontamination. - Abstract: The accident of Fukushima Daiichi nuclear power plant caused the diffusion of radioactive cesium over the wide area. We examined the possibility of applying magnetic separation method using the superconducting magnet, which can process a large amount of the soil in high speed, to the soil decontamination and volume reduction of the radioactive cesium contaminated soil. Clay minerals are classified as 2:1 and 1:1 types by the difference of their layer structures, and these types of minerals are respectively paramagnetic and diamagnetic including some exception. It is known that most of the radioactive cesium is strongly adsorbed on the clay, especially on 2:1 type clay minerals. It is expected that the method which can separate only 2:1 type clay minerals selectively from the mixture clay minerals can enormously contribute to the volume reduction of the contaminated soil. In this study, the components in the clay before and after separation were evaluated to estimate the magnetic separation efficiency by using X-ray diffraction. From the results, the decontamination efficiency and the volume reduction ratio were estimated in order to examine the appropriate separation conditions for the practical decontamination of the soil.

  13. ION EXCHANGE MODELING FOR REMOVAL OF CESIUM FROM HANFORD WASTE USING SUPERLIG 644 RESIN

    Energy Technology Data Exchange (ETDEWEB)

    Hamm, L

    2004-05-01

    The expected performance of a proposed ion exchange column using SuperLig{reg_sign} 644 resin for the removal of cesium from Hanford high level radioactive alkaline waste is discussed. This report represents a final report on the ability and knowledge with regard to modeling the Cesium-SuperLig{reg_sign} 644 resin ion exchange system. Only the loading phase of the cycle process is addressed within this report. Pertinent bench-scale column tests and batch equilibrium experiments are addressed. The methodology employed and sensitivity analyses are also included (i.e., existing methodology employed is referenced to prior developmental efforts while updated methodology is discussed). Pilot-scale testing is not assessed since no pilot-scale testing was available at the time of this report. Column performance predictions are made considering three selected feed compositions under nominal operating conditions. The sensitivity analyses provided help to identify key parameters that aid in resin procurement acceptance criteria. The methodology and application presented within this report reflect the expected behavior of SuperLig{reg_sign} 644 resin manufactured at the production-scale (i.e, 250 gallon batch size level). The primary objective of this work was, through modeling and verification based on experimental assessments, to predict the cesium removal performance of SuperLig{reg_sign} 644 resin for application in the RPP pretreatment facility.

  14. Novel application of nanozeolite for radioactive cesium removal from high-salt wastewater.

    Science.gov (United States)

    Lee, Keun-Young; Kim, Kwang-Wook; Park, Minsung; Kim, Jimin; Oh, Maengkyo; Lee, Eil-Hee; Chung, Dong-Yong; Moon, Jei-Kwon

    2016-05-15

    Finding a striking peculiarity of nanomaterials and evaluating its feasibility for practical use are interesting topics of research. We investigated the application of nanozeolite's outstanding reactivity for a rapid and effective method for radioactive cesium removal in the wastewater generated from nuclear power plant accident, as a new concept. Extremely fast removal of cesium, even without stirring, was achieved by the nanozeolite at efficiencies never observed with bulk materials. The nanozeolite reached an adsorption equilibrium state within 1 min. Cesium adsorption by nanozeolite was demonstrated at reaction rates of orders of magnitude higher than that of larger zeolite phases. This observation was strongly supported by the positive correlation between the rate constant ratio (k2,bulk/k2,nano) and the initial Cs concentrations with a correlation coefficient (R(2)) of 0.99. A potential drawback of a nanoadsorbent is the difficulty of particle settling and separation because of its high dispersivity in solution. However, our results also demonstrated that the nanozeolite could be easily precipitated from the high-salt solution with ferric flocculant. The flocculation index reached a steady state within 10 min. A series of our experimental results met the goal of rapid processing in the case of emergency by applying the well-suited nanozeolite adsorption and flocculation.

  15. Enhanced capacity and stability for the separation of cesium in electrically switched ion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Tawfic, A.F.; Dickson, S.E.; Kim, Y. [McMaster University, Hamilton, ON (Canada); Mekky, W. [AMEC NSS, Power and Process America, Toronto (Canada)

    2015-03-15

    Electrically switched ion exchange (ESIX) can be used to separate ionic contaminants from industrial wastewater, including that generated by the nuclear industry. The ESIX method involves sequential application of reduction and oxidation potentials to an ion exchange film to induce the respective loading and unloading of cesium. This technology is superior to conventional methods (e.g electrodialysis reversal or reverse osmosis) as it requires very little energy for ionic separation. In previous studies, ESIX films have demonstrated relatively low ion exchange capacities and limited film stabilities over repeated potential applications. In this study, the methodology for the deposition of electro-active films (nickel hexacyanoferrate) on nickel electrodes was modified to improve the ion exchange capacity for cesium removal using ESIX. Cyclic voltammetry was used to investigate the ion exchange capacity and stability. Scanning electron microscopy (SEM) was used to characterize the modified film surfaces. Additionally, the films were examined for the separation of cesium ions. This modified film preparation technique enhanced the ion exchange capacity and improves the film stability compared to previous methods for the deposition of ESIX films. (authors)

  16. Cellulose nanofiber backboned Prussian blue nanoparticles as powerful adsorbents for the selective elimination of radioactive cesium

    Science.gov (United States)

    Vipin, Adavan Kiliyankil; Fugetsu, Bunshi; Sakata, Ichiro; Isogai, Akira; Endo, Morinobu; Li, Mingda; Dresselhaus, Mildred S.

    2016-11-01

    On 11 March 2011, the day of the unforgettable disaster of the 9 magnitude Tohoku earthquake and quickly followed by the devastating Tsunami, a damageable amount of radionuclides had dispersed from the Fukushima Daiichi’s damaged nuclear reactors. Decontamination of the dispersed radionuclides from seawater and soil, due to the huge amounts of coexisting ions with competitive functionalities, has been the topmost difficulty. Ferric hexacyanoferrate, also known as Prussian blue (PB), has been the most powerful material for selectively trapping the radioactive cesium ions; its high tendency to form stable colloids in water, however, has made PB to be impossible for the open-field radioactive cesium decontamination applications. A nano/nano combinatorial approach, as is described in this study, has provided an ultimate solution to this intrinsic colloid formation difficulty of PB. Cellulose nanofibers (CNF) were used to immobilize PB via the creation of CNF-backboned PB. The CNF-backboned PB (CNF/PB) was found to be highly tolerant to water and moreover, it gave a 139 mg/g capability and a million (106) order of magnitude distribution coefficient (Kd) for absorbing of the radioactive cesium ion. Field studies on soil and seawater decontaminations in Fukushima gave satisfactory results, demonstrating high capabilities of CNF/PB for practical applications.

  17. Fire Safety Tests for Cesium-Loaded Spherical Resorcinol Formaldehyde Resin: Data Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong-Sang; Schweiger, Michael J.; Peterson, Reid A.

    2012-09-01

    A draft safety evaluation of the scenario for spherical resorcinol formaldehyde (SRF) resin fire inside the ion exchange column was performed by the Hanford Tank Waste Treatment and Immobilization Plant (WTP) Fire Safety organization. The result of this draft evaluation suggested a potential change of the fire safety classification for the Cesium Ion Exchange Process System (CXP) emergency elution vessels, equipment, and piping. To resolve this question, the fire properties of the SRF resin were measured by Southwest Research Institute (SwRI) through a subcontract managed by Pacific Northwest National Laboratory (PNNL). The results of initial fire safety tests on the SRF resin were documented in a previous report (WTP-RPT-218). The present report summarizes the results of additional tests performed by SwRI on the cesium-loaded SRF resin. The efforts by PNNL were limited to summarizing the test results provided by SwRI into one consolidated data report. The as-received SwRI report is attached to this report in the Appendix A. Where applicable, the precision and bias of each test method, as given by each American Society for Testing and Materials (ASTM) standard procedure, are included and compared with the SwRI test results of the cesium-loaded SRF resin.

  18. Uptake and transport of radioactive cesium and strontium into grapevines after leaf contamination

    Science.gov (United States)

    Zehnder, H. J.; Kopp, P.; Eikenberg, J.; Feller, U.; Oertli, J. J.

    1995-07-01

    From 1989 to 1993 the foliar uptake of radioactive strontium (Sr-85) and cesium (Cs-134) by selected leaves of grapevine plants and the subsequent redistribution within the plants was examined under controlled conditions in a greenhouse. The radionuclides were applied as chlorides. These plants were grown in large pots containing a mixture of local soil and peat. Plant and soil samples were analyzed throughout the growing season and also during the following vegetation period. Only traces of the applied radiostrontium were taken up by the leaves. This element was essentially not redistributed within the plants. In contrast, radiocesium was easily taken up through the leaf surface, transported to other plant parts and to some extent released from the roots into the soil. Cesium reaching the soil may interact with clay particles causing a very reduced availability for plants. Therefore the soil may act as a long-term sink for radiocesium. On the other hand, grape berries represent transient sinks. The cesium levels in the berries decreased again in a late phase of maturation, but the mechanisms causing this loss are not yet identified. During the second vegetation period, only a very minor proportion of the radiocesium taken up previously by the plants was present in the above ground parts.

  19. Evaluating gully erosion using {sup 137}Cs and {sup 210}Pb/{sup 137}Cs ratio in a reservoir catchment

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y. [Institute of Agricultural Environment and Sustainable Development, CAAS, Beijing (China) and Institute for Application of Atomic Energy, CAAS, Beijing (China)]. E-mail: yongli32@hotmail.com and yongli@ami.ac.cn; Poesen, J. [Laboratory for Experimental Geomorphology, Catholic University Leuven, Leuven (Belgium); Yang, J.C.; Zhang, J.H. [Institute of Agricultural Environment and Sustainable Development, CAAS, Beijing (China); Institute for Application of Atomic Energy, CAAS, Beijing (China); Fu, B. [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing (China)

    2003-02-15

    Water erosion in the hilly areas of west China is the main process contributing to the overall sediment of the Yellow River and the Yangtze River. The impact of gully erosion in total sediment output has been mostly neglected. Our objective was to assess the sediment production and sediment sources at both the hillslope and catchment scales in the Yangjuangou reservoir catchment of the Chinese Loess Plateau, northwest China. Distribution patterns in sediment production caused by water erosion on hills and gully slopes under different land use types were assessed using the fallout {sup 137}Cs technique. The total sediment production from the catchment was estimated by using the sediment record in a reservoir. Sediment sources and dominant water erosion processes were determined by comparing {sup 137}Cs activities and {sup 210}Pb/{sup 137}Cs ratios in surface soils and sub-surface soils with those of sediment deposits from the reservoir at the outlet of the catchment. Results indicated that landscape location had the most significant impact on sediment production for cultivated hillslopes, followed by the terraced hillslope, and the least for the vegetated hillslope. Sediment production increased in the following order: top>upper>lower>middle for the cultivated hillslope, and top>lower>upper>middle for the terraced hillslope. The mean value of sediment production declined by 49% for the terraced hillslope and by 80% for the vegetated hillslope compared with the cultivated hillslope. Vegetated gully slope reduced the sediment production by 38% compared with the cultivated gully slope. These data demonstrate the effectiveness of terracing and perennial vegetation cover in controlling sediment delivery at a hillslope scale. Averaged {sup 137}Cs activities and {sup 210}Pb/{sup 137}Cs ratios in the 0-5 cm surface soil (2.22-4.70 Bq kg{sup -1} and 20.70-22.07, respectively) and in the 5-30 cm subsoil (2.60 Bq kg{sup -1} and 28.57, respectively) on the cultivated hills and

  20. Fukushima 137Cs at the base of planktonic food webs off Japan

    Science.gov (United States)

    Baumann, Z.; Fisher, N. S.; Gobler, C. J.; Buesseler, K. O.; George, J. A.; Breier, C. F.; Nishikawa, J.

    2015-12-01

    The potential bioaccumulation of 137Cs in marine food webs off Japan became a concern following the release of radioactive contaminants from the damaged Fukushima nuclear power plant into the coastal ocean. Previous studies suggest that 137Cs activities increase with trophic level in pelagic food webs, however, the bioaccumulation of 137Cs from seawater to primary producers, to zooplankton has not been evaluated in the field. Since phytoplankton are frequently the largest component of suspended particulate matter (SPM) we used SPM concentrations and particle-associated 137Cs to understand bioaccumulation of 137Cs in through trophic pathways in the field. We determined particle-associated 137Cs for samples collected at 20 m depth from six stations off Japan three months after the initial release from the Fukushima nuclear power plant. At 20 m SPM ranged from 0.65 to 1.60 mg L-1 and rapidly declined with depth. The ratios of particulate organic carbon to chlorophyll a suggested that phytoplankton comprised much of the SPM in these samples. 137Cs activities on particles accounted for on average 0.04% of the total 137Cs in seawater samples, and measured concentration factors of 137Cs on small suspended particles were comparatively low (∼102). However, when 137Cs in crustacean zooplankton was derived based only on modeling dietary 137Cs uptake, we found predicted and measured 137Cs concentrations in good agreement. We therefore postulate the possibility that the dietary route of 137Cs bioaccumulation (i.e., phytoplankton ingestion) could be largely responsible for the measured levels in the copepod-dominated (%) zooplankton assemblages in Japanese coastal waters. Finally, our data did not support the notion that zooplankton grazing on phytoplankton results in a biomagnification of 137Cs.

  1. 青海共和盆地土壤风蚀的137Cs法研究(Ⅱ)--137Cs背景值与风蚀速率测定%Application of Caesium-137 Technique on Wind Erosion in Gonghe Basin, Qinghai Province (Ⅱ)-137Cs Reference Inventory and 137Cs Model for Wind Erosion Estimation

    Institute of Scientific and Technical Information of China (English)

    严平; 董光荣; 张信宝; 邹学勇

    2003-01-01

    通过对高寒草原背景值样点(RS7)的分析,将共和盆地的137Cs背景值含量确定为(2 691.78±196.08) Bq*m-2,基本接近北半球137Cs背景值的平均水平,其137Cs剖面满足尖峰分布函数,与公认的理论分布(即负指数分布)相比,呈现出峰值下移和曲线趋平的现象,可能与近几十年来137Cs的稳定下渗有关.应用137Cs背景值剖面分布函数,建立了风蚀速率的137Cs估算模型,估算出四个样方的土壤风蚀速率,并由此转化为区域风蚀速率,计算出共和盆地区域土壤风蚀速率为12.556 t*hm-2*a-1,通过蚀积平衡检验,其误差水平小于10%.并分析了风蚀物的输出途径及其所占比例.

  2. 33 CFR 137.70 - Specialized knowledge or experience on the part of persons specified in § 137.1(a).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Specialized knowledge or... INNOCENT LAND-OWNER DEFENSE Standards and Practices § 137.70 Specialized knowledge or experience on the... located, persons specified in § 137.1(a) must take into account their own specialized knowledge of...

  3. 8 GHz Tunable Gunn Oscillator in WR-137 Waveguide

    Directory of Open Access Journals (Sweden)

    P. C. Rakshit

    1983-01-01

    Full Text Available The conventional technique of realising waveguide resonators for Gunn diode oscillators to operate at the band edge of the waveguide fails owing to the excitation of a coaxial mode resonance formed by the post and the side walls of the waveguide. One of the solutions to the problem is to mount the diode in a ridged waveguide resonator. This has been demonstrated by constructing an 8 GHz Gunn oscillator using a single ridge in WR-137 waveguide.The steps in designing the oscillator system are also presented.

  4. A study of mechanisms responsible for incorporation of cesium and radiocesium into fruitbodies of king oyster mushroom (Pleurotus eryngii)

    Energy Technology Data Exchange (ETDEWEB)

    Bystrzejewska-Piotrowska, Grazyna [Isotope Laboratory, Faculty of Biology, Warsaw University, 02-096 Warsaw, Miecznikowa 1 (Poland)], E-mail: byst@biol.uw.edu.pl; Bazala, Michal A. [Isotope Laboratory, Faculty of Biology, Warsaw University, 02-096 Warsaw, Miecznikowa 1 (Poland)

    2008-07-15

    Ex vitro cultures of Pleurotus eryngii were carried out under controlled conditions using sterile medium composed of barley seeds. The influence of alkali and alkaline earth element salts (CsCl, KCl, NaCl, RbCl, and CaCl{sub 2}) and tetraethylammonium chloride on incorporation of cesium, potassium, sodium, rubidium and calcium, and their distribution within fruitbodies, was examined. The results show that incorporation of cesium into fruitbodies was not suppressed by Na{sup +} and Rb{sup +} or tetraethylammonium chloride. However, it was inhibited by Ca{sup 2+} and stimulated by high concentrations of K{sup +}. The inhibition of cesium incorporation by Ca{sup 2+}, lack of influence of tetraethylammonium chloride and stimulation by high K{sup +} concentrations suggest that there may exist two pathways of passive transport of cesium in mycelium: (i) uptake mediated by a non-specific potassium channel localised in plasmalemma (similar to voltage-insensitive cation channel, VICC) followed by diffusive transport inside hyphae and (ii) extracellular transport from the medium through inter-hyphal cavities into fruitbodies. The results highlight distinctiveness of mechanisms responsible for the uptake and incorporation of cesium in mushrooms and plants.

  5. {sup 137}Cs applicability to soil erosion assessment: theoretical and empirical model; Aplicabilidade do {sup 137}Cs para medir erosao do solo: modelos teoricos e empiricos

    Energy Technology Data Exchange (ETDEWEB)

    Andrello, Avacir Casanova

    2004-02-15

    The soil erosion processes acceleration and the increase of soil erosion rates due to anthropogenic perturbation in soil-weather-vegetation equilibrium has influenced in the soil quality and environment. So, the possibility to assess the amplitude and severity of soil erosion impact on the productivity and quality of soil is important so local scale as regional and global scale. Several models have been developed to assess the soil erosion so qualitative as quantitatively. {sup 137}Cs, an anthropogenic radionuclide, have been very used to assess the superficial soil erosion process Empirical and theoretical models were developed on the basis of {sup 137} Cs redistribution as indicative of soil movement by erosive process These models incorporate many parameters that can influence in the soil erosion rates quantification by {sup 137} Cs redistribution. Statistical analysis was realized on the models recommended by IAEA to determinate the influence that each parameter generates in results of the soil redistribution. It was verified that the most important parameter is the {sup 137} Cs redistribution, indicating the necessity of a good determination in the {sup 137} Cs inventory values with a minimum deviation associated with these values. After this, it was associated a 10% deviation in the reference value of {sup 137} Cs inventory and the 5% in the {sup 137} Cs inventory of the sample and was determinate the deviation in results of the soil redistribution calculated by models. The results of soil redistribution was compared to verify if there was difference between the models, but there was not difference in the results determinate by models, unless above 70% of {sup 137} Cs loss. Analyzing three native forests and an area of the undisturbed pasture in the Londrina region, can be verified that the {sup 137} Cs spatial variability in local scale was 15%. Comparing the {sup 137} Cs inventory values determinate in the three native forest with the {sup 137} Cs inventory

  6. 137Ba Double Gamma Decay Measurement with GAMMASPHERE

    Directory of Open Access Journals (Sweden)

    Merchán E.

    2015-01-01

    Full Text Available The study of the electromagnetic moments (EM, and decay probability, provides detailed information about nuclear wave functions. The well-know properties of EM interactions are good for extracting information about the motion of nucleons. Higher order EM processes always occur, but are usually too weak to be measured. In the case of a 0+ → 0+ transitions [1, 2], where a single gamma transition is forbidden, the simultaneous emission of two γ-rays has been studied. An interesting opportunity to further investigate 2-photon emission phenomena is by using a standard 137Cs source populating, via β-decay, the Jπ = 11/2− isomeric state at 662 keV in 137Ba. In this case, two photon process can have contributions from quadrupole-quadrupole or dipole-octupole multipolarities in direct competition with the high multipolarity M4 decay. Since the yield of the double gamma decay is around six orders of magnitude less than the first order transition, very good statistics are needed in order to observe the phenomena and great care must be taken to suppress the first-order decay. The Gammasphere array is ideal since its configuration allows a good coverage of the angular distribution and the Compton events can be suppressed. Nevertheless the process to understand and eliminate the Compton background is a challenge. Geant4 simulations were carried out to help understand and correct for those factors.

  7. Cesium accumulation by bacterium Thermus sp.TibetanG7: hints for biomineralization of cesiumbearing geyserite in hot springs in Tibet, China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The bacterium Thermus sp. TibetanG7, isolated from hot springs in Tibet, China, was examined for the ability to accumulate cesium from solutions. Environmental conditions were simulated and the effects of pH, K+, Na+ and K+-regimes were then studied to determine the possible role of the bacterium in the formation of cesium-bearing geyserite around these hot springs. In despite of the inhibition of K+ and Na+, the bacterium Thermus sp. TibetanG7 revealed noticeable accumulation of cesium from solutions, with maximum accumulations of 53.49 and 40.41 μmol Cesium/g cell dry weight in Na+ and K+ inhibition experiments, respectively. The accumulation of cesium by this microorganism is rapid, with 40%―50% accumulated within the first 5 min. K+-deficient cells showed a much higher capacity of cesium accumulation compared with K+-sufficient cells. It is evident that the bacteria within the genus thermus play a significant role in the cesium assembly. The formation of cesium-bearing geyserite is also considered.

  8. Reconstruction of 137Cs activity in the ocean following the Fukushima Daiichi Nuclear Power Plant Accident

    Science.gov (United States)

    Tsumune, Daisuke; Aoyama, Michio; Tsubono, Takaki; Tateda, Yutaka; Misumi, Kazuhiro; Hayami, Hiroshi; Toyoda, Yasuhiro; Maeda, Yoshiaki; Yoshida, Yoshikatsu; Uematsu, Mitsuo

    2014-05-01

    A series of accidents at the Fukushima Dai-ichi Nuclear Power Plant following the earthquake and tsunami of 11 March 2011 resulted in the release of radioactive materials to the ocean by two major pathways, direct release from the accident site and atmospheric deposition. We reconstructed spatiotemporal variability of 137Cs activity in the ocean by the comparison model simulations and observed data. We employed a regional scale and the North Pacific scale oceanic dispersion models, an atmospheric transport model, a sediment transport model, a dynamic biological compartment model for marine biota and river runoff model to investigate the oceanic contamination. Direct releases of 137Cs were estimated for more than 2 years after the accident by comparing simulated results and observed activities very close to the site. The estimated total amounts of directly released 137Cs was 3.6±0.7 PBq. Directly release rate of 137Cs decreased exponentially with time by the end of December 2012 and then, was almost constant. The daily release rate of 137Cs was estimated to be 3.0 x 1010 Bq day-1 by the end of September 2013. The activity of directly released 137Cs was detectable only in the coastal zone after December 2012. Simulated 137Cs activities attributable to direct release were in good agreement with observed activities, a result that implies the estimated direct release rate was reasonable, while simulated 137Cs activities attributable to atmospheric deposition were low compared to measured activities. The rate of atmospheric deposition onto the ocean was underestimated because of a lack of measurements of dose rate and air activity of 137Cs over the ocean when atmospheric deposition rates were being estimated. Observed 137Cs activities attributable to atmospheric deposition in the ocean helped to improve the accuracy of simulated atmospheric deposition rates. Although there is no observed data of 137Cs activity in the ocean from 11 to 21 March 2011, observed data of

  9. Cesium Platinide Hydride 4Cs 2 Pt-CsH: An Intermetallic Double Salt Featuring Metal Anions

    Energy Technology Data Exchange (ETDEWEB)

    Smetana, Volodymyr [Ames Laboratory, US Department of Energy, and Critical Materials Institute, Ames Iowa 50011-3020 USA; Mudring, Anja-Verena [Ames Laboratory, US Department of Energy, and Critical Materials Institute, Ames Iowa 50011-3020 USA; Department of Materials Sciences and Engineering, Iowa State University, Ames Iowa 50011-3111 USA

    2016-10-24

    With Cs9Pt4H a new representative of ionic compounds featuring metal anions can be added to this rare-membered family. Cs9Pt4H exhibits a complex crystal structure containing Cs+ cations, Pt2- and H- anions. Being a red, transparent compound its band gap is in the visible range of the electromagnetic spectrum and the ionic type of bonding is confirmed by quantum chemical calculations. This cesium platinide hydride can formally be considered as a double salt of the “alloy” cesium–platinum, or better cesium platinide, Cs2Pt, and the salt cesium hydride CsH according to Cs9Pt4H≡4 Cs2Pt∙CsH.

  10. One Pot Synthesis and Characterization of Cesium Doped SnO2 Nanocrystals via a Hydrothermal Process

    Institute of Scientific and Technical Information of China (English)

    K. Kaviyarasu; Prem Anand Devarajan; S. Stanly John Xavier; S. Augustine Thomas; S. Se]vakumar

    2012-01-01

    The physico-chemical properties of cesium doped SnO2 nanocrystals synthesized by wet chemical method have been investigated. Scanning electron microscopy (SEM), X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX), inductively coupled plasma (ICP), atomic absorption spectroscopic (AAS) analyses, UV-vis-NIR spectral studies and dielectric studies were carried out for both pure SnO2 and cesium doped SnO2 nano-samples. All samples of SnO2 did not show any metallic cluster, but the sample containing cesium as a dopant displayed significant activity. The products formed were chloride and water representing a competitive advantage from the stand point of environmental protection.

  11. Prussian blue caged in alginate/calcium beads as adsorbents for removal of cesium ions from contaminated water

    Energy Technology Data Exchange (ETDEWEB)

    Vipin, Adavan Kiliyankil; Hu, Baiyang; Fugetsu, Bunshi, E-mail: hu@ees.hokudai.ac.jp

    2013-08-15

    Highlights: • Prussian blue was encapsulated in calcium/alginate beads. •The Prussian blue encapsulated beads were reinforced using carbon nanotubes. • Adsorption behaviors toward cesium were studied with the aid of appropriate mathematical models. • The beads showed high efficiency over a wide range of pH, potassium and sodium ion concentrations. • Continuous column analysis proved that the beads are suitable for large-scale water treatments. -- Abstract: Prussian blue encapsulated in alginate beads reinforced with highly dispersed carbon nanotubes were prepared for the safe removal of cesium ions from aqueous solutions. Equilibrium and kinetic studies were conducted using different models and the goodness of mathematical fitting of the experimental data on the adsorption isotherms was in the order Langmuir > Freundlich, and that of the kinetic models were in the order of pseudo second order > pseudo first order. Fixed bed adsorption column analysis indicated that the beads can be used for large scale treatment of cesium contaminated water.

  12. The role of cesium suboxides in low-work-function surface layers studied by X-ray photoelectron spectroscopy - Ag-O-Cs

    Science.gov (United States)

    Yang, S.-J.; Bates, C. W., Jr.

    1980-01-01

    The oxidation of cesium on silver substrates has been studied using photoyield measurements and X-ray photoelectron spectroscopy. The occurrence of two O1s peaks in the core-level spectrum at 527.5 and 531.5-eV binding energy for cesium and oxygen exposures giving the optimum photoyield proves that two oxides of cesium exist in high-photoyield surfaces, and not Cs2O alone as previously thought. From the shape and position of the cesium peaks and the Auger parameter, the assignment of the O1s peaks at 527.5- and 531.5-eV binding energies to oxygen in Cs2O and Cs11O3, respectively, can be made. Hence the total cesium-oxygen layer is a mixed phase consisting of Cs2O + Cs11O3, approximately 20-40 A thick.

  13. 137例内脏利什曼病患者临床分析%Clinical Analysis of 137 Patients with Visceral Leishmaniasis

    Institute of Scientific and Technical Information of China (English)

    高芹; 刘焱斌; 钟册俊; 吕晓菊

    2013-01-01

    目的 分析近十几年四川地区内脏利什曼病住院患者临床和流行病学特征.方法 收集2000年1月至2012年4月四川大学华西医院收治的内脏利什曼病患者137例的资料,回顾性分析流行病学、临床特点、治疗和转归.结果 137例患者中,64.2% (88/137)居住在四川及周边内脏利什曼病流行区,35.8% (49/137)有流行区逗留史.137例中,农村占84.7% (116/137),城镇占15.3% (21/137).临床表现以发热,肝、脾及淋巴结肿大,全血细胞减少和球蛋白明显增高为主.137例患者利什曼原虫rk39抗体试纸条检测均为阳性.诊断明确者用葡萄糖酸锑钠治疗.治愈118例(86.1%),脾切除4例(2.9%),复发9例(6.6%).137例中首诊疑诊为内脏利什曼病者105例,误诊率为23.4% (32/137).结论 关注流行病学史、检测rk39抗体,以及尽早骨髓涂片或组织活检有助于早期诊治,葡萄糖酸锑钠疗效较好.%Objective To analyze the clinical and epidemiological characteristics of visceral leishmaniasis cases in Sichuan. Methods The medical records of 137 patients with visceral leishmaniasis were reviewed between January 2000 and April 2012 in West China Hospital. The epidemiological data, clinical manifestations, laboratory features, diagnosis, therapeutic procedures and outcome of the patients were retrospectively analyzed. Results Eighty-eight(64.2%) out of 137 cases were the residents in the endemic area of Sichuan Province and adjacent areas, and 49 (35.8%) were non-endemic area residents with a history of visiting endemic area. Patients living in rural areas accounted for 84.7%(116/137), in town for 15.3% (21/137). Visceral leishmaniasis should be strongly suspected in a patient with prolonged fever, marked hepatosplenomegaly, Iymphadenectasis, cytopenia and hypergammaglobulinemia. All patients showed positive in rk39 dipstick test, and were treated with antimony sodium gluconate. Among these patients, 86.1% (118/137) were cured by

  14. Effect of arbuscular mycorrhizal (AM) fungi on 137Cs uptake by plants grown on different soils.

    Science.gov (United States)

    Vinichuk, M; Mårtensson, A; Ericsson, T; Rosén, K

    2013-01-01

    The potential use of mycorrhiza as a bioremediation agent for soils contaminated by radiocesium was evaluated in a greenhouse experiment. The uptake of (137)Cs by cucumber, perennial ryegrass, and sunflower after inoculation with a commercial arbuscular mycorrhizal (AM) product in soils contaminated with (137)Cs was investigated, with non-mycorrhizal quinoa included as a "reference" plant. The effect of cucumber and ryegrass inoculation with AM fungi on (137)Cs uptake was inconsistent. The effect of AM fungi was most pronounced in sunflower: both plant biomass and (137)Cs uptake increased on loamy sand and loamy soils. The total (137)Cs activity accumulated within AM host sunflower on loamy sand and loamy soils was 2.4 and 3.2-fold higher than in non-inoculated plants. Although the enhanced uptake of (137)Cs by quinoa plants on loamy soil inoculated by the AM fungi was observed, the infection of the fungi to the plants was not confirmed.

  15. MicroRNA-137 promoter methylation in oral lichen planus and oral squamous cell carcinoma

    DEFF Research Database (Denmark)

    Dang, Jun; Bian, Yong-qian; Sun, Jian-yong

    2013-01-01

    Oral lichen planus (OLP) is a common oral mucosal disease, which is generally considered a potentially malignant lesion. To identify efficiently prognostic biomarker, we investigated the microRNA-137 (miR-137) promoter methylation in OLP and compared with the samples from healthy volunteers...... and patients with oral squamous cell carcinoma (OSCC). A total of 20 OLP and 12 patients with OSCC as well as 10 healthy subjects were subjected to miR-137 promoter methylation analysis using methylation-specific PCR (MSP). To address the malignancy prediction potential from miR-137 promoter methylation status...... between miR-137 and p16 methylation levels were statistically significant between healthy controls and patients. Methylation levels of the two promoters were also influenced by age, gender, and lesion duration. Interestingly, aberrant promoter methylation of the p16 and miR-137 genes was only found...

  16. Al-free active region laser diodes at 894 nm for compact Cesium atomic clocks

    Science.gov (United States)

    Von Bandel, N.; Bébé Manga Lobé, J.; Garcia, M.; Larrue, A.; Robert, Y.; Vinet, E.; Lecomte, M.; Drisse, O.; Parillaud, O.; Krakowski, M.

    2015-03-01

    Time-frequency applications are in need of high accuracy and high stability clocks. Compact industrial Cesium atomic clocks optically pumped is a promising area that could satisfy these demands. However, the stability of these clocks relies, among others, on the performances of laser diodes that are used for atomic pumping. This issue has led the III-V Lab to commit to the European Euripides-LAMA project that aims to provide competitive compact optical Cesium clocks for earth applications. This work will provide key experience for further space technology qualification. We are in charge of the design, fabrication and reliability of Distributed-Feedback diodes (DFB) at 894nm (D1 line of Cesium) and 852nm (D2 line). The use of D1 line for pumping will provide simplified clock architecture compared to D2 line pumping thanks to simpler atomic transitions and larger spectral separation between lines in the 894nm case. Also, D1 line pumping overcomes the issue of unpumped "dark states" that occur with D2 line. The modules should provide narrow linewidth (<1MHz), very good reliability in time and, crucially, be insensitive to optical feedback. The development of the 894nm wavelength is grounded on our previous results for 852nm DFB. Thus, we show our first results from Al-free active region with InGaAsP quantum well broad-area lasers (100μm width, with lengths ranging from 2mm to 4mm), for further DFB operation at 894nm. We obtained low internal losses below 2cm-1, the external differential efficiency is 0.49W/A with uncoated facets and a low threshold current density of 190A/cm², for 2mm lasers at 20°C.

  17. The chemical durability of glass and graphite-glass composite doped with cesium oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hamodi, Nasir H., E-mail: nasirhamodi@yahoo.co.uk [School of Mechanical, Aerospace and Civil Engineering (MACE)/University of Manchester, Pariser Building, F-floor, Manchester M13 9PL (United Kingdom); Abram, Timothy J. [School of Mechanical, Aerospace and Civil Engineering (MACE)/University of Manchester, Pariser Building, F-floor, Manchester M13 9PL (United Kingdom); Lowe, Tristan; Cernik, Robert J. [Henry Mosley Imaging Facility, Material Science Centre, University of Manchester, Manchester M13 9PL (United Kingdom); Lopez-Honorato, Eddie [Centro de Investigacion y Estudios Avanzados del IPN (CINVESTAV), Unidad Saltillo. Carretera Saltillo-Monterrey km 13.5, 25900 Ramos Arizpe, Coahuila (Mexico)

    2013-01-15

    The role of temperature in determining the chemical stability of a waste form, as well as its leach rate, is very complex. This is because the dissolution kinetics is dependent both on temperature and possibility of different rate-controlling mechanisms that appear at different temperature regions. The chemical durability of Alumina-Borosilicate Glass (ABG) and Glass-Graphite Composite (GGC), bearing Tristructural Isotropic (TRISO) fuel particles impregnated with cesium oxide, were compared using a static leach test. The purpose of this study is to examine the chemical durability of glass-graphite composite to encapsulate coated fuel particles, and as a possible alternative for recycling of irradiated graphite. The test was based on the ASTM C1220-98 methodology, where the leaching condition was set at a temperature varying from 298 K to 363 K for 28 days. The release of cesium from ABG was in the permissible limit and followed the Arrhenius's law of a surface controlled reaction; its activation energy (E{sub a}) was 65.6 {+-} 0.5 kJ/mol. Similar values of Ea were obtained for Boron (64.3 {+-} 0.5) and Silicon (69.6 {+-} 0.5 kJ/mol) as the main glass network formers. In contrast, the dissolution mechanism of cesium from GGC was a rapid release, with increasing temperature, and the activation energy of Cs (91.0 {+-} 5 kJ/mol) did not follow any model related to carbon kinetic dissolution in water. Microstructure analysis confirmed the formation of Crystobalite SiO{sub 2} as a gel layer and Cs{sup +1} valence state on the ABG surface.

  18. Estimation of retention factor of cesium in sodium pool under fuel pin failure scenario in SFR

    Energy Technology Data Exchange (ETDEWEB)

    Pradeep, Arjun [Computational Simulation Section, Safety Engineering Division, Nuclear and Safety Engineering Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India); Rao, P. Mangarjuna, E-mail: pmr@igcar.gov.in [Computational Simulation Section, Safety Engineering Division, Nuclear and Safety Engineering Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India); Nashine, B.K.; Chellapandi, P. [Computational Simulation Section, Safety Engineering Division, Nuclear and Safety Engineering Group, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer We model retention factor of cesium in infinite dilute solution of sodium pool. Black-Right-Pointing-Pointer We study variation in retention factor with cover gas temperature gradient. Black-Right-Pointing-Pointer Increasing height and temperature difference decreases the retention factor. Black-Right-Pointing-Pointer In infinite dilution regime retention factor is independent of cesium inventory. Black-Right-Pointing-Pointer The retention factor is useful in estimating source term in cover gas region. - Abstract: Radioactive source term in argon (Ar) cover gas region of the primary vessel due to cesium (Cs) leaked from the failed fuel pins into the primary coolant of Sodium cooled Fast Reactor (SFR) depends on its thermodynamic and kinetic behavior with the coolant sodium. Evaluation of this source term requires detailed knowledge on the distribution of Cs between large volume of the liquid sodium, and the inert Ar cover gas. Solute-solvent combination like liquid Cs and sodium, with relative volatility greater than unity, is an important system to be analyzed in the context of SFR safety. Distribution of Cs between Ar cover gas and liquid sodium pool is complicated by the imposition of temperature difference across the cover gas region and its resultant enrichment of the more volatile solute. An analytical model has been developed to obtain the geometry dependent Retention Factor (RF) of Cs in the sodium pool as a function of the height of cover gas, initial mass inventory of Cs, the temperature difference across the cover gas region (between the sodium pool surface and top roof bottom plate) for an infinite dilute solution of Cs in the sodium pool. The model predicted results are validated with available experimental results in the literature and found that they are fairly in good agreement. In the infinite dilute solution (IDS) regime sodium pool is having the retention capacity to keep the Cs from being released into

  19. Research on the treatment of liquid waste containing cesium by an adsorption-microfiltration process with potassium zinc hexacyanoferrate

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Changping, E-mail: melindazhang@yahoo.com.cn [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Gu Ping, E-mail: guping@tju.edu.cn [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Zhao Jun; Zhang Dong; Deng Yue [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang 621900 (China)

    2009-08-15

    The removal of cesium from an aqueous solution by an adsorption-microfiltration (AMF) process was investigated in jar tests and lab-scale tests. The adsorbent was K{sub 2}Zn{sub 3}[Fe(CN){sub 6}]{sub 2}. The obtained cesium data in the jar test fit a Freundlich-type isotherm well. In the lab-scale test, the mean cesium concentration of the raw water and the effluent were 106.87 {mu}g/L and 0.59 {mu}g/L, respectively, the mean removal of cesium was 99.44%, and the mean decontamination factors (DF) and concentration factors (CF) were 208 and 539, respectively. The removal of cesium in the lab-scale test was better than that in the jar test because the old adsorbents remaining in the reactor still had adsorption capacity with the premise of no significant desorption being observed, and the continuous renewal of the adsorbent surface improved the adsorption capacity of the adsorbent. Some of the suspended solids were deposited on the bottom of the reactor, which would affect the mixing of adsorbents with the raw water and the renewing of the adsorbent surface. Membrane fouling was the main physical fouling mechanism, and the cake layer was the main filtration resistance. Specific flux (SF) decreased step by step during the whole period of operation due to membrane fouling and concentration polarization. The quality of the effluent was good and the turbidity remained lower than 0.1 NTU, and the toxic anion, CN{sup -}, could not be detected because of its low concentration, this indicated that the effluent was safe. The AMF process was feasible for practical application in the treatment of liquid waste containing cesium.

  20. Optical and evaporative cooling of cesium atoms in the gravito-optical surface trap

    CERN Document Server

    Hammes, M; Druzhinina, V; Moslener, U; Manek-Hönninger, I; Grimm, R

    2000-01-01

    We report on cooling of an atomic cesium gas closely above an evanescent-wave atom mirror. At high densitities, optical cooling based on inelastic reflections is found to be limited by a density-dependent excess temperature and trap loss due to ultracold collisions involving repulsive molecular states. Nevertheless, very good starting conditions for subsequent evaporative cooling are obtained. Our first evaporation experiments show a temperature reduction from 10muK down to 300nK along with a gain in phase-space density of almost two orders of magnitude.