WorldWideScience

Sample records for cesium 134

  1. Activity of cesium-134 and cesium-137 in game and mushrooms in Poland

    International Nuclear Information System (INIS)

    The activity of cesium-134 and cesium-137 was measured in mushrooms and game in 1986-1991. The samples were collected all over Poland and most of the measurements were carried out for export purposes. The results indicate that the activity ratio of cesium-137 to cesium-134 in some samples is not comparable to that with fallout after the Chernobyl accident. The analysis of some samples of mushrooms from 1985 showed that the activity of cesium-137 was higher compared to any other foodstuff. The level of contamination varied greatly throughout Poland

  2. Seasonal variation of cesium 134 and cesium 137 in semidomestic reindeer in Norway after the Chernobyl accident

    Directory of Open Access Journals (Sweden)

    I.M. H. Eikelmann

    1990-09-01

    Full Text Available The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively.

  3. The determination of Fukushima-derived cesium-134 and cesium-137 in Japanese green tea samples and their distribution subsequent to simulated beverage preparation.

    Science.gov (United States)

    Cook, Matthew C; Stukel, Matthew J; Zhang, Weihua; Mercier, Jean-Francois; Cooke, Michael W

    2016-03-01

    Health Canada's Radiation Protection Bureau has identified trace quantities of (134)Cs and (137)Cs in commercially available green tea products of Japanese origin. Referenced to March 11, 2011, the activity ratio ((134)Cs/(137)Cs) has been determined to be 1:1, which supports an origin from the Fukushima Dai-ichi Nuclear Power Plant accident. The upper limits of typical tea beverage preparation conditions were applied to the most contaminated of these green tea samples to determine the proportion of radiocesium contamination that would be available for human consumption. The distribution of radiocesium among the components of the extraction experiments (water, residual tea solid, and filter media) was determined by both conventional and Compton-suppressed gamma spectroscopy. The latter aided tremendously in providing a more complete radiocesium distribution profile, particularly for the shorter-lived (134)Cs. Cesium extraction efficiencies of 64 ± 7% and 64 ± 5% were determined based on (134)Cs and (137)Cs, respectively. Annual, effective dose estimates from ingestion of (137)Cs and (134)Cs (1.8-3.7 μSv), arising from the consumption of tea beverages prepared from the most contaminated of these samples, are insignificant relative to both total (∼ 2.4 mSv) and ingested (∼ 0.28 mSv) annual effective doses received from naturally occurring radioactive sources. As such, there is no health concern arising from the consumption of green tea beverages contaminated with radiocesium at the levels encountered in this study. PMID:26714059

  4. The transfer of cesium-134 and -137 from sewage sludge to plants

    International Nuclear Information System (INIS)

    Amounts of 134Cs and 137Cs taken up by plants from contaminated sewage sludge were determined. The sewage sludge was highly enriched in fall-out activity from the reactor accident at Chernobyl and contained about 900 Bq/kg dry weight of 134Cs, 1600 Bq/kg dry weight of 137Cs and 20 BQ/kg dry weight of 90Sr (activities corrected to 1st May 1986). This sludge was deposited as a root deep layer (20 cm) on a refuse deposit site on a layer of clay. The soil to plant transfer of 90Sr was not investigated. Different plants were grown from seed. After harvest they were segmented into different parts (eg. edible parts, roots, stem, leaves,), and activities of the dry samples determined. The transfer factors, T.Fs., varied by a factor of 2.5 between similar kinds of plants (leafy vegetables) 0.26 (kale) and 0.68 (chicory) and by a factor of three between different samples of the same plants (beans) 0.05 and 0.14. No differences were found between transfer factors for the 134Cs - and 137Cs isotopes. (author)

  5. Uptake of cesium-134 by the earthworm species Eisenia foetida and Lumbricus rubellus

    International Nuclear Information System (INIS)

    The uptake processes of 134Cs in two earthworm species were investigated as well as the effect of temperature on these processes. The results show that equilibrium concentrations in the two species differ by 1.5- to fivefold. Equilibrium concentrations range from 367 to 963 Bq g-1 in Lumbricus rubellus and from 920 to 1,893 g-1 in Eisenia foetida; biological half-lives range from 56 to 119 h and 52 to 64 h, respectively. Assimilation was two to four times higher in E. foetida and elimination rate one to two times higher in E. foetida than in L. rubellus. Further, the results show that temperature may affect the 134Cs concentration in these earthworms by a factor of 1.4 to 2.1 between 10 and 20 C, depending on the species. The maximum difference found within one species was a factor of 2.6. Their results show no clear effect of temperature on the assimilation, but a small negative effect on elimination, resulting in an increasing biological half-life and concentration factor with higher temperatures

  6. Seasonal variations in deposition and retention of cerium-141 and cesium-134 in cool desert vegetation

    International Nuclear Information System (INIS)

    Deposition velocities and retention half-times were measured for 141Ce and 134Cs aerosols on big sagebrush (Artemisia tridentata) and squirreltail bottlebrush (Elymus elymoides). These aerosols were released over a native community in southeast Idaho during each of three seasons -spring, summer, and winter -to study the effects of plant development and growth on deposition velocity and retention. Air concentrations during the release and vegetation concentration after the release were measured to determine deposition velocity. Friction velocity, roughness length, and particle size were measured to determine retention half-time. There was no significant difference between nuclides for deposition velocity and retention half-time. Species differences were significant (P -1 in spring, summer and winter, respectively. Big sagebrush values were 1.6, 1.6, and 1.0 mm s-1. Retention data indicated a rapid initial loss (half-times of 1-2 d) followed by a slower loss (half-times of several weeks). (Author)

  7. Cesium 137 and cesium 134 in roe deer from the north and central Hessen area: Measurement of the contamination in muscle tissue after the Chernobyl accident. Caesium 137 und Caesium 134 in Rehwild aus Nord- und Mittelhessen: Untersuchungen zur Kontamination von Muskelgewebe nach dem Reaktorunfall in Tschernobyl

    Energy Technology Data Exchange (ETDEWEB)

    Georgii, S.; Brunn, H.; Eskens, U. (Staatliches Medizinal-, Lebensmittel- und Veterinaeruntersuchungsamt Mittelhessen, Giessen (Germany, F.R.))

    1989-06-01

    The present report describes the amount of incorporated 134 and 137 cesium in the muscle tissue of 330 roe deer, which were referred for routine necropsy between 1986 and 1988. The amount of incorporated radiocesium was markedly decreased in 1987 and 1988 compared with 1986. However, a seasonal fluctuation with increase of the measured incorporated radioactivity during the autumn months was observed in 1987 and 1988. (orig.).

  8. Supplement to investigation of technology process of cesium-134,137 decontamination of beef and lamb meet

    International Nuclear Information System (INIS)

    We tried in our investigation to modify certain methods of contamination of meat, contaminated by feeding with radioactive grass and hay. We present data concerning the decontamination of the fresh meat of animal fed on radioactive foods, and the follow up of the 134Cs - 137Cs mixture. The contamination procedure of lamb meat was performed in the different manners, namely by external salting of the fresh meat with the sea salt during 4 hours on the temperature of 40 C, and by pressure cooking lasting 15 minutes, followed by the buillon extraction. The decontamination procedure of veal was performed by the sinking of the meat samples in a 4% acetic acid, with meat-acid ratio being 1:3 on 80 C during the period of 4 days. Pressure cooking was performed on the temperature of 1200 C with the pressure of 2,02.105 N/m2 (2 Atu) lasting 15 minutes after which the buillon was extracted and split. Data analysis shows that the salting of the lamb meat produced the 83% activity loss in 134Cs and 137Cs and the pressure cooking even larger effect of over 90%. The veal meat after acetic acid treatment lost more than 80% 134Cs and 137Cs. Pressurized cooking increase the contamination effect to 95%. 2 refs., 4 tabs. (nev)

  9. Cesium-134 and 137 activities in the central North Pacific Ocean after the Fukushima Dai-ichi Nuclear Power Plant accident

    Directory of Open Access Journals (Sweden)

    J. Kameník

    2013-09-01

    Full Text Available Surface seawater 134Cs and 137Cs samples were collected in the central and western North Pacific Ocean during the 2 yr after the Fukushima Dai-ichi Nuclear Power Plant accident to monitor dispersion patterns of these radioisotopes towards the Hawaiian Islands. In the absence of other recent sources and due to its short half-life, only those parts of the Pacific Ocean would have detectable 134Cs values that were impacted by Fukushima releases. Between March and May 2011, 134Cs was not detected around the Hawaiian Islands and Guam. Here, most 137Cs activities (1.2–1.5 Bq m–3 were in the range of expected preexisting levels. Some samples north of the Hawaiian Islands (1.6–1.8 Bq m–3 were elevated above the 23-month baseline established in surface seawater in Hawaii indicating that those might carry atmospheric fallout. The 23-month time-series analysis of surface seawater from Hawaii did not reveal any seasonal variability or trends, with an average activity of 1.46 ± 0.06 Bq m–3 (Station Aloha, 18 values. In contrast, samples collected between Japan and Hawaii contained 134Cs activities in the range of 1–4 Bq m–3, and 137Cs levels were about 2–3 times above the preexisting activities. We found that the southern boundary of the Kuroshio and Kuroshio extension currents represented a boundary for radiation dispersion with higher activities detected within and north of the major currents. The radiation plume has not been detected over the past 2 yr at the main Hawaiian Islands due to the transport patterns across the Kuroshio and Kuroshio extension currents.

  10. Investigations into the transfer of sup 134+137 cesium from Chernobyl fall-out-contaminated grasscobs in the bodies of fallow deer and angora rabbits and on the biological half-life of radio-cesium by means of whole-body gamma spectroscopy. Untersuchungen zum Transfer von sup 134+137 Caesium aus falloutkontaminiertem Futter in Damwild und Angorakaninchen und zur biologischen Halbwertszeit des Radiocaesium mittels der Ganzkoerpergammaspektrometrie

    Energy Technology Data Exchange (ETDEWEB)

    Feiden, F.

    1989-06-28

    The present work concerns a feeding experiment to establish the transfer-factors of {sup 134+137}cesium from Chernobyl fall-out-contaminated grasscobs in the bodies of fallow deer (Dama-dama) and angora rabbits (Oryctolagus cuniculus). The transfer factor from the feed-stuff in the fallow deer body amounted to 0.0311 d/kg independent of the proportion of the contaminated grasscobs in the overall daily ration of food. The {sup 137}Cs activity/kg in the flesh of two killed deer averaged about the factor 1.35, in the joint muscles about the factor 1.44 higher. An increase in the transfer factor for the fallow deers flesh to 0.0448 d/kg is assumed. The transfer factor (whole body) for the angora rabbits amounted to 0.285 d/kg. Two animals killed in balanced condition displayed around the factor 1.35 higher cesium values in the muscles. On this base the TF{sub (meat)} could be given as at 0.385 d/kg. The biological half-life of the radio-cesium in the body of fallow deer comprised a fast component of 0.3 d and a proportion of about 37% in overall activity and a slower one of 13 d with a 63% proportion. On an average it amounted to 8.3 d for excretion of the first half of the initial burden. At 5.5 d, a fallow deer burdened by only one i.v. injection excreted 50% of the initial activity markedly more quickly. Two proportionally equal phases of 1.2 and 10 days of biological half-time were recognised. As regards the angora rabbits, the biological half-life amounted to 1.2 d for the faster component, and for a slower one about 8 d. The first half of the initial activity was excreted after about 5.5 d. (orig./MG).

  11. Cesium-137

    International Nuclear Information System (INIS)

    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  12. Determination of Cs-134 and Cs-137 rain water samples

    International Nuclear Information System (INIS)

    In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH4+, K+ and Rb+) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author)

  13. Cesium fallout in Norway after the Chernobyl accident

    International Nuclear Information System (INIS)

    Results of country-wide measurements of 137Cs and 134 Cs in soil samples in Norway after the Chernobyl accident are reported. The results clearly demonstrates that municipalities in the central part of southern Norway, Troendelag and the southern part of Nordland, have been rather heavily contaminated. The total fallout of 137Cs and 134Cs from the Chernobyl accident in Norway is estimated to 2300 TBq and 1200 TBq, respectively. This is approximately 6% of the cesium activity released from the reactor

  14. Radioactive cesium. Dynamics and transport in forestal food-webs

    International Nuclear Information System (INIS)

    This report summarises results from a radioecological study during 1994-1995 concerning turnover, redistribution and loss of radioactive Cesium (134 and 137) in boreal forest ecosystems, as well as uptake and transfer in important food-chains over moose, vole and vegetation. The basis for this report are 9 publications published 1994-95. These reports are presented in summary form. 9 refs, 17 figs

  15. Decorporation of cesium-137

    International Nuclear Information System (INIS)

    Cesium radio-isotopes, especially cesium-137 (137Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  16. Sorption of cesium in intact rock

    Energy Technology Data Exchange (ETDEWEB)

    Puukko, E. [Univ. of Helsinki, Dept. of Chemistry (Finland)

    2014-04-15

    The mass distribution coefficient K{sub d} is used in performance assessment (PA) to describe sorption of a radionuclide on rock. The R{sub d} is determined using crushed rock which causes uncertainty in converting the R{sub d} values to K{sub d} values for intact rock. This work describes a method to determine the equilibrium of sorption on intact rock. The rock types of the planned Olkiluoto waste disposal site were T-series mica gneiss (T-MGN), T-series tonalite granodiorite granite gneiss (T-TGG), P-series tonalite granodiorite granite gneiss (P-TGG) and pegmatitic granite (PGR). These rocks contain different amount of biotite which is the main sorbing mineral. The sorption of cesium on intact rock slices was studied by applying an electrical field to speed up migration of cesium into the rock. Cesium is in the solution as a noncomplex cation Cs{sup +} and it is sorbed by ion exchange. The tracer used in the experiments was {sup 134}Cs. The experimental sorption on the intact rock is compared with values calculated using the in house cation exchange sorption model (HYRL model) in PHREEQC program. The observed sorption on T-MGN and T-TGG rocks was close to the calculated values. Two PGR samples were from a depth of 70 m and three samples were from a depth of 150 m. Cesium sorbed more than predicted on the two 70 m PGR samples. The sorption of Cs on the three 150 m PGR samples was small which was consistent with the calculations. The pegmatitic granite PGR has the smallest content of biotite of the four rock types. In the case of P-TGG rock the observed values of sorption were only half of the calculated values. Two kind of slices were cut from P-TGG drill core. The slices were against and to the direction of the foliation of the biotite rims. The sorption of cesium on P-TGG rock was same in both cases. The results indicated that there was no effect of the directions of the electric field and the foliation of biotite in the P-TGG rock. (orig.)

  17. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Energy Technology Data Exchange (ETDEWEB)

    Geer, L.E. De; Vintersved, I.; Arntsing, R. [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)

    1997-12-31

    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  18. Cesium reservoir and interconnective components

    International Nuclear Information System (INIS)

    The program objective is to demonstrate the technology readiness of a TFE (thermionic fuel element) suitable for use as the basic element in a thermionic reactor with electric power output in the 0.5 to 5.0 MW range. A thermionic converter must be supplied with cesium vapor for two reasons. Cesium atoms adsorbed on the surface of the emitter cause a reduction of the emitter work function to permit high current densities without excessive heating of the emitter. The second purpose of the cesium vapor is to provide space-charge neutralization in the emitter-collector gap so that the high current densities may flow across the gap unattenuated. The function of the cesium reservoir is to provide a source of cesium atoms, and to provide a reserve in the event that cesium is lost from the plasma by any mechanism. This can be done with a liquid cesium metal reservoir in which case it is heated to the desired temperature with auxiliary heaters. In a TFE, however, it is desirable to have the reservoir passively heated by the nuclear fuel. In this case, the reservoir must operate at a temperature intermediate between the emitter and the collector, ruling out the use of liquid reservoirs. Integral reservoirs contained within the TFE will produce cesium vapor pressures in the desired range at typical electrode temperatures. The reservoir material that appears to be the best able to meet requirements is graphite. Cesium intercalates easily into graphite, and the cesium pressure is insensitive to loading for a given intercalation stage. The goals of the cesium reservoir test program were to verify the performance of Cs-graphite reservoirs in the temperature-pressure range of interest to TFE operation, and to test the operation of these reservoirs after exposure to a fast neutron fluence corresponding to seven year mission lifetime. In addition, other materials were evaluated for possible use in the integral reservoir

  19. Cesium-137 in biosphere

    International Nuclear Information System (INIS)

    The behaviour of cesium-137 in environment is reviewed. Problems on 137Cs migration in environment, on metabolism andbiological effects are considered. Data on nuclide accumulation in various plants, ways of their entering the man's organism are presented. It is marked that the rate of 137Cs metabolism in the man's organism depends considerably on age, sex, temperature of environment, conditions for activity, water and mineral metabolism and some other factors. It is shown that the annual effective equivalent dose per capita will increase to 2000 yr. up to 1 μSv, that constitutes 0.05% of the average value of irradiation by a natural source

  20. Separation of cesium-137 from uranium fission products via a NeoflonR column supporting tetraphenylboron

    International Nuclear Information System (INIS)

    Cesium is a member of the Group I alkali metals, very reactive earth metals that react vigorously with both air and water. The chemistry of cesium is much like the chemistry of neighboring elements on the periodic table, potassium and rubidium. This close relation creates many problems in plant-life exposed to cesium because it is so easily confused for potassium, an essential nutrient to plants. Radioactive 134Cs and 137Cs are also chemically akin to potassium and stable cesium. Uptake of these radioactive isotopes from groundwater by plant-life destroys the plant-life and can potentially expose humans to the radioactive affects of 134Cs and 137Cs. Much experimental work has been focused on the separation of 137Cs from uranium fission products. In previous experimental work performed a column consisting of Kel-F supporting tetraphenylboron (TPB) was utilized to separate 137Cs from uranium fission products. It is of interest at this time to attempt the separation of 134Cs from 0.01M EDTA using the same method and Neoflon in the place of Kel-F as the inert support. The results of this experiment give a separation efficiency of 88% and show a linear relationship between the column bed length and the separation efficiency obtained. (author)

  1. Cesium diffusion in graphite

    Energy Technology Data Exchange (ETDEWEB)

    Evans, R.B. III; Davis, W. Jr.; Sutton, A.L. Jr.

    1980-05-01

    Experiments on diffusion of /sup 137/Cs in five types of graphite were performed. The document provides a completion of the report that was started and includes a presentation of all of the diffusion data, previously unpublished. Except for data on mass transfer of /sup 137/Cs in the Hawker-Siddeley graphite, analyses of experimental results were initiated but not completed. The mass transfer process of cesium in HS-1-1 graphite at 600 to 1000/sup 0/C in a helium atmosphere is essentially pure diffusion wherein values of (E/epsilon) and ..delta..E of the equation D/epsilon = (D/epsilon)/sub 0/ exp (-..delta..E/RT) are about 4 x 10/sup -2/ cm/sup 2//s and 30 kcal/mole, respectively.

  2. Determining Reactor Flux from Xenon-136 and Cesium-135 in Spent Fuel

    CERN Document Server

    Hayes, A C

    2012-01-01

    The ability to infer the reactor flux from spent fuel or seized fissile material would enhance the tools of nuclear forensics and nuclear nonproliferation significantly. We show that reactor flux can be inferred from the ratios of xenon-136 to xenon-134 and cesium-135 to cesium-137. If the average flux of a reactor is known, the flux inferred from measurements of spent fuel could help determine whether that spent fuel was loaded as a blanket or close to the mid-plane of the reactor. The cesium ratio also provides information on reactor shutdowns during the irradiation of fuel, which could prove valuable for identifying the reactor in question through comparisons with satellite reactor heat monitoring data. We derive analytic expressions for these correlations and compare them to experimental data and to detailed reactor burn simulations. The enrichment of the original uranium fuel affects the correlations by up to 3 percent, but only at high flux.

  3. Carbon, cesium and iodine isotopes in Japanese cedar leaves from Iwaki, Fukushima

    DEFF Research Database (Denmark)

    Xu, Sheng; Cook, Gordon T.; Cresswell, Alan J.;

    2016-01-01

    Japanese cedar leaves from Iwaki, Fukushima were analyzed for carbon, cesium and iodine isotopic compositions before and after the 2011 nuclear accident. The Δ14C values reflect ambient atmospheric 14C concentrations during the year the leaves were sampled/defoliated, and also previous year......(s). The elevated 129I and 134,137Cs concentrations are attributed to direct exposure to the radioactive fallout for the pre-fallout-expended leaves and to internal translocation from older parts of the tree for post-fallout-expended leaves. 134Cs/137Cs and 129I/137Cs activity ratios suggest insignificant isotopic...

  4. Cesium transport data for HTGR systems

    International Nuclear Information System (INIS)

    Cesium transport data on the release of cesium from HTGR fuel elements are reviewed and discussed. The data available through 1976 are treated. Equations, parameters, and associated variances describing the data are presented. The equations and parameters are in forms suitable for use in computer codes used to calculate the release of metallic fission products from HTGR fuel elements into the primary circuit. The data cover the following processes: (1) diffusion of cesium in fuel kernels and pyrocarbon, (2) sorption of cesium on fuel rod matrix material and on graphite, and (3) migration of cesium in graphite. The data are being confirmed and extended through work in progress

  5. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1997-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  6. Extraction of radioactive cesium from tea leaves

    International Nuclear Information System (INIS)

    Radioactive contamination of foodstuffs attributed to the Fukushima Daiichi nuclear disaster has become a social problem. This study investigated the extraction of radioactive cesium from the contaminated leaves to the tea. The green tea was brewed twice reusing the same leaves to study the difference in extraction of cesium between the first and second brew. Moreover, the extraction of cesium was studied in correlation to brewing time. The concentration of radioactive cesium was determined with gamma spectrometry, and the concentration of caffeine was determined with absorption spectrometry. About 40% of cesium was extracted from leaves in the first brew, and about 80% was extracted in the second brew. The extraction of cesium increased over time, and it reached about 80% after 10 minutes brew. The ratio of radioactive cesium to caffeine decreased linearly over time. This study revealed that the extraction of cesium was higher for the second brew, and a rapid increase in extraction was seen as the tea was brewed for 6 minutes and more. Therefore, the first brew of green tea, which was brewed within 5 minutes, contained the least extraction of radioactive cesium from the contaminated leaves. (author)

  7. Small-Column Cesium Ion Exchange Elution Testing of Spherical Resorcinol-Formaldehyde

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Garrett N.; Russell, Renee L.; Peterson, Reid A.

    2011-10-21

    This report summarizes the work performed to evaluate multiple, cesium loading, and elution cycles for small columns containing SRF resin using a simple, high-level waste (HLW) simulant. Cesium ion exchange loading and elution curves were generated for a nominal 5 M Na, 2.4E-05 M Cs, 0.115 M Al loading solution traced with 134Cs followed by elution with variable HNO3 (0.02, 0.07, 0.15, 0.23, and 0.28 M) containing variable CsNO3 (5.0E-09, 5.0E-08, and 5.0E-07 M) and traced with 137Cs. The ion exchange system consisted of a pump, tubing, process solutions, and a single, small ({approx}15.7 mL) bed of SRF resin with a water-jacketed column for temperature-control. The columns were loaded with approximately 250 bed volumes (BVs) of feed solution at 45 C and at 1.5 to 12 BV per hour (0.15 to 1.2 cm/min). The columns were then eluted with 29+ BVs of HNO3 processed at 25 C and at 1.4 BV/h. The two independent tracers allowed analysis of the on-column cesium interaction between the loading and elution solutions. The objective of these tests was to improve the correlation between the spent resin cesium content and cesium leached out of the resin in subsequent loading cycles (cesium leakage) to help establish acid strength and purity requirements.

  8. 13 CFR 134.223 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence. 134.223 Section 134.223... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.223 Evidence. (a) Federal Rules of Evidence. Unless contrary to a particular rule in this part, or an order of the Judge, the Federal Rules...

  9. 13 CFR 134.312 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence. 134.312 Section 134.312 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE... Designations § 134.312 Evidence. To the extent the rules in this subpart permit the submission of evidence,...

  10. 10 CFR 600.134 - Equipment.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Equipment. 600.134 Section 600.134 Energy DEPARTMENT OF... Nonprofit Organizations Post-Award Requirements § 600.134 Equipment. (a) Title to equipment acquired by a... recipient shall not use equipment acquired with Federal funds to provide services to non-Federal...

  11. 14 CFR 1260.134 - Equipment.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Equipment. 1260.134 Section 1260.134..., Hospitals, and Other Non-Profit Organizations Property Standards § 1260.134 Equipment. (a) For grants and... research to not vest title in the recipient as exempt, equipment shall vest in the recipient subject...

  12. 7 CFR 1.134 - Docket number.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Docket number. 1.134 Section 1.134 Agriculture Office... Adjudicatory Proceedings Instituted by the Secretary Under Various Statutes § 1.134 Docket number. Each proceeding, immediately following its institution, shall be assigned a docket number by the Hearing...

  13. 49 CFR 176.134 - Vehicles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Vehicles. 176.134 Section 176.134 Transportation... Class 1 (Explosive) Materials Stowage § 176.134 Vehicles. Closed vehicles may be used to transport Class... requirements relating to the transport of Class 1 (explosive) materials in vehicles....

  14. 7 CFR 58.134 - Sediment content.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Sediment content. 58.134 Section 58.134 Agriculture... Milk § 58.134 Sediment content. (a) Method of testing. Methods for determining the sediment content of... for the Examination of Dairy Products. Sediment content shall be based on comparison with...

  15. 19 CFR 134.0 - Scope.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 134.0 Section 134.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING § 134.0 Scope. This part sets forth regulations implementing the country of origin...

  16. 46 CFR 134.170 - Operating manual.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Operating manual. 134.170 Section 134.170 Shipping COAST... LIFTBOATS § 134.170 Operating manual. (a) Each liftboat must have aboard an operating manual approved by the Coast Guard as complying with this section. (b) The operating manual must be available to, and...

  17. Surface tension of liquid dilute solutions of lead-cesium and bismuth-cesium systems

    International Nuclear Information System (INIS)

    Method of the maximal pressure in a drop was used to measure the surface tension of 15 liquid dilute solutions of lead-cesium system in 0-0.214 at% concentration range and of 12 diluted solutions of bismuth-cesium system in 0-0.160 at.% cesium range from solidification temperature up to 500 dec C. It was found that cesium was characterized as surfactant in lead and bismuth melts. It was established that the temperature coefficient of surface tension changes sufficiently in maximally diluted solutions of alkali metals in bismuth and lead melts. Effect of sodium, potassium, rubidum and cesium on the value of surface tension of lead and bismuth was systematized. Growth of activity in sodium, potassium, rubidium and cesium series was noted

  18. Sorption of cesium on Latvian clays

    International Nuclear Information System (INIS)

    Cesium is like potassium - good solubility and mobile in a ground, easily assimilate in organism expressly brawn woof. It is a problem if pollutant is a radioactive 137Cs. We made experiments to sorption a 2M CsF solution on some Latvian clays which mainly contain hydro micas (cesium content after good elute of clays are in table). We establish, that clay treated with 25 % sulfuric acid adsorb cesium two times more that waste clay. Hereto unstuck elute Cs from clays. (author)

  19. Cesium and strontium ion specific exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Yates, S.

    1996-10-01

    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with AlliedSignal, Inc. (Des Plaines, Illinois) to develop inorganic ion exchangers that are selective for strontium and cesium from alkaline high-level waste and groundwater streams.

  20. Sorption of Cesium on Latvia clays

    International Nuclear Information System (INIS)

    Cesium is like potassium - good solubility and mobile in a ground, easy assimilates in organism expressly brawn woof. It is a problem if pollutant is radioactive 137Cs. We made experiments to sorption a 2M CsF solution on some Latvian clays which mainly contain hydro micas. We establish that clay treated with 25% sulfuric acid absorb cesium two times more that waste clay. Hereto unstuck elute Cs from clays

  1. Removal of cesium from wastewater: A cesium-specific ion exchange resin

    International Nuclear Information System (INIS)

    Researchers at the Savannah River Laboratory (SRL) have applied for a patent for an ion exchange resin that will remove cesium from water. Radioactive cesium-137 is a fission product of nuclear reactor operations. Cesium may enter the water of spent fuel holding basins through defects in fuel cladding. Control of cesium in these basins is desirable to keep personnel exposure to a minimum. Cesium is also present in the waste from reprocessing of defense nuclear reactor fuel. Research has been underway at SRL for over a decade to improve management of high-level reprocessing waste. The current technology separates the waste into soluble and insoluble components. Radioactive constituents are removed from the soluble component stream and combined with the insoluble components, which are then converted to a glass for long-term storage. Cesium is the most radioactive constituent of the soluble components stream. The SRL resin is a resorcinol-formaldehyde condensation polymer highly specific for cesium and is about 10 times more effective in removal of cesium than other ion exchange resins evaluated for use in processing defense nuclear waste. Tests have been run at SRL using both simulated and actual waste streams

  2. Uptake and transport of radioactive cesium and strontium into grapevines after leaf contamination

    Science.gov (United States)

    Zehnder, H. J.; Kopp, P.; Eikenberg, J.; Feller, U.; Oertli, J. J.

    1995-07-01

    From 1989 to 1993 the foliar uptake of radioactive strontium (Sr-85) and cesium (Cs-134) by selected leaves of grapevine plants and the subsequent redistribution within the plants was examined under controlled conditions in a greenhouse. The radionuclides were applied as chlorides. These plants were grown in large pots containing a mixture of local soil and peat. Plant and soil samples were analyzed throughout the growing season and also during the following vegetation period. Only traces of the applied radiostrontium were taken up by the leaves. This element was essentially not redistributed within the plants. In contrast, radiocesium was easily taken up through the leaf surface, transported to other plant parts and to some extent released from the roots into the soil. Cesium reaching the soil may interact with clay particles causing a very reduced availability for plants. Therefore the soil may act as a long-term sink for radiocesium. On the other hand, grape berries represent transient sinks. The cesium levels in the berries decreased again in a late phase of maturation, but the mechanisms causing this loss are not yet identified. During the second vegetation period, only a very minor proportion of the radiocesium taken up previously by the plants was present in the above ground parts.

  3. Dicty_cDB: SSA134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA134 (Link to dictyBase) - - - Contig-U16443-1 SSA134F (Link to Original site) SSA...134F 590 - - - - - - Show SSA134 Library SS (Link to library) Clone ID SSA134 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA134Q.Seq.d/ Representative seq. ID SSA13...4F (Link to Original site) Representative DNA sequence >SSA134 (SSA134Q) /CSM/SS/SSA1-B/SSA134Q.Seq.d/ TTTTA...XXXXXXXXXX sequence update 1998. 7.31 Translated Amino Acid sequence LDDRSVEFDYLVINSGSSYNSPFKESSVVSSARANTLRE

  4. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    International Nuclear Information System (INIS)

    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103Ru, 134Cs and 124Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10-3 to 5.10-5% of the Ru fed, for Cs the corresponding release fraction ranges between 3.10-3 to 10-4% and for Sb the release fraction ranges between 1.7 10-4 to 1.7 10-5%. The same experiments were performed at a throughput of 1 to 2 1 h-1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103Ru and 134Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  5. Spatial variability and the fate of cesium in coastal sediments near Fukushima, Japan

    Directory of Open Access Journals (Sweden)

    E. Black

    2014-05-01

    Full Text Available Quantifying the amount of cesium incorporated into marine sediments as a result of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP accident has proven challenging due to the limited multi-core sampling from within the 30 km zone around the facility, the inherent spatial heterogeneities in ocean sediments, and the potential for inventory fluctuations due to physical, biological, and chemical processes. Using 210Pb, 234Th, 137Cs, and 134Cs profiles from 20 sediment cores, coastal sediment inventories were reevaluated. A minimum 137Cs sediment inventory of 100 ± 50 TBq was found for an area of 55 000 km2 using cores from this study and a total of 130 ± 60 TBq using an additional 181 samples. These inventories represent less than 1% of the estimated 15–30 PBq of cesium released during the FDNPP disaster and constitute ~ 90% of the total coastal inventory of 137Cs remaining in 2012. The time needed for surface sediment activities (0 to 3 cm at the 20 locations to reduce by 50% via bioturbation was estimated to range from 0.4 to 26 years, indicating a much greater persistence of cesium in the sediments relative to coastal water activities. However, due to the observed variability in mixing rates, grain size, and inventories, additional cores are needed to further improve estimates and capture the full extent of cesium penetration into the shallow coastal sediments, which was deeper than 14 cm for all cores retrieved from water depths less than 150 m.

  6. 41 CFR 105-71.134 - Copyrights.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Copyrights. 105-71.134...-Award Requirements/Changes, Property, and Subawards § 105-71.134 Copyrights. The Federal awarding agency... to authorize others to use, for Federal Government purposes: (a) The copyright in any work...

  7. 13 CFR 134.402 - Appeal petition.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Appeal petition. 134.402 Section 134.402 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... why the determination is alleged to be arbitrary, capricious or contrary to law. This section does...

  8. Radioactive cesium in Finnish mushrooms

    International Nuclear Information System (INIS)

    Surveillance of radioactive cesium in Finnish mushrooms was started in 1986 at STUK. Results of the surveillance programs carried out in Lapland and other parts of Finland are given in this report. More than 2000 samples of edible mushrooms have been analysed during 1986-2008. The 137Cs detected in the mushrooms mainly originates from the 137Cs deposition due to the accident at the Chernobyl nuclear power plant in 1986. The 137Cs concentrations of mushrooms in the end of 1970s and in the beginning of 1980s varied from some ten to two hundred becquerels per kilogram originating from the nuclear weapon test period. The uneven division of the Chernobyl fallout is seen in the areal variation of 137Cs concentrations of mushrooms, the 137Cs concentrations being about tenfold in the areas with the highest deposition compared to those where the deposition was lowest. After the Chernobyl accident the maximum values in the 137Cs concentrations were reached during 1987-88 among most species of mushrooms. The 137Cs concentrations have decreased slowly, being in 2008 about 40 per cent of the maximum values. The 137Cs concentrations may be tenfold in the mushroom species with high uptake of cesium (Rozites caperatus, Hygrophorus camarophyllus, Lactarius trivialis) compared to the species with low uptake (Albatrellus ovinus, Leccinum sp.) picked in the same area. The 137Cs contents in certain species of commercial mushrooms in Finland still exceed the maximum permitted level, 600 Bq/kg, recommended to be respected when placing wild game, wild berries, wild mushrooms and lake fish on the market (Commission recommendation 2003/274/Euratom). Therefore, the 137Cs concentrations of mushrooms should be measured before placing them on the market in the areas of the highest 137Cs deposition, except for Albatrellus ovinus, Boletus sp. and Cantharellus cibarius. The 137Cs concentrations of common commercial mushroom species, Cantharellus tubaeformis and Craterellus cornucopioides often

  9. Plasma etching of cesium iodide

    International Nuclear Information System (INIS)

    Thick films of cesium iodide (CsI) are often used to convert x-ray images into visible light. Spreading of the visible light within CsI, however, reduces the resolution of the resulting image. Anisotropic etching of the CsI film into an array of micropixels can improve the image resolution by confining light within each pixel. The etching process uses a high-density inductively coupled plasma to pattern CsI samples held by a heated, rf-biased chuck. Fluorine-containing gases such as CF4 are found to enhance the etch rate by an order of magnitude compared to Ar+ sputtering alone. Without inert-gas ion bombardment, however, the CF4 etch becomes self-limited within a few microns of depth due to the blanket deposition of a passivation layer. Using CF4+Ar continuously removes this layer from the lateral surfaces, but the formation of a thick passivation layer on the unbombarded sidewalls of etched features is observed by scanning electron microscopy. At a substrate temperature of 220 deg. C, the minimum ion-bombardment energy for etching is Ei∼50 eV, and the rate depends on Ei1/2 above 65 eV. In dilute mixtures of CF4 and Ar, the etch rate is proportional to the gas-phase density of atomic fluorine. Above 50% CF4, however, the rate decreases, indicating the onset of net surface polymer deposition. These observations suggest that anisotropy is obtained through the ion-enhanced inhibitor etching mechanism. Etching exhibits an Arrhenius-type behavior in which the etch rate increases from ∼40 nm/min at 40 deg. C to 380 nm/min at 330 deg. C. The temperature dependence corresponds to an activation energy of 0.13±0.01 eV. This activation energy is consistent with the electronic sputtering mechanism for alkali halides

  10. Perlite for permanent confinement of cesium

    Science.gov (United States)

    Balencie, J.; Burger, D.; Rehspringer, J.-L.; Estournès, C.; Vilminot, S.; Richard-Plouet, M.; Boos, A.

    2006-06-01

    We present the potential use of expanded perlite, a metastable amorphous hydrated aluminium silicate, as a permanent medium for the long-term confinement of cesium. The method requires simply a loading by mixing an aqueous cesium nitrate solution and expanded perlite at 300 K followed by densification by sintering. The formation of pollucite, CsAlSi2O6, a naturally occurring mineral phase, upon careful heat treatment is demonstrated by X-ray diffraction. Leaching tests on the resulting glass-ceramics reveal a very low Cs departure of 0.5 mg m-2 d-1.

  11. Crystalline silicotitanates for cesium/strontium removal

    Energy Technology Data Exchange (ETDEWEB)

    Brown, N.; Miller, J.; Sherman, J.

    1996-10-01

    A new class of inorganic ion exchangers called crystalline silicotitanates (CST) has been developed that exhibits very high selectivity for cesium and strontium in the highly alkaline radioactive wastes at the Hanford Site and other DOE sites. Tests have also shown that CSTs have high selectivity for cesium in acidic and neutral solutions. The ESP is supporting an effort at Sandia National Laboratories and Texas A & M University to further develop and characterize the important chemical and physical properties that will determine the applicability of CST to radioactive waste treatment at Hanford and other DOE facilities.

  12. Microbial accumulation of uranium, radium, and cesium

    International Nuclear Information System (INIS)

    Diverse microbial species varied considerably in their ability to accumulate uranium, cesium, and radium. Mechanistic differences in uranium uptake by Saccharomyces cerevisiae and Pseudomonas aeruginosa were indicated. S. serevisiae exhibited a slow (hours) surface accumulation of uranium which was subject to environmental factors, while P. aeruginosa accumulated uranium rapidly (minutes) as dense intracellular deposits and did not appear to be affected by environmental parameters. Metabolism was not required for uranium uptake by either organism. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several species tested

  13. Dicty_cDB: SLB134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB134 (Link to dictyBase) - - - Contig-U16455-1 SLB134E (Link to Original site) SLB...134F 638 SLB134Z 233 SLB134P 871 SLB134E 654 Show SLB134 Library SL (Link to library) Clone ID SLB...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-B/SLB134Q.Seq.d/ Representative seq. ID SLB...134E (Link to Original site) Representative DNA sequence >SLB134 (SLB134Q) /CSM/SL/SLB1-B/SLB...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLB134 (SLB134Q) /CSM/SL/SLB1-B/SLB

  14. Removal of Radioactive Cesium Using Prussian Blue Magnetic Nanoparticles

    Directory of Open Access Journals (Sweden)

    Sung-Chan Jang

    2014-11-01

    Full Text Available Radioactive cesium (137Cs has inevitably become a human concern due to exposure from nuclear power plants and nuclear accident releases. Many efforts have been focused on removing cesium and the remediation of the contaminated environment. In this study, we elucidated the ability of Prussian blue-coated magnetic nanoparticles to eliminate cesium from radioactive contaminated waste. Thus, the obtained Prussian blue-coated magnetic nanoparticles were then characterized and examined for their physical and radioactive cesium adsorption properties. This Prussian blue-coated magnetic nanoparticle-based cesium magnetic sorbent can offer great potential for use in in situ remediation.

  15. Cesium vapor thermionic converter anomalies arising from negative ion emission

    Science.gov (United States)

    Rasor, Ned S.

    2016-08-01

    Compelling experimental evidence is given that a longstanding limit encountered on cesium vapor thermionic energy converter performance improvement and other anomalies arise from thermionic emission of cesium negative ions. It is shown that the energy that characterizes thermionic emission of cesium negative ions is 1.38 eV and, understandably, is not the electron affinity 0.47 eV determined for the photodetachment threshold of the cesium negative ion. The experimental evidence includes measurements of collector work functions and volt-ampere characteristics in quasi-vacuum cesium vapor thermionic diodes, along with reinterpretation of the classic Taylor-Langmuir S-curve data on electron emission in cesium vapor. The quantitative effects of negative ion emission on performance in the ignited, unignited, and quasi-vacuum modes of cesium vapor thermionic converter operation are estimated.

  16. Anomalous wetting of helium on cesium

    International Nuclear Information System (INIS)

    The authors report studies of the anomalous wetting of a cesium substrate by a liquid helium film by means of the technique of third sound. A hysteretic pre-wetting transition is observed as a function of the amount of helium in the experimental cell. 10 refs., 2 figs

  17. Cesium and Strontium Separation Technologies Literature Review

    Energy Technology Data Exchange (ETDEWEB)

    T. A. Todd; T. A. Todd; J. D. Law; R. S. Herbst

    2004-03-01

    Integral to the Advanced Fuel Cycle Initiative (AFCI) Program’s proposed closed nuclear fuel cycle, the fission products cesium and strontium in the dissolved spent nuclear fuel stream are to be separated and managed separately. A comprehensive literature survey is presented to identify cesium and strontium separation technologies that have the highest potential and to focus research and development efforts on these technologies. Removal of these high-heat-emitting fission products reduces the radiation fields in subsequent fuel cycle reprocessing streams and provides a significant short-term (100 yr) heat source reduction in the repository. This, along with separation of actinides, may provide a substantial future improvement in the amount of fuel that could be stored in a geologic repository. The survey and review of the candidate cesium and strontium separation technologies are presented herein. Because the AFCI program intends to manage cesium and strontium together, technologies that simultaneously separate both elements are of the greatest interest, relative to technologies that separate only one of the two elements.

  18. Preferential removal and immobilization of stable and radioactive cesium in contaminated fly ash with nanometallic Ca/CaO methanol suspension

    International Nuclear Information System (INIS)

    Graphical abstract: Schematic representation of possible mechanisms determining the Cs extraction and immobilization in fly ash during water, methanol or n-MCaS extraction. - Highlights: • nMCaS suspension for cesium extraction and immobilization in fly ash was developed. • Enhanced cesium immobilization was done by nanometallic Ca/CaO methanol suspension. • By SEM analysis the amount of cesium detectable on soil particle surface decreases. • Leachable cesium concentrations reduced, lower than the standard regulatory limit. • nMCaS unique and a highly potential amendment for the remediation of Cs. - Abstract: In this work, the capability of nanometallic Ca/CaO methanol suspension in removing and/or immobilizing stable (133Cs) and radioactive cesium species (134Cs and 137Cs) in contaminated fly ash was investigated. After a first methanol and second water washing yielded only 45% of 133Cs removal. While, after a first methanol washing, the second solvent with nanometallic Ca/CaO methanol suspension yielded simultaneous enhanced removal and immobilization about 99% of 133Cs. SEM-EDS analysis revealed that the mass percent of detectable 133Cs on the fly ash surface recorded a 100% decrease. When real radioactive cesium contaminated fly ash (containing an initial 14,040 Bq kg−1134Cs and 137Cs cumulated concentration) obtained from burning wastes from Fukushima were reduced to 3583 Bq kg−1 after treatment with nanometallic Ca/CaO methanol suspension. Elution test conducted on the treated fly ash gave 100 Bq L−1 total 134Cs and 137Cs concentrations in eluted solution. Furthermore, both ash content and eluted solution concentrations of 134Cs and 137Cs were much lower than the Japanese Ministry of the Environment regulatory limit of 8000 Bq kg−1 and 150 Bq L−1 respectively. The results of this study suggest that the nanometallic Ca/CaO methanol suspension is a highly potential amendment for the remediation of radioactive cesium-contaminated fly ash

  19. Dicty_cDB: AFM134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM134 (Link to dictyBase) - - - - AFM134P (Link to Original site) AFM134F 542 AFM...134Z 759 AFM134P 1281 - - Show AFM134 Library AF (Link to library) Clone ID AFM134 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM...1-B/AFM134Q.Seq.d/ Representative seq. ID AFM134P (Link to... Original site) Representative DNA sequence >AFM134 (AFM134Q) /CSM/AF/AFM1-B/AFM134Q.Seq.d/ AATTTTATTTTTAATC

  20. Dicty_cDB: CHS134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS134 (Link to dictyBase) - - - Contig-U15930-1 CHS134P (Link to Original site) CHS13...4F 649 CHS134Z 693 CHS134P 1322 - - Show CHS134 Library CH (Link to library) Clone ID CHS13...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHS1-B/CHS134Q.Seq.d/ Representative seq. ID CHS13...4P (Link to Original site) Representative DNA sequence >CHS134 (CHS134Q) /CSM/CH/CHS1-B/CHS13...TIATQEGNTNNQ*in Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHS134 (CHS13

  1. 19 CFR 134.34 - Certain repacked articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certain repacked articles. 134.34 Section 134.34... TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.34 Certain repacked articles. (a) Exception for repacked articles. An exception under § 134.32(d) may be authorized in...

  2. Lanthanide doped strontium-barium cesium halide scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  3. Surface interactions of cesium and boric acid with stainless steel

    International Nuclear Information System (INIS)

    In this report, the effects of cesium hydroxide and boric acid on oxidized stainless steel surfaces at high temperatures and near one atmosphere of pressure are investigated. This is the first experimental investigation of this chemical system. The experimental investigations were performed using a mass spectrometer and a mass electrobalance. Surfaces from the different experiments were examined using a scanning electron microscope to identify the presence of deposited species, and electron spectroscopy for chemical analysis to identify the species deposited on the surface. A better understanding of the equilibrium thermodynamics, the kinetics of the steam-accelerated volatilizations, and the release kinetics are gained by these experiments. The release rate is characterized by bulk vaporization/gas-phase mass transfer data. The analysis couples vaporization, deposition, and desorption of the compounds formed by cesium hydroxide and boric acid under conditions similar to what is expected during certain nuclear reactor accidents. This study shows that cesium deposits on an oxidized stainless steel surface at temperatures between 1000 and 1200 Kelvin. Cesium also deposits on stainless steel surfaces coated with boric oxide in the same temperature ranges. The mechanism for cesium deposition onto the oxide layer was found to involve the chemical reaction between cesium and chromate. Some revaporization in the cesium hydroxide-boric acid system was observed. It has been found that under the conditions given, boric acid will react with cesium hydroxide to form cesium metaborate. A model is proposed for this chemical reaction

  4. Distribution and retention of cesium in Swedish boreal forest ecosystems

    International Nuclear Information System (INIS)

    The retention and distribution of cesium in forest environments are being studied at three locations in Sweden. The main part of the cesium found in the soil was recovered in horizons rich in organic matter. The cesium was retained in the soil organic matter in a more or less extractable form. As different soil types have a different distribution pattern of organic matter the distribution of cesium will depend on the forest soil type. The clay content in Swedish forest soils is in general low which will mitigate the retention of cesium in the soil mineral horizons. The cesium present in the tree was considered to be an effect of assimilation by the tissues in the canopy as well as by the roots. The redistribution of cesium within the trees was extensive which was considered to be an effect of a high mobility of cesium in the close system of a forest environment. The cesium will remain in the forest environment for a considerable time but can be removed by forest practice, by leaching out of the soil profile or by the radioactive decay. (au)

  5. 42 CFR 410.134 - Provider qualifications.

    Science.gov (United States)

    2010-10-01

    ... Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM SUPPLEMENTARY MEDICAL INSURANCE (SMI) BENEFITS Medical Nutrition Therapy § 410.134 Provider qualifications. For Medicare Part B coverage of MNT, only a registered dietitian or nutrition professional...

  6. 5 CFR 185.134 - Witnesses.

    Science.gov (United States)

    2010-01-01

    ... § 185.134 Witnesses. (a) Except as provided in paragraph (b) of this section, testimony at the hearing..., testimony may be admitted in the form of a written statement or deposition. Any such written statement must be provided to all others parties along with the last known address of such witness, in a...

  7. Radium-based estimates of cesium isotope transport and total direct ocean discharges from the Fukushima Nuclear Power Plant accident

    Directory of Open Access Journals (Sweden)

    M. A. Charette

    2013-03-01

    Full Text Available Radium has four naturally occurring isotopes that have proven useful in constraining water mass source, age, and mixing rates in the coastal and open ocean. In this study, we used radium isotopes to determine the fate and flux of runoff-derived cesium from the Fukushima Dai-ichi Nuclear Power Plant (FNPP. During a June 2011 cruise, the highest cesium (Cs concentrations were found along the eastern shelf of northern Japan, from Fukushima south, to the edge of the Kuroshio Current, and in an eddy ~ 130 km from the FNPP site. Locations with the highest cesium also had some of the highest radium activities, suggesting much of the direct ocean discharges of Cs remained in the coastal zone 2–3 months after the accident. We used a short-lived Ra isotope (223Ra, t1/2 = 11.4 d to derive an average water mass age (Tr in the coastal zone of 32 days. To ground-truth the Ra age model, we conducted a direct, station-by-station comparison of water mass ages with a numerical oceanographic model and found them to be in excellent agreement (model avg. Tr = 27 days. From these independent Tr values and the inventory of Cs within the water column at the time of our cruise, we were able to calculate an offshore 134Cs flux of 3.9–4.6 × 1013 Bq d−1. Radium-228 (t1/2 = 5.75 yr was used to derive a vertical eddy diffusivity (Kz of 0.7 m2 d−1 (0.1 cm2 s−1; from this Kz and 134Cs inventory, we estimated a 134Cs flux across the pycnocline of 1.8 × 104 Bq d−1 for the same time period. On average, our results show that horizontal mixing loss of Cs from the coastal zone was ~ 109 greater than vertical exchange below the surface mixed layer. Finally, a mixing/dilution model that utilized our Ra-based and oceanographic model water mass ages produced a direct ocean discharge of 134Cs from the FNPP of 11–16 PBq at the time of the peak release in early April 2011. Our results can be used to calculate discharge of other water-soluble radionuclides that were released

  8. Distillation device supplies cesium vapor at constant pressure

    Science.gov (United States)

    Basiulis, A.; Shefsiek, P. K.

    1968-01-01

    Distillation apparatus in the form of a U tube supplies small amounts of pure cesium vapor at constant pressure to a thermionic converter. The upstream leg of the U tube is connected to a vacuum pump to withdraw noncondensable impurities, the bottom portion serves as a reservoir for the liquid cesium.

  9. Extraction of radioactive cesium from ash of flammable radioactive material

    International Nuclear Information System (INIS)

    Huge amount of radioactive materials was released by the hydrogen explosion at Fukushima Daiichi Nuclear Power Plant due to the Great East Japan Earthquake on March 11, 2011. Suppression of the volume of radioactive materials stored by decontamination works is strongly required since the preparation of storage places is not easy. We are developing the technology for separation and concentration of radioactive cesium using nano-particle, Prussian blue, as a cesium adsorption material which has a high efficiency and good selectivity. We propose a method in which radioactive cesium is extracted from the ash of flammable materials into the water and the Prussian blue nano-particles are added to the water to collect cesium. The volume of radioactive wastes contaminated by cesium is expected to be cut down with these processes. (J.P.N.)

  10. A combined cesium-strontium extraction/recovery process

    International Nuclear Information System (INIS)

    A new solvent extraction process for the simultaneous extraction of cesium and strontium from acidic nitrate media is described. This process uses a solvent formulation comprised of 0.05 M di-t-butylcyclohexano-18-crown-6 (DtBuCH18C6), 0.1 M Crown 100' (a proprietary, cesium-selective derivative of dibenzo-18-crown-6), 1.2 M tributyl phosphate (TBP), and 5% (v/v) lauryl nitrile in an isoparaffinic hydrocarbon diluent. Distribution ratios for cesium and strontium from 4 M nitric acid are 4.13 and 3.46, respectively. A benchtop batch countercurrent extraction experiment indicates that >98% of the cesium and strontium initially present in the feed solution can be removed in only four extraction stages. Through proper choice of extraction and strip conditions, extracted cesium and strontium can be recovered either together or individually

  11. Plutonium and Cesium Colloid Mediated Transport

    Science.gov (United States)

    Boukhalfa, H.; Dittrich, T.; Reimus, P. W.; Ware, D.; Erdmann, B.; Wasserman, N. L.; Abdel-Fattah, A. I.

    2013-12-01

    Plutonium and cesium have been released to the environment at many different locations worldwide and are present in spent fuel at significant levels. Accurate understanding of the mechanisms that control their fate and transport in the environment is important for the management of contaminated sites, for forensic applications, and for the development of robust repositories for the disposal of spent nuclear fuel and nuclear waste. Plutonium, which can be present in the environment in multiple oxidations states and various chemical forms including amorphous oxy(hydr)oxide phases, adsorbs/adheres very strongly to geological materials and is usually immobile in all its chemical forms. However, when associated with natural colloids, it has the potential to migrate significant distances from its point of release. Like plutonium, cesium is not very mobile and tends to remain adhered to geological materials near its release point, although its transport can be enhanced by natural colloids. However, the reactivity of plutonium and cesium are very different, so their colloid-mediated transport might be significantly different in subsurface environments. In this study, we performed controlled experiments in two identically-prepared columns; one dedicated to Pu and natural colloid transport experiments, and the other to Cs and colloid experiments. Multiple flow-through experiments were conducted in each column, with the effluent solutions being collected and re-injected into the same column two times to examine the persistence and scaling behavior of the natural colloids, Pu and Cs. The data show that that a significant fraction of colloids were retained in the first elution through each column, but the eluted colloids collected from the first run transported almost conservatively in subsequent runs. Plutonium transport tracked natural colloids in the first run but deviated from the transport of natural colloids in the second and third runs. Cesium transport tracked natural

  12. Adsorption of cesium on cement mortar from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Volchek, Konstantin, E-mail: konstantin.volchek@ec.gc.ca [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Kuang, Wenxing; DeMaleki, Zack [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, Canada K1N 6N5 (Canada)

    2011-10-30

    Highlights: {yields} The adsorption of cesium on cement mortar was investigated in a range of temperatures and cesium concentrations. {yields} The pseudo-second order kinetic model produced a good fit with the experimental kinetic data. {yields} Equilibrium test results correlated well with the Freundlich isotherm adsorption model. {yields} The interaction between cesium ions and cement mortar was dominated by chemical adsorption. - Abstract: The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L{sup -1} and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L{sup -1} while the respective surface concentration on coupons varied from 0.0395 to 22.34 {mu}g cm{sup -2}. Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol{sup -1} suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  13. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms

    International Nuclear Information System (INIS)

    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,mf=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,mf=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,mf=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The last chapter

  14. Intense non-relativistic cesium ion beam

    International Nuclear Information System (INIS)

    The Heavy Ion Fusion group at Lawrence Berkeley Laboratory has constructed the One Ampere Cesium Injector as a proof of principle source to supply an induction linac with a high charge density and high brightness ion beam. This is studied here. An electron beam probe was developed as the major diagnostic tool for characterizing ion beam space charge. Electron beam probe data inversion is accomplished with the EBEAM code and a parametrically adjusted model radial charge distribution. The longitudinal charge distribution was not derived, although it is possible to do so. The radial charge distribution that is derived reveals an unexpected halo of trapped electrons surrounding the ion beam. A charge fluid theory of the effect of finite electron temperature on the focusing of neutralized ion beams (Nucl. Fus. 21, 529 (1981)) is applied to the problem of the Cesium beam final focus at the end of the injector. It is shown that the theory's predictions and assumptions are consistent with the experimental data, and that it accounts for the observed ion beam radius of approx. 5 cm, and the electron halo, including the determination of an electron Debye length of approx. 10 cm

  15. Microbial uptake of uranium, cesium, and radium

    International Nuclear Information System (INIS)

    The ability of diverse microbial species to concentrate uranium, cesium, and radium was examined. Saccharomyces cerevisiae, Pseudomonas aeruginosa, and a mixed culture of denitrifying bacteria accumulated uranium to 10 to 15% of the dry cell weight. Only a fraction of the cells in a given population had visible uranium deposits in electron micrographs. While metabolism was not required for uranium uptake, mechanistic differences in the metal uptake process were indicated. Uranium accumulated slowly (hours) on the surface of S. cerevisiae and was subject to environmental factors (i.e., temperature, pH, interfering cations and anions). In contrast, P. aeruginosa and the mixed culture of denitrifying bacteria accumulated uranium rapidly (minutes) as dense, apparently random, intracellular deposits. This very rapid accumulation has prevented us from determining whether the uptake rate during the transient between the initial and equilibrium distribution of uranium is affected by environmental conditions. However, the final equilibrium distributions are not affected by those conditions which affect uptake by S. cerevisiae. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several microbial species tested. The potential utility of microorganisms for the removal and concentration of these metals from nuclear processing wastes and several bioreactor designs for contacting microorganisms with contaminated waste streams will be discussed

  16. Biosorption behavior and mechanism of cesium-137 on Rhodosporidium fluviale strain UA2 isolated from cesium solution

    International Nuclear Information System (INIS)

    In order to identify a more efficient biosorbent for 137Cs, we have investigated the biosorption behavior and mechanism of 137Cs on Rhodosporidium fluviale (R. fluviale) strain UA2, one of the dominant species of a fungal group isolated from a stable cesium solution. We observed that the biosorption of 137Cs on R. fluviale strain UA2 was a fast and pH-dependent process in the solution composed of R. fluviale strain UA2 (5 g/L) and cesium (1 mg/L). While a Langmuir isotherm equation indicated that the biosorption of 137Cs was a monolayer adsorption, the biosorption behavior implied that R. fluviale strain UA2 adsorbed cesium ions by electrostatic attraction. The TEM analysis revealed that cesium ions were absorbed into the cytoplasm of R. fluviale strain UA2 across the cell membrane, not merely fixed on the cell surface, which implied that a mechanism of metal uptake contributed largely to the cesium biosorption process. Moreover, PIXE and EPBS analyses showed that ion-exchange was another biosorption mechanism for the cell biosorption of 137Cs, in which the decreased potassium ions were replaced by cesium ions. All the above results implied that the biosorption of 137Cs on R. fluviale strain UA2 involved a two-step process. The first step is passive biosorption that cesium ions are adsorbed to cells surface by electrostatic attraction; after that, the second step is active biosorption that cesium ions penetrate the cell membrane and accumulate in the cytoplasm. - Highlights: • Microorganisms isolated from a cesium solution are considered as a biosorbent to remove cesium ions. • The biosorption equilibrium is fitted well to a Langmuir model with a correlation coefficient of 0.9997. • First attempt to explore biosorption mechanisms using PIXE and EPBS. • Living and dead microorganisms have different biosorption mechanisms. • The biosorption of 137Cs involved a two-step process: passive and active

  17. Adsorption of cesium on cement mortar from aqueous solutions.

    Science.gov (United States)

    Volchek, Konstantin; Miah, Muhammed Yusuf; Kuang, Wenxing; DeMaleki, Zack; Tezel, F Handan

    2011-10-30

    The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L(-1) and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive (137)Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L(-1) while the respective surface concentration on coupons varied from 0.0395 to 22.34 μg cm(-2). Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol(-1) suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  18. 10 CFR 1.34 - Office of Administration.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Office of Administration. 1.34 Section 1.34 Energy NUCLEAR REGULATORY COMMISSION STATEMENT OF ORGANIZATION AND GENERAL INFORMATION Headquarters Staff Offices § 1.34 Office of Administration. The Office of Administration— (a) Develops and implements...

  19. 29 CFR 784.134 - “Canning.”

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false âCanning.â 784.134 Section 784.134 Labor Regulations... First Processing, Canning, Or Packing of Marine Products Under Section 13(a)(5) § 784.134 “Canning.” The term “canning” was defined in the legislative history of the 1949 amendments (House (Conference)...

  20. 13 CFR 134.409 - Decision on appeal.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision on appeal. 134.409 Section 134.409 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING... § 134.409 Decision on appeal. (a) A decision of the Administrative Law Judge under this subpart is...

  1. 13 CFR 134.404 - Decision by Administrative Law Judge.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Decision by Administrative Law Judge. 134.404 Section 134.404 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... 8(a) Program § 134.404 Decision by Administrative Law Judge. Appeal proceedings brought under...

  2. 19 CFR 134.14 - Articles usually combined.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles usually combined. 134.14 Section 134.14... TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.14 Articles usually combined. (a) Articles combined before delivery to purchaser. When an imported article is of a kind which is...

  3. Synthesis and peculiarities of the cesium zeolite crystal structure (cesite)

    International Nuclear Information System (INIS)

    An attempt is made to synthesize cesium zeolite by introduction of amorphous seed crystals which correspond by composition with cesium-containing zeolite into the aluminosilicate gel, since this method can produce zeolite with a crystal structure it would not adopt under the usual conditions. It is seen that during crystablization upon introduction of a seed crystal the cesium content in zeolite decreases. A more complete structural elucidation of zeolite obtained by the suggested method was carried out by x0ray and IR spectral analyses. The data of x-ray analysis showed that the structures of synthesized zeolite and binary octagonal pores are similar

  4. Pollution of drug-technical materials by cesium-137

    International Nuclear Information System (INIS)

    Drug-technical raw materials are medicinal plants (flowers, folium, grasses, mushrooms, roots, fruits, berry, kidney, cortex), used in pharmacy. To limit receipt cesium-137 in people body in 1993 in the Republic of Belarus were created 'Temporary permission levels of the cesium-137 radionuclides contents in drug-technical raw materials' were created (TPL-1993). The permission levels of cesium-137 are following: for drug-technical raw material (flowers, folium, grass, mushrooms, roots and other plants parts) - 1850 Bq/kg, for dried up fruits and berries - 2590 Bq/kg. (Author)

  5. Management of cesium loaded AMP- Part I preparation of 137Cesium concentrate and cementation of secondary wastes

    International Nuclear Information System (INIS)

    Separation of 137cesium from High Level Waste can be achieved by use of composite-AMP, an engineered form of Ammonium Molybdo-Phosphate(AMP). Direct vitrification of cesium loaded composite AMP in borosilicate glass matrix leads to separation of water soluble molybdate phase. A proposed process describes two different routes of selective separation of molybdates and phosphate to obtain solutions of cesium concentrates. Elution of 137Cesium from composite-AMP by decomposing it under flow conditions using saturated barium hydroxide was investigated. This method leaves molybdate and phosphate embedded in the column but only 70% of total cesium loaded on column could be eluted. Alternatively composite-AMP was dissolved in sodium hydroxide and precipitation of barium molybdate-phosphate from the resultant solution, using barium nitrate was investigated by batch methods. The precipitation technique gave over 99.9% of 137Cesium activity in solutions, free of molybdates and phosphates, which is ideally suited for immobilization in borosilicate glass matrix. Detailed studies were carried out to immobilize secondary waste of 137Cesium contaminated barium molybdate-phosphate precipitates in the slag cement matrix using vermiculite and bentonite as admixtures. The cumulative fraction of 137Cs leached from the cement matrix blocks was 0.05 in 140 days while the 137Cs leach rate was 0.001 gm/cm2/d. (author)

  6. Structure of double hafnium and cesium sulfate

    International Nuclear Information System (INIS)

    The structure of a compound whose formula according to the structural investigation is Cssub(2+x)Hf(SOsub(4))sub(2+x)(HSOsub(4))sub(2-x)x3Hsub(2)O (x approximately 0.7) (a=10.220, b=12.004, c=15.767 A, space group Pcmn) is determined by diffractometric data (2840 reflections, anisotropic refinement, R=0.087). It is build of complex unions [Hf(SO4)4H2O]4-, Cs+ cations and water molecules. Eight O atoms surrounding Hf atom (dodecahedron Hf-O 2.10-2.22 A) belong to four sulphate groups and water molecule. Three sulphate groups are bidentate-cyclic, and one group - monodentate relative to Hf. The structure has a cesium deficit in particular positions

  7. Biosorption of uranium, radium, and cesium

    International Nuclear Information System (INIS)

    Some fundamental aspects of the biosorption of metals by microbial cells were investigated. These studies were carried out in conjunction with efforts to develop a process to utilize microbial cells as biosorbents for the removal of radionuclides from waste streams generated by the nuclear fuel cycle. It was felt that an understanding of the mechanism(s) of metal uptake would potentially enable the enhancement of the metal uptake phenomenon through environmental or genetic manipulation of the microorganisms. Also presented are the results of a preliminary investigation of the applicability of microorganisms for the removal of 137cesium and 226radium from existing waste solutions. The studies were directed primarily at a characterization of uranium uptake by the yeast, Saccharomyces cerevisiae, and the bacterium, Pseudomonas aeruginosa

  8. Atmospheric transmission for cesium DPAL using TDLAS

    Science.gov (United States)

    Rice, Christopher A.; Perram, Glen P.

    2012-03-01

    The cesium (Cs) Diode Pumped Alkali Laser (DPAL) operates near 894 nm, in the vicinity of atmospheric water vapor absorption lines. An open-path Tunable Diode Laser Absorption (TDLAS) system composed of narrow band (~300 kHz) diode laser fiber coupled to a 12" Ritchey-Chrétien transmit telescope has been used to study the atmospheric transmission characteristics of Cs DPALs over extended paths. The ruggedized system has been field deployed and tested for propagation distances of greater than 1 km. By scanning the diode laser across many free spectral ranges, many rotational absorption features are observed. Absolute laser frequency is monitored with a High Finesse wavemeter to an accuracy of less than 10 MHz. Phase sensitive detection is employed with an absorbance of less than 1% observable under field conditions.

  9. Sorption of cesium and strontium by arid region desert soil

    International Nuclear Information System (INIS)

    Adsorption and ion exchange in soil systems are the principal mechanisms that retard the migration of nuclear waste to the biosphere. Cesium and strontium are two elements with radioactive isotopes (Cs137 and Sr90) that are commonly disposed of as nuclear waste. The sorption and ion exchange properties of nonradioactive cesium and strontium were studied in this investigation. The soil used in this study was collected at an experimental infiltration site on Frenchman Flat, a closed drainage basin on the Nevada Test Site. This soil is mostly nonsaline-alkali sandy loam and loamy sand with a cation exchange capacity ranging from 13 to 30 me/100g. The clay fraction of the soil contains illite, montmorillonite, and clinoptilolite. Ion exchange studies have shown that this soil sorbs cesium preferentially relative to strontium, and that charge for charge, the exchange-phase cations released from exchange sites exceed the cesium and strontium sorbed by the soil. 38 references, 22 figures

  10. Sorption of cesium on Olkiluoto mica gneiss, granodiorite and granite

    Energy Technology Data Exchange (ETDEWEB)

    Huitti, T.; Hakanen, M. [Univ. of Helsinki (Finland). Lab. of Radiochemistry; Lindberg, A. [Geological Survey of Finland, Espoo (Finland)

    1998-09-01

    Cesium was selected as a model to study the sorption in bedrock occurring by ion exchange mechanism. The aim of the study was to supplement the existing data on sorption occurring by ion exchange mechanism in bedrock of the candidate sites for spent fuel disposal at Olkiluoto. The sorption of cesium was studied on crushed mica gneiss, tonalite (granodiorite) and granite in artificial groundwaters. Fresh water was represented by Allard water, pH 8 and pH 7, and saline water by Ol-So water, pH 7 and pH 9. In addition, a Na-Ca-Cl brine water and its 1:10 dilution were used as simulants. Cesium concentrations were between 10{sup -8} and 10{sup -3} mol/l. The distribution coefficients of the sorption, R{sub d} and R{sub a} values were determined by batch method. Isotherms were partly non-linear with slopes 0.7 - 1.0 depending on rock and water. At the end of the sorption experiment, the water was analysed for cations exchanged for cesium. The sorption of cesium was also studied as a function of ionic strength. The ionic strength increased in the order Allard < 0l-Br 1:10 < 0l-So < 0l-Br. The sorption of cesium was lower at higher ionic strength and higher Cs concentration. The mineral composition of rocks was determined by thin section analysis, and the sorption distribution ratios on thin sections in the different waters were determined by batch technique. The minerals, that sorbed most cesium were determined by autoradiography. These were biotite, muscovite and chlorite. Cordierite in mica gneiss also sorbed cesium very effectively. (orig.) 12 refs.

  11. Adsorption Behaviour of Liquid 4He on Cesium Substrates

    OpenAIRE

    Iov, Valentin

    2004-01-01

    The aim of this thesis is to investigate the wetting properties of 4He on cesium substrates using optical and electrical methods. Due to the fact that the cesium substrates are deposited at low temperatures onto a thin silver underlayer, it is necessary firstly to study and understand the adsorption of helium on silver. The work presented here is structured as follows: some of the fundamental concepts on the theory of physisorbed films, such as van der Waals interaction, adsorption isotherms ...

  12. STS-134 Re-Rendezvous Design History

    Science.gov (United States)

    Stuit, Timothy D.

    2011-01-01

    In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.

  13. Transporting dynamics of radioactive cesium in a forest ecosystem and its discharge processes

    Energy Technology Data Exchange (ETDEWEB)

    Iseda, Kohei; Ohte, Nobuhito; Tanoi, Keitaro; Endo, Izuki; Oda, Tomoki; Kato, Hiroyu [Graduate School of Agricultural and Life Sciences, University of Tokyo (Japan)

    2014-07-01

    A lot of radioactive substance including {sup 137}Cs, {sup 134}Cs fell out to Tohoku and Kanto region in particular Fukushima prefecture after the accident of Fukushima-daiichi nuclear power plant. Generally, cesium tends to attach to clay particle and organic matter. These clay particle and organic matter can potentially flow out from the forest through the river to the downstream not only as particulate matter but also dissolved matter. It is likely that behavior of cesium is similar to sediment locomotion. The objective of this study is to understand transporting dynamics of radioactive cesium inside and outside of the forest. We started investigations on transporting dynamics of cesium in the forest upper stream of Kami-Oguni river in Date city Fukushima prefecture located in about 50 km from the nuclear power plant since July 2012. We conducted river water sampling at 9 points along the river from the uppermost stream to the middle reaches during low flow condition once a month. We also sampled river water during storm event for 5 times in order to capture the change of {sup 137}Cs concentration in a flood stage. Samples were filtered and separated into particulate and dissolved matters using glass micro-fiber filters (GF/F). Samples were analyzed their {sup 137}Cs concentration by Germanium semiconductor detector at University of Tokyo. During low flow condition, {sup 137}Cs was detected only a very small amount both in particulate and dissolved matters. In contrast, during high flow condition, {sup 137}Cs was detected about 10-100 times higher than that of during low flow condition in particulate matter. We estimated discharge flux of {sup 137}Cs from the forest using the relations between water discharge and {sup 137}Cs concentration. It was 0.977 Bq/(m2 day ) (2012/8/31-2013/4/19). In the forest, we set 2 deciduous tree plots (Quercus serrata, Zelkova serrata and so on) and 1 evergreen confer plot (Cyptomeria japonica). Atmospheric depositions of {sup 137

  14. Experimental evaluation of automotive air-conditioning using HFC-134a and HC-134a

    Science.gov (United States)

    Nasution, Henry; Zainudin, Muhammad Amir; Aziz, Azhar Abdul; Latiff, Zulkarnain Abdul; Perang, Mohd Rozi Mohd; Rahman, Abd Halim Abdul

    2012-06-01

    An experimental study to evaluate the energy consumption of an automotive air conditioning is presented. In this study, these refrigerants will be tested using the experimental rig which simulated the actual cars as a cabin complete with a cooling system component of the actual car that is as the blower, evaporator, condenser, radiators, electric motor, which acts as a vehicle engine, and then the electric motor will operate the compressor using a belt and pulley system, as well as to the alternator will recharge the battery. The compressor working with the fluids HFC-134a and HC-134a and has been tested varying the speed in the range 1000, 1500, 2000 and 2500 rpm. The measurements taken during the one hour experimental periods at 2-minutes interval times for temperature setpoint of 20°C with internal heat loads 0, 500, 700 and 1000 W. The final results of this study show an overall better energy consumption of the HFC-134a compared with the HC-134a.

  15. Evaluation of ambient dose equivalent rates influenced by vertical and horizontal distribution of radioactive cesium in soil in Fukushima Prefecture

    CERN Document Server

    Malins, Alex; Nakama, Shigeo; Saito, Tatsuo; Okumura, Masahiko; Machida, Masahiko; Kitamura, Akihiro

    2016-01-01

    The air dose rate in an environment contaminated with 134Cs and 137Cs depends on the amount, depth profile and horizontal distribution of these contaminants within the ground. This paper introduces and verifies a tool that models these variables and calculates ambient dose equivalent rates at 1 m above the ground. Good correlation is found between predicted dose rates and dose rates measured with survey meters in Fukushima Prefecture in areas contaminated with radiocesium from the Fukushima Dai-ichi Nuclear Power Plant accident. This finding is insensitive to the choice for modelling the activity depth distribution in the ground using activity measurements of collected soil layers, or by using exponential and hyperbolic secant fits to the measurement data. Better predictions are obtained by modelling the horizontal distribution of radioactive cesium across an area if multiple soil samples are available, as opposed to assuming a spatially homogeneous contamination distribution. Reductions seen in air dose rate...

  16. Evaluation of ambient dose equivalent rates influenced by vertical and horizontal distribution of radioactive cesium in soil in Fukushima Prefecture.

    Science.gov (United States)

    Malins, Alex; Kurikami, Hiroshi; Nakama, Shigeo; Saito, Tatsuo; Okumura, Masahiko; Machida, Masahiko; Kitamura, Akihiro

    2016-01-01

    The air dose rate in an environment contaminated with (134)Cs and (137)Cs depends on the amount, depth profile and horizontal distribution of these contaminants within the ground. This paper introduces and verifies a tool that models these variables and calculates ambient dose equivalent rates at 1 m above the ground. Good correlation is found between predicted dose rates and dose rates measured with survey meters in Fukushima Prefecture in areas contaminated with radiocesium from the Fukushima Dai-ichi Nuclear Power Plant accident. This finding is insensitive to the choice for modeling the activity depth distribution in the ground using activity measurements of collected soil layers, or by using exponential and hyperbolic secant fits to the measurement data. Better predictions are obtained by modeling the horizontal distribution of radioactive cesium across an area if multiple soil samples are available, as opposed to assuming a spatially homogeneous contamination distribution. Reductions seen in air dose rates above flat, undisturbed fields in Fukushima Prefecture are consistent with decrement by radioactive decay and downward migration of cesium into soil. Analysis of remediation strategies for farmland soils confirmed that topsoil removal and interchanging a topsoil layer with a subsoil layer result in similar reductions in the air dose rate. These two strategies are more effective than reverse tillage to invert and mix the topsoil.

  17. Solvent-free synthesis and application of nano-Fe/Ca/CaO/[PO4] composite for dual separation and immobilization of stable and radioactive cesium in contaminated soils

    International Nuclear Information System (INIS)

    Graphical abstract: A possible pathway for immobilization with the nano-Fe/Ca/CaO/[PO4] treatment (a) 133Cs is adsorbed onto the soil particles, (b) Cs encapsulation through the formation of immobile salts, and (c) solid (small/finer or larger/aggregate) soil fraction separation. - Highlights: • Nano-Fe/Ca/CaO/[PO4] composite for Cs immobilization in soil was developed. • Enhanced cesium separation and immobilization was done in dry condition. • By SEM analysis the amount of cesium detectable on soil particle surface decreases. • Leachable cesium concentrations reduced, lower than the standard regulatory limit. • Nano-Fe/Ca/CaO/[PO4] a highly potential amendment for the remediation of Cs. - Abstract: This study assessed the synthesis and application of nano-Fe/Ca/CaO-based composite material for use as a separation and immobilizing treatment of dry soil contaminated by stable (133Cs) and radioactive cesium species (134Cs and 137Cs). After grinding with nano-Fe/CaO, nano-Fe/Ca/CaO, and nano-Fe/Ca/CaO/[PO4], approximately 31, 25, and 22 wt% of magnetic fraction soil was separated. Their resultant 133Cs immobilization values were about 78, 81, and 100%, respectively. When real radioactive cesium contaminated soil obtained from Fukushima was treated with nano-Fe/Ca/CaO/[PO4], approximately 27.3 wt% of magnetic and 72.75% of non-magnetic soil fractions were separated. The highest amount of entrapped 134Cs and 137Cs was found in the lowest weight of the magnetically separated soil fraction (i.e., 80% in 27.3% of treated soil). Results show that 134Cs and 137Cs either in the magnetic or non-magnetic soil fractions was 100% immobilized. The morphology and mineral phases of the nano-Fe/Ca/CaO/[PO4] treated soil were characterized using SEM–EDS, EPMA, and XRD analysis. The EPMA and XRD patterns indicate that the main fraction of enclosed/bound materials on treated soil included Ca/PO4 associated crystalline complexes. These results suggest that simple grinding

  18. Solvent-free synthesis and application of nano-Fe/Ca/CaO/[PO{sub 4}] composite for dual separation and immobilization of stable and radioactive cesium in contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Mallampati, Srinivasa Reddy, E-mail: srireddys@ulsan.ac.kr [Department of Civil and Environmental Engineering, University of Ulsan, Daehak-ro 93, Nam-gu, Ulsan 680-749 (Korea, Republic of); Mitoma, Yoshiharu, E-mail: mitomay@pu-hiroshima.ac.jp [Department of Environmental Sciences, Faculty of Life and Environmental Sciences, Prefectural University of Hiroshima, 562 Nanatsuka-Cho Shobara City, Hiroshima 727-0023 (Japan); Okuda, Tetsuji [Environmental Research and Management Center, Hiroshima University, 1-5-3 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8513 (Japan); Simion, Cristian [Politehnica University of Bucharest, Department of Organic Chemistry, Bucharest 060042 (Romania); Lee, Byeong Kyu [Department of Civil and Environmental Engineering, University of Ulsan, Daehak-ro 93, Nam-gu, Ulsan 680-749 (Korea, Republic of)

    2015-10-30

    Graphical abstract: A possible pathway for immobilization with the nano-Fe/Ca/CaO/[PO{sub 4}] treatment (a) {sup 133}Cs is adsorbed onto the soil particles, (b) Cs encapsulation through the formation of immobile salts, and (c) solid (small/finer or larger/aggregate) soil fraction separation. - Highlights: • Nano-Fe/Ca/CaO/[PO{sub 4}] composite for Cs immobilization in soil was developed. • Enhanced cesium separation and immobilization was done in dry condition. • By SEM analysis the amount of cesium detectable on soil particle surface decreases. • Leachable cesium concentrations reduced, lower than the standard regulatory limit. • Nano-Fe/Ca/CaO/[PO{sub 4}] a highly potential amendment for the remediation of Cs. - Abstract: This study assessed the synthesis and application of nano-Fe/Ca/CaO-based composite material for use as a separation and immobilizing treatment of dry soil contaminated by stable ({sup 133}Cs) and radioactive cesium species ({sup 134}Cs and {sup 137}Cs). After grinding with nano-Fe/CaO, nano-Fe/Ca/CaO, and nano-Fe/Ca/CaO/[PO{sub 4}], approximately 31, 25, and 22 wt% of magnetic fraction soil was separated. Their resultant {sup 133}Cs immobilization values were about 78, 81, and 100%, respectively. When real radioactive cesium contaminated soil obtained from Fukushima was treated with nano-Fe/Ca/CaO/[PO{sub 4}], approximately 27.3 wt% of magnetic and 72.75% of non-magnetic soil fractions were separated. The highest amount of entrapped {sup 134}Cs and {sup 137}Cs was found in the lowest weight of the magnetically separated soil fraction (i.e., 80% in 27.3% of treated soil). Results show that {sup 134}Cs and {sup 137}Cs either in the magnetic or non-magnetic soil fractions was 100% immobilized. The morphology and mineral phases of the nano-Fe/Ca/CaO/[PO{sub 4}] treated soil were characterized using SEM–EDS, EPMA, and XRD analysis. The EPMA and XRD patterns indicate that the main fraction of enclosed/bound materials on treated soil

  19. Oceanic dispersion of radioactive cesium in the western North Pacific - Eastward dispersion in surface water and southward intrusion with mode water

    Energy Technology Data Exchange (ETDEWEB)

    Kaeriyama, Hideki; Ambe, Daisuke; Shigenobu, Yuya; Fujimoto, Ken; Ono, Tsuneo; Watanabe, Tomowo [National Research Institute of Fisheries Science, Fisheries Research Agency, 2-12-4, Fukuura, Kanazawa, Yokohama, Kanagawa 236-8648 (Japan); Morita, Takami [Fisheries Research Agency, 2-3-3, Minato Mirai, Nishi-ku, Yokohama, Kanagawa 220-6115 (Japan)

    2014-07-01

    The Fukushima Dai-ichi Nuclear Power Plant (FNPP) accident after the Great East Japan Earthquake and tsunami on 11 March 2011 resulted in elevation of the level of anthropogenic radioactivity in the marine environment in the western North Pacific from atmospheric fallout and direct discharges of highly radioactive liquid waters. Intensive monitoring on iodine-131, cesium-134 (Cs-134) and cesium-137 (Cs-137) in seawater near offshore FNPP, and those in marine organisms in the broad area around Japan were conducted, while the information of radioactive contamination in the North Pacific is still limited due to the limitation of the observational data. In this study, we report the concentrations of Cs-134 and Cs-137 in seawater collected from western North Pacific during June 2011 and November 2012. The eastward dispersion of FNPP-derived radioactive cesium in the surface water has been observed with prevention of southward dispersion due to the strong eastward current (Kuroshio Extension; KE) in the North Pacific. Although the concentrations of Cs-134 and Cs-137 were remarkably decreased between 2011 and 2012 at 145 deg. E and 155 deg. E, they were almost comparable between these two years at 175 deg. E. The inventories of Cs-137 between 0-500 m around KE at 147 deg. E were ranged from 3800 to 11000 Bq/m{sup 2} in October 2011, and from 1000 to 2400 Bq/m{sup 2} in November 2012. Surface water had the highest concentration of radioactive Cs at northern part of KE, subsurface peak of radioactive Cs were observed at KE and south of KE in both years. Furthermore, the southward dispersion of FNPP-derived radioactive Cs in the subsurface waters were also observed south of Japan Islands. We found the FNPP-derived Cs-134 (1.8-6.8 mBq/kg) at southernmost 18 deg. N, 135 deg. deg. E in September 2012. The potential density at the subsurface peaks of Cs-134 and increase of water column inventories of Cs-137 after the winter season of 2011-2012, suggested that the main water mass

  20. Cesium and strontium in Black Sea macroalgae

    International Nuclear Information System (INIS)

    The trace level of metals and particularly radioactive ones should be monitored to evaluate the transfer along the trophic chain, assess the risk for biota and can be used for global changes assessment. Plants respond rapidly to all changes in the ecosystem conditions and are widely used as indicators and predictors for changes in hydrology and geology. In this work we represent our successful development and applications of a methodology for monitoring of stable and radioactive strontium and cesium in marine biota (Black Sea algae's). In case of radioactive release they are of high interest. We use ED-XRF, gamma spectrometers and LSC instrumentation and only 0.25 g sample. Obtained results are compared with those of other authors in same regions. The novelty is the connection between the radioactive isotopes and their stable elements in algae in time and space scale. All our samples were collected from Bulgarian Black Sea coast. - Highlights: • An extraction chromatography method for radiochemical separation of Sr and Cs. • Assessment of Sr and Cs accumulation capacity of six Black Sea macroalgae species. • Connection between the isotopes and their stable elements content in algae. • Assessment of Sr and Cs content in ecosystems along the Bulgarian coast

  1. Viscosity and crystallization mechanism of cesium loaded iron phosphate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Joseph, Kitheri, E-mail: joskit@igcar.gov.in [Chemistry Group, IGCAR, Kalpakkam 603 102 (India); Kutty, K.V. Govindan [Chemistry Group, IGCAR, Kalpakkam 603 102 (India); Goswami, M.C. [National Metallurgical Laboratory, Jamshedpur 831 007 (India); Rao, P.R. Vasudeva [Chemistry Group, IGCAR, Kalpakkam 603 102 (India)

    2014-07-01

    Highlights: • Melt viscosity of cesium loaded iron phosphate glasses is measured and reported for the first time. • Viscosity – temperature followed Arrhenius model. • Activation energy of viscous flow is strongly correlated to glass transition temperature of the glasses. • Process of crystallization of cesium loaded glass by approximation-free kinetic method to understand the mechanism. • Cesium loaded IPG and IPG shows bulk crystallization mechanism. - Abstract: This paper describes the melt viscosity behaviour and the crystallization mechanism of a series of iron phosphate glasses. High temperature viscosity measurements were carried out on pristine iron phosphate glass and a series of cesium loaded iron phosphate glasses in order to understand the effect of addition of Cs{sub 2}O on viscosity of iron phosphate glasses. Activation energy of viscous flow was estimated from the experimental data by applying Arrhenius model of viscosity–temperature relationship. Activation energy of viscous flow is observed to be strongly correlated to glass transition temperature of these glasses. Fragility of iron phosphate and cesium loaded iron phosphate glass systems were also evaluated in region of high temperature. Crystallization of these glasses was studied using thermal analysis techniques. Temperature integral approximation free method was utilized to evaluate the kinetic parameters such as activation energy of crystallization (E{sub c}) and Avrami exponent (n). The value of Avrami exponent ‘n’ obtained showed that the glasses under present study crystallize via bulk crystallization mechanism, i.e., nucleation and three dimensional growth.

  2. Cesium corrosion process in Fe–Cr steel

    International Nuclear Information System (INIS)

    A cesium corrosion out-pile test was performed to Fe–Cr steel in a simulated fuel pin environment. In order to specify the corrosion products, the corroded area was analyzed by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). A cesium corrosion process in Fe–Cr steel was successfully developed proceeding from both experimental results and thermochemical consideration. The corroded area was mainly formed by Fe layer and Fe depleted oxidized layer. The Fe depleted oxidized layer was formed by Cr0.5Fe0.5 and Cr2O3. The presumed main corrosion reactions were 2Cr+2/3 O2→Cr2O3(ΔG650°C=-894.1kJ/mol) and Cr23C6+46Cs+46O2→23Cs2CrO4+6C(ΔG650°C=-25018.1kJ/mol). Factors of these reactions are chromium, carbon, oxygen and cesium. Therefore, cesium corrosion progression must be dependent on the chromium content, carbon content in the steel, the supply rate of oxygen and temperature which correlated with the diffusion rate of cesium and oxygen into the specimen

  3. Viscosity and crystallization mechanism of cesium loaded iron phosphate glasses

    International Nuclear Information System (INIS)

    Highlights: • Melt viscosity of cesium loaded iron phosphate glasses is measured and reported for the first time. • Viscosity – temperature followed Arrhenius model. • Activation energy of viscous flow is strongly correlated to glass transition temperature of the glasses. • Process of crystallization of cesium loaded glass by approximation-free kinetic method to understand the mechanism. • Cesium loaded IPG and IPG shows bulk crystallization mechanism. - Abstract: This paper describes the melt viscosity behaviour and the crystallization mechanism of a series of iron phosphate glasses. High temperature viscosity measurements were carried out on pristine iron phosphate glass and a series of cesium loaded iron phosphate glasses in order to understand the effect of addition of Cs2O on viscosity of iron phosphate glasses. Activation energy of viscous flow was estimated from the experimental data by applying Arrhenius model of viscosity–temperature relationship. Activation energy of viscous flow is observed to be strongly correlated to glass transition temperature of these glasses. Fragility of iron phosphate and cesium loaded iron phosphate glass systems were also evaluated in region of high temperature. Crystallization of these glasses was studied using thermal analysis techniques. Temperature integral approximation free method was utilized to evaluate the kinetic parameters such as activation energy of crystallization (Ec) and Avrami exponent (n). The value of Avrami exponent ‘n’ obtained showed that the glasses under present study crystallize via bulk crystallization mechanism, i.e., nucleation and three dimensional growth

  4. The diffusion of cesium, strontium, and europium in silicon carbide

    Science.gov (United States)

    Dwaraknath, S. S.; Was, G. S.

    2016-08-01

    A novel multi-layer diffusion couple was used to isolate the diffusion of strontium, europium and cesium in SiC without introducing radiation damage to SiC and at concentrations below the solubility limit for the fission products in SiC. Diffusion occurred by both bulk and grain boundary pathways for all three fission products between 900∘ C and 1 ,300∘ C. Cesium was the fastest diffuser below 1 ,100∘ C and the slowest above this temperature. Strontium and europium diffusion tracked very closely as a function of temperature for both bulk and grain boundary diffusion. Migration energies ranged from 1.0 eV to 5.7 eV for bulk diffusion and between 2.2 eV and 4.7 eV for grain boundary diffusion. These constitute the first measurements of diffusion of cesium, europium, and strontium in silicon carbide, and the magnitude of the cesium diffusion coefficient supports the premise that high quality TRISO fuel should have minimal cesium release.

  5. Dissociative excitation of cesium atom upon e-CsOH collisions

    International Nuclear Information System (INIS)

    The process of dissociative excitation of cesium atom in collisions with mono-kinetic molecules of cesium hydroxide is studied. It is established that behaviour of dissociative excitations the cesium atom in spectral series corresponds of to the grade dependence of cross sections on the main quantum number of the upper level. The values of constants, characterizing the behaviour of cross sections in the eight spectral series of the cesium atom are determined

  6. Beef contamination by Cs-134 and Cs-137 in Japan, from the Fukushima Dai-ichi NPP accident

    Energy Technology Data Exchange (ETDEWEB)

    Kelecom, Alphonse; Cruz, Camila Oliveira da; Paulo Filho, Guilherme de Souza, E-mail: lararapls@hotmail.com, E-mail: camilabiouff@gmail.com, E-mail: akelecom@id.uff.br [Universidade Federal Fluminense (LARARA-PLS/UFF), Niteroi, RJ (Brazil). Lab. de Radiobiologia e Radiometria Pedro Lopes dos Santos; Pereira, Wagner de S., E-mail: pereiraws@gmail.com [Industrias Nucleares do Brasil (UNB), Pocos de Caldas, MG (Brazil). Servico de Radioprotecao. Grupo Multidisciplinar de Radioprotecao

    2013-07-01

    The most serious earthquake ever registered in Japan occurred on March 11, 2011; it was followed by a tsunami that flowed over the Prefectures of Miyagi and Fukushima destroying roads, cities and rice fields, but also knocking several nuclear power plants. The Dai-ichi plant was seriously damaged and considerable amounts of radioactivity were release contaminating atmosphere, soil, ocean and associated fauna and flora. A major environmental monitoring program started covering the Japanese territory and the sea along the coasts of Miyagi, Fukushima and Ibaraki. Thousands of measurements were released every day by Japanese authorities, the plant operator and Universities principally looking for the presence of I-131, C{sub s}-134 and C{sub s}-137. Drinking water and aliments were seriously contaminated. We here analyze data released during one year on I-131 and C{sub s}-134,137 radioactive concentrations in cattle meat. Along this period I-131, when observed, was present only in trace amounts, but the contamination by cesium isotopes exceeded legal Japanese limit in several Japanese prefectures, and became an acute national and international economic problem. (author)

  7. Simultaneous solid phase extraction of cobalt, strontium and cesium from liquid radioactive waste using microcrystalline naphthalene

    International Nuclear Information System (INIS)

    Most of the procedures developed for the extraction of cobalt, strontium and cesium by solid phase extraction do not employ simultaneous extraction of them. In this study, rapid simultaneous removal of Co2+, Sr2+ and Cs+ on microcrystalline naphthalene as solid-phase extractant was investigated. These ions were allowed to form chelates with oxine and then adsorbed on freshly microcrystalline naphthalene from aqueous solutions. The solid phase extraction procedure (SPE) was optimized by using model solution containing Co2+, Sr2+ and Cs+ in batch system. The effects of different parameters such as variation in pH, reagent concentration, standing time, naphthalene solution concentration and contact time on the simultaneous removal of these ions was studied. The obtained results indicated that, sorption was found to be rapid, and the percentage removal of Co2+, Sr2+ and Cs+ was found to be 98, 79 and 68% within 10 min, respectively. The kinetics of the sorption process was investigated to understand the kinetic characteristics of sorption of metal chelates onto microcrystalline naphthalene. The developed procedure has been successfully applied to the removal and recovery of 60Co and 134Cs from liquid radioactive waste. The parameters can be used for designing a plant for treatment of wastewater economically.

  8. Cesium in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.

    1992-03-01

    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of [sup 137]Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of [sup 137]Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope [sup 137]Cs releases have resulted in a negligible risk to the environment and the population it supports.

  9. Cesium in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.

    1992-03-01

    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of {sup 137}Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of {sup 137}Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope {sup 137}Cs releases have resulted in a negligible risk to the environment and the population it supports.

  10. Controllable evaporation of cesium from a dispenser oven

    Science.gov (United States)

    Fantz, U.; Friedl, R.; Fröschle, M.

    2012-12-01

    This instrument allows controlled evaporation of the alkali metal cesium over a wide range of evaporation rates. The oven has three unique features. The first is an alkali metal reservoir that uses a dispenser as a cesium source. The heating current of the dispenser controls the evaporation rate allowing generation of an adjustable and stable flow of pure cesium. The second is a blocking valve, which is fully metallic as is the body of the oven. This construction both reduces contamination of the dispenser and enables the oven to be operated up to 300 °C, with only small temperature variations (metal at a cold spot is significantly hindered. The last feature is an integral surface ionization detector for measuring and controlling the evaporation rate. The dispenser oven can be easily transferred to the other alkali-metals.

  11. Dating of mine waste in lacustrine sediments using cesium-137

    Science.gov (United States)

    Rember, W. C.; Erdman, T. W.; Hoffmann, M. L.; Chamberlain, V. E.; Sprenke, K. F.

    1993-11-01

    For over a century Medicine Lake in northern Idaho has received heavy-metal-laden tailings from the Coeur d'Alene mining district. Establishing the depositional chronology of the lake bottom sediments provides information on the source and rate of deposition of the tailings. Cesium-137, an isotope produced in the atmosphere by nuclear bomb tests, was virtually absent in the environment prior to 1951, but reached its apex in 1964. Our analysis of cesium-137 in the sediments of Medicine Lake revealed that 14 cm of fine-grained tailings were deposited in the lake from 1951 to 1964 and tailing deposition downstream was greatly reduced by the installation of tailings dams in the district in 1968. Cesium-137 analysis is accomplished by a fairly simple gamma-ray counting technique and should be a valuable tool for analyzing sedimentation in any lacustrine environment that was active during the 1950s and 1960s.

  12. Cesium 137 in oils and plants from Guatemala

    International Nuclear Information System (INIS)

    Since 1990 the project of radioactive and environmental contamination started in Guatemala. Studies about the radioactive contamination levels are made within the framework of this project. Cesium-137 has been an interest radionuclide, because it is a fission product released to the environment by the use of nuclear weapons and nuclear power plants accidents. The sampling consisted in collection of soil and grass in 20 provinces of Guatemala, one point by province, and it was made in 1990. The cesium-137 concentration in the samples, was determined by gamma spectrometry, using an hyper pure germanium detector. The results show the presence of radioactive contamination in soil and grass due to cesium-137, at levels that might be considered as normal. The levels found are not harmful for human health, and its importance is the fact that can be used as reference levels for the environmental radioactivity monitoring in Guatemala

  13. Study of radiatively sustained cesium plasmas for solar energy conversion

    Science.gov (United States)

    Palmer, A. J.; Dunning, G. J.

    1980-01-01

    The results of a study aimed at developing a high temperature solar electric converter are reported. The converter concept is based on the use of an alkali plasma to serve as both an efficient high temperature collector of solar radiation as well as the working fluid for a high temperature working cycle. The working cycle is a simple magnetohydrodynamic (MHD) Rankine cycle employing a solid electrode Faraday MHD channel. Research milestones include the construction of a theoretical model for coupling sunlight in a cesium plasma and the experimental demonstration of cesium plasma heating with a solar simulator in excellent agreement with the theory. Analysis of a solar MHD working cycle in which excimer laser power rather than electric power is extracted is also presented. The analysis predicts a positive gain coefficient on the cesium-xenon excimer laser transition.

  14. 7 CFR 1942.134 - State supplements and guides.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 13 2010-01-01 2009-01-01 true State supplements and guides. 1942.134 Section 1942.134 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE (CONTINUED) PROGRAM REGULATIONS...

  15. Direct and indirect contamination of tree crops with Cs-134

    International Nuclear Information System (INIS)

    A long term glasshouse pot experiment was established in 1994 to study the transfer factors of Cs-134 from soil to olive and orange trees for which no relevant data are available. A calcareous-heavy textured and an acid-light textured soil were used in this experiment. Results from two year's experimentation are considered in this study. The ability of the studied plant species for Cs-134 root uptake seems to be significantly influenced by soil type. The contamination of both tree species grown on calcareous and heavy soil was very low and did not change much with the time. On the contrary, trees grown on acid and light soil showed much higher Cs-134 concentration (up to 34 times for orange and 23 for olive trees) which significantly increased with the time. Both olive and orange trees showed a similar behaviour in the studied soils. Effort was also made to study the long term consequences of the direct contamination in a field experiment where an olive tree was contaminated by dry deposition with Cs-134. Six months after contamination 5 % of the Cs-134 deposited on the leaves was measured in the first olive production. However, very small quantities (= 0.5 %) of the olive Cs-134 was detected in the unprocessed olive oil. The following year 15 % of the Cs-134 remained in the leaves while extremely low quantities of Cs-134 were detected in either olives or olive oil. (author)

  16. 19 CFR 134.11 - Country of origin marking required.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Country of origin marking required. 134.11 Section... OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Subject to Marking § 134.11 Country of origin... English name of the country of origin of the article, at the time of importation into the...

  17. 41 CFR 105-53.134 - Office of Administration.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Administration. 105-53.134 Section 105-53.134 Public Contracts and Property Management Federal Property Management... Associate Administrator for Administration, participates in the executive leadership of the...

  18. 26 CFR 13.4 - Arbitrage bonds; temporary rules.

    Science.gov (United States)

    2010-04-01

    ... 13.4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) TEMPORARY INCOME TAX REGULATIONS UNDER THE TAX REFORM ACT OF 1969 § 13.4 Arbitrage bonds... 103(a)(1). Thus, the interest on an obligation which would have been excluded from gross...

  19. 19 CFR 134.43 - Methods of marking specific articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Methods of marking specific articles. 134.43...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.43 Methods of marking specific articles. (a) Marking previously required by certain provisions of...

  20. 42 CFR 84.134 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.134... Respirators § 84.134 Respirator containers; minimum requirements. Supplied-air respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type...

  1. 19 CFR 134.35 - Articles substantially changed by manufacture.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles substantially changed by manufacture. 134...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Exceptions to Marking Requirements § 134.35 Articles substantially changed by manufacture. (a) Articles other than goods of a NAFTA country. An article used in...

  2. 13 CFR 134.220 - Prohibition against ex parte communications.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Prohibition against ex parte communications. 134.220 Section 134.220 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... concerning any fact, question of law, or SBA policy relevant to the merits of a case before that Judge...

  3. 7 CFR 57.134 - Accessibility of product.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Accessibility of product. 57.134 Section 57.134... AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) INSPECTION OF EGGS (EGG PRODUCTS INSPECTION ACT) Regulations Governing the Inspection of Eggs Performance of Services §...

  4. Sorption of cesium in young till soils

    Energy Technology Data Exchange (ETDEWEB)

    Lusa, Merja; Lempinen, Janne; Ahola, Hanna; Soederlund, Mervi; Lehto, Jukka [Helsinki Univ. (Finland). Laboratory of Radiochemistry; Lahdenperae, Anne-Maj [Saanio and Riekkola Oy, Consulting Engineers, Helsinki (Finland); Ikonen, Ari T.K. [Posiva Oy, Eurajoki (Finland)

    2014-10-01

    Soil samples from three forest soil pits were examined down to a depth of approximately three metres using 1 M ammonium acetate extraction and microwave-assisted extraction with concentrated nitric acid (HNO{sub 3}), to study the binding of cesium (Cs) at Olkiluoto Island, southern Finland. Ammonium acetate was used to extract the readily exchangeable Cs fractions roughly representing the Cs fraction in soil which is available for plants. Microwave-assisted HNO{sub 3} extraction dissolves various minerals, e.g. carbonates, most sulphides, arsenides, selenides, phosphates, molybdates, sulphates, iron (Fe) and manganese (Mn) oxides and some silicates (olivine, biotite, zeolite), and reflects the total Cs concentrations. Cs was mostly found in the strongly bound fraction obtained through HNO{sub 3} extraction. The average Cs concentrations found in this fraction were 3.53 ± 0.30 mg/kg (d.w.), 3.06 ± 1.86 mg/kg (d.w.) and 1.83 ± 0.42 mg/kg (d.w.) in the three soil pits, respectively. The average exchangeable Cs found in the ammonium acetate extraction in all three sampling pits was 0.015 ± 0.008 mg/kg (d.w.). In addition, Cs concentrations in the soil solution were determined and in situ distribution coefficients (K{sub d}) for Cs were calculated. Furthermore, the in situ K{sub d} data was compared with the Cs K{sub d} data obtained using the model batch experiments. The in situ K{sub d} values were observed to fairly well follow the trend of batch sorption data with respect to soil depth, but on average the batch distribution coefficients were almost an order of magnitude higher than the in situ K{sub d} data. In situ Cs sorption data could be satisfactory fitted with the Langmuir sorption isotherm, but the Freundlich isotherm failed to fit the data. Finally, distribution coefficients were calculated by an ion exchange approach using soil solution data, the cation exchange capacity (CEC) as well as Cs to sodium (Na) and Cs to potassium (K) ion exchange selectivity

  5. Nonendoscopic endonasal dacryocystorhinostomy: Outcome in 134 eyes

    Directory of Open Access Journals (Sweden)

    Anasua Ganguly

    2016-01-01

    Full Text Available Aims: To evaluate the outcome of nonendoscopic endonasal dacryocystorhinostomy (NEN-DCR in patients with nasolacrimal duct obstruction (NLDO in India. Methods: Retrospective case series of NEN-DCR between July 2012 and October 2014. All patients had follow-up >3 months. Success was defined anatomically as patency on irrigation and functionally as relief from epiphora. Statistical Analysis Used: Fischer's exact test and Chi-square test. Results: A total of 122 patients (134 eyes; 81 female; mean age 37 ± 18 years were included. Indications were primary acquired NLDO in 92 (68% eyes of adults (>18 years, NLDO in children (<18 years in 22 eyes (16%, acute dacryocystitis in 13 eyes, failed prior DCR in six eyes, and secondary acquired NLDO in one eye. Mean duration of surgery was 36 min (range: 16–92. At a median follow-up of 6 months (range: 3–15, 86% eyes had functional success and 85% had anatomical success. Revision NEN-DCR was successful in 13/16 eyes. All patients with acute dacryocystitis were completely symptom-free at final visit. In children, (17/22 77% achieved functional success after primary NEN-DCR which improved to 100% after one revision. Tube-related epiphora and granuloma in ten eyes resolved after removal. Conclusion: NEN-DCR gives good outcome in primary NLDO and is also effective in those with acute dacryocystitis and in children with NLDO. The technique obviates the need for an endoscope and has an acceptable safety profile and thus may be particularly suited for the developing nations.

  6. Cesium-137 Levels Detected in Otters from Austria

    Directory of Open Access Journals (Sweden)

    Gutleb A.C.

    1991-02-01

    Full Text Available Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra. The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  7. Membrane-based separation technologies for cesium, strontium, and technetium

    Energy Technology Data Exchange (ETDEWEB)

    Kafka, T.

    1996-10-01

    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah.

  8. Cesium Ion Exchange Using Tank 241-AN-104 Supernate

    International Nuclear Information System (INIS)

    The River Protection Project is to design and build a high level nuclear waste treatment facility. The waste treatment plant is to process millions of gallons of radioactive waste stored in tanks at the Hanford Site. The high level nuclear waste treatment process includes various unit operations, such as ultrafiltration, precipitation, evaporation, ion exchange, and vitrification. Ion exchange is identified as the optimal treatment method for removal of cesium-137 and Tc-99 from the waste. Extensive ion exchange testing was performed using small-scale columns with actual waste samples. The objectives of this study were to: demonstrate SuperLig 644 ion exchange performance and process steps for the removal of cesium from actual AN-104 tank waste; pretreat actual AN-104 tank waste to reduce the concentration of cesium-137 in the waste below LAW vitrification limit; produce and characterize cesium eluate solutions for use in eluate evaporation tests. The experiments consisted of batch contact and small-scale column tests. The batch contact tests measured sorption partition coefficients Kds. The Kds were used to predict the effective resin capacity. The small-scale column tests, which closely mimic plant conditions, generated loading and elution profile data used to determine whether removal targets and design requirements were met

  9. Discovery of Cesium, Lanthanum, Praseodymium and Promethium Isotopes

    OpenAIRE

    May, E.; Thoennessen, M

    2011-01-01

    Currently, forty-one cesium, thirty-five lanthanum, thirty-two praseodymium, and thirty-one promethium, isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  10. Strontium-90 and cesium-137 in fresh water

    International Nuclear Information System (INIS)

    Japan Chemical Analysis Center has analysed the strontium-90 and Cesium-137 contents in fresh water from 7 prefectures in Japan by the commission of Science and Technology Agency of Japanese Government. The method described in ''Radioactivity Survey Data in Japan No. 43 (NIRS-RSD-43, 1977) was applied to the analysis of these two radionuclides in samples. (author)

  11. Some aspects of cesium deposition in Transilvania (Romania)

    International Nuclear Information System (INIS)

    Following the accident of the Chernobyl atomic electric power station, a great quantity of radionuclides (∼100MCi) escaped from the reactor. It was estimated that 13% of the inventory activity of cesium representing 1.5-2 MCi left the reactor. The radioactive deposits were very nonuniform for the same distance and in the same direction from Chernobyl nuclear center having a close dependence upon direction and speed of wind and pluviometric conditions. The rains, especially the storms, spectacularly increased the radioactive fallout. Although, for the first two-three days, subsequent to accident, the meteorological conditions were favorable for Romania, after April 29/30, because of the changing in the wind direction on SW (initial it was N and NW) the countries were on this direction - Romania, Bulgaria, Greece, former Yugoslavia - began to be intensely contaminated with radioactive fallout. In Romania, the radioactive cloud passing coincided with abundant rains, especially on the direction mentioned above. On this direction, the cesium deposits are of 8-2 times larger than other Romanian regions. The torrential rain which fell on May 1st 1986, in the western side of Cluj Napoca town caused an intense contamination especially with short-life isotopes as Te, I, Ba, La, Mo. Medium and long-life isotopes as Ru, Zr, Cs, Sr were present in large quantities in this area.too. For the total contribution the value obtained was 1130 kBq/m2, much larger than the average in Romania. This work presents data about cesium content of pollen samples gathered daily between 1-30 May 1986; cesium deposits in five areas and some measurements in connection with cesium mitigation in soils

  12. 33 CFR 157.134 - Cargo tank drainage.

    Science.gov (United States)

    2010-07-01

    ...) POLLUTION RULES FOR THE PROTECTION OF THE MARINE ENVIRONMENT RELATING TO TANK VESSELS CARRYING OIL IN BULK Crude Oil Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.134 Cargo...

  13. 19 CFR 134.54 - Articles released from Customs custody.

    Science.gov (United States)

    2010-04-01

    ...; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Articles Found Not Legally Marked § 134.54 Articles... compliance with the marking requirements, and has attempted by all reasonable means to effect redelivery...

  14. A frozen spin polarized target for S134

    CERN Multimedia

    1974-01-01

    The CERN-ETH, Zurich-Helsinki-Imperial College-Southampton Collaboration used a frozen spin polarized target together with the ETH spectrometer magnet to study spin effects (S134). Beam was d31 in South Hall

  15. 13 CFR 134.618 - How are awards paid?

    Science.gov (United States)

    2010-01-01

    ... CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Implementation of the Equal Access to Justice Act § 134... the adversary adjudication, or of the award, to the following address: Chief Financial Officer,...

  16. Idiopathic urolithiasis in Tunisian children: A report of 134 cases

    OpenAIRE

    A Alaya; Sakly, R; Nouri, A.; M F Najjar; M Belgith; R Jouini

    2013-01-01

    We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males) with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of da...

  17. Distribution and retention of cesium and strontium in Swedish boreal forest ecosystems

    International Nuclear Information System (INIS)

    The retention and distribution of cesium, and to some extent strontium, in forest environments are being studied at three sites in Sweden. The main part of the cesium found in the soil was recovered in horizons rich in organic matter. The cesium was retained in the soil organic matter in a more or less extractable form. As different soil types have a different distribution pattern of organic matter, the distribution of cesium will depend on the forest soil type. The clay content in Swedish forest soils is, in general, low which will mitigate the retention of cesium in the soil mineral horizons. The cesium and strontium present in the trees was considered to be an effect of assimilation by the tissues in the canopy as well as by the roots. The redistribution of cesium within the trees was extensive which was considered to be the effect of a high mobility of cesium in the trees. The recovery of strontium-90 in pines, in relation to the deposition rate was higher compared to the relative recovery of cesium-137, 30 years after deposition. The cesium and strontium will remain in the forest environment for a considerable time but can be reduced by forest practice, by leaching out of the soil profile or by radioactive decay

  18. Comparison of HFO-1234yf with R134a; Vergleich des neuen Kaeltemittels HFO-1234yf mit R134a

    Energy Technology Data Exchange (ETDEWEB)

    Hieble, Tobias; Blumhardt, Rolf [BITZER Kuehlmaschinenbau GmbH, Sindelfingen (Germany); Cibis, Dominik [Europaeische Studienakademie Kaelte-Klima-Lueftung (ESaK), Maintal (Germany)

    2010-04-15

    The thermodynamic properties of the refrigerant HFO-1234yf, especially regarding the COP, will be compared with R134a. Moreover the effect on the compression process due to the higher mass flow will be explained. An additional calculation method will be introduced which focuses on the different properties of the refrigerant. On this basis compressor performance data for HFO-1234yf can be calculated with a high precision from R134a. (orig.)

  19. Removal of radioactive cesium from solutions by zinc ferrocyanide

    Institute of Scientific and Technical Information of China (English)

    LI Bing; LIAO Jiali; WU Jiaojiao; ZHANG Dong; ZHAO Jun; YANG Yuanyou; CHENG Qiong; FENG Yue; LIU Ning

    2008-01-01

    Adsorption of 134Cs from aqueous solution by zinc ferrocyanide, and the effect of experimental conditions on the adsorption were investigated. Preliminary results showed that zinc ferrecyanide was very efficient as an absorbent. Over 98% of 134Cs could be removed by zinc ferrocyanide of 0.33 g.L-1 from 134Cs solution (Co) of one hour and the suitable pH ranged 1~10. No significant differences on 134Cs adsorption were observed at 0~50℃, or in solutions containing Ca2+, Fe3+, Mg2+, HCO3-, CO32-, CI- and SO42-, even though they are 1000 times higher than the anions or cations in groundwater. However, the adsorption rates decreased when solutions contained K+ or Na+. The adsorption process could be described by Freundlich and Langmuir adsorption equations.

  20. Efficient removal of cesium from low-level radioactive liquid waste using natural and impregnated zeolite minerals

    International Nuclear Information System (INIS)

    The objective of the proposed work was focused to provide promising solid-phase materials that combine relatively inexpensive and high removal capacity of some radionuclides from low-level radioactive liquid waste (LLRLW). Four various zeolite minerals including natural clinoptilolite (NaNCl), natural chabazite (NaNCh), natural mordenite (NaNM) and synthetic mordenite (NaSM) were investigated. The effective key parameters on the sorption behavior of cesium (Cs-134) were investigated using batch equilibrium technique with respect to the waste solution pH, contacting time, potassium ion concentration, waste solution volume/sorbent weight ratio and Cs ion concentration. The obtained results revealed that natural chabazite (NaNCh) has the higher distribution coefficients and capacity towards Cs ion rather than the other investigated zeolite materials. Furthermore, novel impregnated zeolite material (ISM) was prepared by loading Calix [4] arene bis(-2,3 naphtho-crown-6) onto synthetic mordenite to combine the high removal uptake of the mordenite with the high selectivity of Calix [4] arene towards Cs radionuclide. Comparing the obtained results for both NaSM and the impregnated synthetic mordenite (ISM-25), it could be observed that the impregnation process leads to high improvement in the distribution coefficients of Cs+ ion (from 0.52 to 27.63 L/g). The final objective in all cases was aimed at determining feasible and economically reliable solution to the management of LLRLW specifically for the problems related to the low decontamination factor and the effective recovery of monovalent cesium ion.

  1. Cesium-137, a drama recounted; Cesio-137, um drama recontado

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar

    2013-01-15

    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  2. Trapping and cooling cesium atoms in a speckle field

    International Nuclear Information System (INIS)

    We present the results of two experiments where cold cesium atoms are trapped in a speckle field. In the first experiment, a YAG laser creates the speckle pattern and induces a far-detuned dipole potential which is a nearly-conservative potential. Localization of atoms near the intensity maxima of the speckle field is observed. In a second experiment we use two counterpropagating laser beams tuned close to a resonance line of cesium and in the lin perpendicular to lin configuration, one of them being modulated by a holographic diffuser that creates the speckle field. Three-dimensional cooling is observed. Variations of the temperature and of the spatial diffusion coefficient with the size of a speckle grain are presented. (orig.)

  3. Kelvin Probe Studies of Cesium Telluride Photocathode for AWA Photoinjector

    CERN Document Server

    Wisniewski, Eric; Yusof, Zikri; Spentzouris, Linda; Terry, Jeff; Harkay, Katherine

    2012-01-01

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (~50 nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin Probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating.

  4. Cesium exchange reaction on natural and modified clinoptilolite zeolites

    International Nuclear Information System (INIS)

    Cesium cation exchange reaction with K, Na, Ca and Mg ions on natural and modified clinoptilolite has been studied. Batch cation-exchange experiments were performed by placing 0.5 g of clinoptilolite into 10 ml or 20 ml of 1 x 10-3M CsCl solution for differing times. Two type deposits of clinoptilolite zeolites from, Nizny Hrabovec (NH), Slovakia and Metaxades (MX), Greece were used for ion-exchange study. The distribution coefficient (Kd) and sorption capacity (Γ) were evaluated. For the determination of K, Na, Ca and Mg isotachophoresis method, the most common cations in exchange reaction was used. Cesium sorption was studied using 137Cs tracer and measured by γ-spectrometry. (author)

  5. Spectrally selective optical pumping in Doppler-broadened cesium atoms

    International Nuclear Information System (INIS)

    The D1 line spectrally selective pumping process in Doppler-broadened cesium is analyzed by solving the optical Bloch equations. The process, described by a three-level model with the Λ scheme, shows that the saturation intensity of broadened atoms is three orders of magnitude larger than that of resting atoms. The |Fg = 3> → |Fe = 4> resonance pumping can result in the ground state |Fg = 4, mF = 4> sublevel having a maximum population of 0.157 and the population difference would be about 0.01 in two adjacent magnetic sublevels of the hyperfine (HF) state Fg = 4. To enhance the anisotropy in the ground state, we suggest employing dichromatic optical HF pumping by adding a laser to excite D1 line |Fg = 4> → |Fe = 3> transition, in which the cesium magnetometer sensitivity increases by half a magnitude and is unaffected by the nonlinear Zeeman effect even in Earth's average magnetic field. (atomic and molecular physics)

  6. Fiber laser system for cesium and rubidium atom interferometry

    CERN Document Server

    Diboune, Clément; Bidel, Yannick; Cadoret, Malo; Bresson, Alexandre

    2016-01-01

    We present an innovative fiber laser system for both cesium and rubidium manipulation. The architecture is based on frequency conversion of two lasers at 1560 nm and 1878 nm. By taking advantage of existing fiber components at these wavelengths, we demonstrate an all fiber laser system delivering 350 mW at 780 nm for rubidium and 210 mW at 852 nm for cesium. This result highlights the promising nature of such laser system especially for Cs manipulation for which no fiber laser system has been reported. It offers new perspectives for the development of atomic instruments dedicated to onboard applications and opens the way to a new generation of atom interferometers involving three atomic species $^{85}$Rb, $^{87}$Rb and $^{133}$Cs for which we propose an original laser architecture.

  7. Studies on the Separation of Cesium From Fission Products

    Institute of Scientific and Technical Information of China (English)

    QIANLi-juan; ZHANGSheng-dong; GUOJing-ru; CUIAn-zhi; YANGLei; WUWang-suo

    2003-01-01

    135Cs is a long-life fission product. When measuring its thermal cross section, we must separate radiochemical purity cesium from fission products. Except for decontaminating radio- nuclides, others which can be activated must be avoided to come into solution. So ion exchanger is used. Inorganic ion exchangers have received increased attention because of their high resistance to radiation and their very efficient separation of alkali metal ions.

  8. Optimized production of a cesium Bose-Einstein condensate

    OpenAIRE

    Kraemer, Tobias; Herbig, Jens; Mark, Michael; Weber, Tino; Chin, Cheng; Naegerl, Hanns-Christoph; Grimm, Rudolf

    2004-01-01

    We report on the optimized production of a Bose-Einstein condensate of cesium atoms using an optical trapping approach. Based on an improved trap loading and evaporation scheme we obtain more than $10^5$ atoms in the condensed phase. To test the tunability of the interaction in the condensate we study the expansion of the condensate as a function of scattering length. We further excite strong oscillations of the trapped condensate by rapidly varying the interaction strength.

  9. Electrically switched cesium ion exchange. FY 1997 annual report

    International Nuclear Information System (INIS)

    This paper describes the Electrically Switched Ion Exchange (ESIX) separation technology being developed as an alternative to ion exchange for removing radionuclides from high-level waste. Progress in FY 1997 for specific applications of ESIX is also outlined. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution can be controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. Based on the ferrocyanide film capacity, stability, rate of uptake, and selectivity shown during performance testing, it appears possible to retain a consistent rate of removal and elute cesium into the same elution solution over several load/unload cycles. In batch experiments, metal hexacyanoferrate films showed high selectivities for cesium in concentrated sodium solutions. Cesium uptake was unaffected by Na/Cs molar ratios of up to 2 x 104 , and reached equilibrium within 18 hours. During engineering design tests using 60 pores per inch, high surface area nickel electrodes, nickel ferrocyanide films displayed continued durability. losing less than 20% of their capacity after 1500 load/unload cycles. Bench-scale flow system studies showed no change in capacity or performance of the ESIX films at a flow rate up to 13 BV/h, the maximum flow rate tested, and breakthrough curves further supported once-through waste processing. 9 refs., 24 figs

  10. Corrections to our results for optical nanofiber traps in Cesium

    CERN Document Server

    Ding, D; Choi, K S; Kimble, H J

    2012-01-01

    Several errors in Refs. [1, 2] are corrected related to the optical trapping potentials for a state-insensitive, compensated nanofiber trap for the D2 transition of atomic Cesium. Section I corrects our basic formalism in Ref. [1] for calculating dipole-force potentials. Section II corrects erroneous values for a partial lifetime and a transition wavelength in Ref. [1]. Sections III and IV present corrected figures for various trapping configurations considered in Refs. [1] and [2], respectively.

  11. Test procedures and instructions for Hanford complexant concentrate supernatant cesium removal using CST

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W.

    1997-01-08

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Complexant Concentrate supernatant liquor from tank 241-AN-107, in a bench-scale column. The cesium sorbent to be tested is crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-023, Hanford Complexant Concentrate Supernatant Cesium Removal Test Plan.

  12. Test procedures and instructions for Hanford tank waste supernatant cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W., Westinghouse Hanford

    1996-05-31

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test using Hanford Double-Shell Slurry Feed supernatant liquor from tank 251-AW-101 in a bench-scale column.Cesium sorbents to be tested include resorcinol-formaldehyde resin and crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-022, Hanford Tank Waste Supernatant Cesium Removal Test Plan.

  13. MODELING RESULTS FROM CESIUM ION EXCHANGE PROCESSING WITH SPHERICAL RESINS

    Energy Technology Data Exchange (ETDEWEB)

    Nash, C.; Hang, T.; Aleman, S.

    2011-01-03

    Ion exchange modeling was conducted at the Savannah River National Laboratory to compare the performance of two organic resins in support of Small Column Ion Exchange (SCIX). In-tank ion exchange (IX) columns are being considered for cesium removal at Hanford and the Savannah River Site (SRS). The spherical forms of resorcinol formaldehyde ion exchange resin (sRF) as well as a hypothetical spherical SuperLig{reg_sign} 644 (SL644) are evaluated for decontamination of dissolved saltcake wastes (supernates). Both SuperLig{reg_sign} and resorcinol formaldehyde resin beds can exhibit hydraulic problems in their granular (nonspherical) forms. SRS waste is generally lower in potassium and organic components than Hanford waste. Using VERSE-LC Version 7.8 along with the cesium Freundlich/Langmuir isotherms to simulate the waste decontamination in ion exchange columns, spherical SL644 was found to reduce column cycling by 50% for high-potassium supernates, but sRF performed equally well for the lowest-potassium feeds. Reduced cycling results in reduction of nitric acid (resin elution) and sodium addition (resin regeneration), therefore, significantly reducing life-cycle operational costs. These findings motivate the development of a spherical form of SL644. This work demonstrates the versatility of the ion exchange modeling to study the effects of resin characteristics on processing cycles, rates, and cold chemical consumption. The value of a resin with increased selectivity for cesium over potassium can be assessed for further development.

  14. Radiogenotoxicological effect of signal nuclide 134Cs on somatic and germ cells

    Institute of Scientific and Technical Information of China (English)

    ZhuShou-Peng; XiaFen; 等

    1997-01-01

    Chromosome at aberation rates in bone marrow cells and micronucleus formation in bone marrow polychromatic erythrocytes both rise with increase in radioactivities of 134Cs,and can be fitted to power functions of radioactivities of 134Cs.In spermatogonia 134Cs mainly induced chromatid breakage,and abnormalities in sperm can also be experessed as power functions of radioactivities of 134 Cs.

  15. Cesium Toxicity Alters MicroRNA Processing and AGO1 Expressions in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Il Lae Jung

    Full Text Available MicroRNAs (miRNAs are short RNA fragments that play important roles in controlled gene silencing, thus regulating many biological processes in plants. Recent studies have indicated that plants modulate miRNAs to sustain their survival in response to a variety of environmental stimuli, such as biotic stresses, cold, drought, nutritional starvation, and toxic heavy metals. Cesium and radio-cesium contaminations have arisen as serious problems that both impede plant growth and enter the food chain through contaminated plants. Many studies have been performed to define plant responses against cesium intoxication. However, the complete profile of miRNAs in plants during cesium intoxication has not been established. Here we show the differential expression of the miRNAs that are mostly down-regulated during cesium intoxication. Furthermore, we found that cesium toxicity disrupts both the processing of pri-miRNAs and AGONOUTE 1 (AGO1-mediated gene silencing. AGO 1 seems to be especially destabilized by cesium toxicity, possibly through a proteolytic regulatory pathway. Our study presents a comprehensive profile of cesium-responsive miRNAs, which is distinct from that of potassium, and suggests two possible mechanisms underlying the cesium toxicity on miRNA metabolism.

  16. Laboratory plant for the separation of cesium from waste solutions of the PUREX process

    International Nuclear Information System (INIS)

    A laboratory plant for the separation of cesium from a fission product waste solution of the fuel reprocessing is described. The plant consists of two stages. In the first stage cesium is adsorbed on ammonium molybdatophosphate (AMP). Then the adsorbent is dissolved. From the solution cesium is adsorbed on a cationic ion exchanger in the second stage. Then AMP can be reproduced from this solution. For the elution of cesium in the second stage a NH4NO3 solution (3 m) is used. Flow sheet, construction and the control device of the plant are described and the results of tests with a model solution are given. (author)

  17. Structure of cesium loaded iron phosphate glasses: An infrared and Raman spectroscopy study

    International Nuclear Information System (INIS)

    The structure of cesium loaded iron phosphate glasses (IPG) was investigated using infrared and Raman spectroscopy. The spectra of the cesium doped samples revealed a structural modification of the parent glass owing to the incorporation of cesium. The structural changes could be correlated with the variation observed in the glass transition temperature of these glasses. Increased Cs-mediated cationic cross linking appears to be the reason for the initial rise in glass transition temperature up to 21 mol% Cs2O in IPG; while, breakdown of the phosphate network with increasing cesium content, brings down the glass transition temperature.

  18. Mobility of cesium through the Callovo-Oxfordian claystones under partially saturated conditions

    International Nuclear Information System (INIS)

    The diffusion of cesium was studied in an unsaturated core of Callovo-Oxfordian claystone, which is a potential host rock for retrievable disposal of high-level radioactive wastes. In-diffusion laboratory experiments were performed on rock samples with water saturation degrees ranging from 81% to 100%. The analysis of both cesium concentration monitoring in the source reservoir and postmortem cesium rock concentration profile of the samples was carried out using a chemical-transport code where the sorption of cesium was described by a multi-site ion-exchange model. The results showed that cesium exhibited a clear trend related to the saturation degree of the sample. The more dehydrated the rock sample, the slower the decrease of cesium concentration, and the thinner the penetration depth of cesium was. The effective diffusion coefficient (De) for cesium decreased from 18.5 *10-11 m2 s-1 at full-saturation to 0.3 * 10-11 m2 s-1 for the more dehydrated sample. This decrease is almost 1 order of magnitude higher than that for tritiated water (HTO), although a similar behavior could have been expected, since cesium is known to diffuse in the same parts of the pore space as HTO in fully saturated claystones. (authors)

  19. Cesium transport in Four Mile Creek of the Savannah River Plant

    International Nuclear Information System (INIS)

    The behavior of a large radioactive cesium release to a Savannah River Plant (SRP) stream was examined using a stable cesium release to Four Mile Creek. Measurements following the release show that most of the cesium released was transported downstream; however, sorption and desorption decreased the maximum concentration and increased the travel time and duration, relative to a dye tracer, at sampling stations downstream. The study was made possible by the development of an analytical technique using ammonium molybdophosphate and neutron activation that permitted the measurement of stable cesium concentrations as low as 0.2 μg/L

  20. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    OpenAIRE

    Houssni El-Saied; Samya El-Sherbiny; Omnia Ali; Wafaa El-Saied; Said Rohyem

    2013-01-01

    In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+) on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the...

  1. Experimental Study on Vapor Pressure of HFC—134a

    Institute of Scientific and Technical Information of China (English)

    Ming-ShanZhu; Yi-DongFu; 等

    1992-01-01

    As part of the study on thermophysical properties of HFC-134a,this paper concerns itself with vapor pressure of HFC-134a in the temperature range of 279.15K to 365.15K,A total of 43 measurement data were measured during the experiment which was conducted on a high precision pVTx test apparatus designed by the authors with slight modifications,Uncertainties of temperature was ±10mK and of pressure was±500Pa,purity of sample was either 99.95wt%,or 99.98wt%,Data resulting from this experiment matched closely with the newest data published internationalyy,Compared to our porposed equation for calculating vapor pressure of HFC-134a,the RMS deviation cfexperimental data was only 0.0531%,showing relatively high precision.

  2. Transverse wobbling motion in $^{134}$Ce and $^{136}$Nd

    CERN Document Server

    Petrache, C M

    2016-01-01

    The existence of one-phonon and possible two-phonon transverse wobbling bands is proposed for the first time in two even-even nuclei, $^{134}$Ce and $^{136}$Nd. The predominant $E2$ character of the $\\Delta I = 1$ transitions connecting the one-phonon wobbling band in $^{134}$Ce to the two-quasiparticle yrast band supports the wobbling interpretation. The extracted wobbling frequencies decrease with increasing spin, indicating the transverse character of the wobbling motion, with the angular momenta of the two quasiparticles aligned perpendicular to the axis of collective rotation. A candidate for two-phonon wobbling motion is also proposed in $^{136}$Nd. The wobbling frequencies calculated in the harmonic frozen approximation are in good agreement with the experimental ones for both the$^{134}$Ce and $^{136}$Nd nuclei.

  3. Radium-based estimates of cesium isotope transport and total direct ocean discharges from the Fukushima Nuclear Power Plant accident

    Directory of Open Access Journals (Sweden)

    M. A. Charette

    2012-11-01

    Full Text Available Radium has four naturally occurring isotopes that have proven useful in constraining water mass source, age, and mixing rates in the coastal and open ocean. In this study, we used radium isotopes to determine the fate and flux of runoff-derived cesium from the Fukushima Nuclear Power Plant (NPP. During a June 2011 cruise, the highest Cs concentrations were found along the eastern shelf of northern Japan, from Fukushima south, to the edge of the Kuroshio current, and in an eddy ∼ 130 km from the NPP site. Locations with the highest cesium also had some of the highest radium activities, suggesting much of the direct ocean discharges of Cs remained in the coastal zone 2–3 months after the accident. We used a short-lived Ra isotope (223Ra, t1/2 = 11.4 d to derive an average water mass age (Tr in the coastal zone of 32 days. To ground-truth the Ra age model, we conducted a direct, station-by-station comparison of water mass ages with a numerical oceanographic model and found them to be in excellent agreement (model avg. Tr = 27 days. From these independent Tr values and the inventory of Cs within the water column at the time of our cruise, we were able to calculate an offshore 134Cs flux of 3.9–4.6 × 1013 Bq d−1. Radium-228 (t1/2 = 5.75 yr was used to derive a vertical eddy diffusivity (Kz of 0.7 m2 d−1 (0.1 cm2 s−1; from this Kz and 134Cs inventory, we estimated a 134Cs flux across the pycnocline of 1.8 × 104 Bq d−1 for the same time period. On average, our results show that horizontal mixing loss of Cs from the coastal zone was ∼ 109 greater than vertical exchange below the surface mixed layer. Finally, a mixing/dilution model that utilized our Ra-based and

  4. 1,3,4-Thiadiazole Based Anticancer Agents.

    Science.gov (United States)

    Aliabadi, Alireza

    2016-01-01

    In recent years, researchers like medicinal chemists in the field of medicinal chemistry have widely utilized the 1,3,4-thiadiazole nucleus to investigate its biological and pharmacological effects. This heterocyclic structure has demonstrated various bioactivities such as antifungal, antimicrobial, antiviral, antileishmanial, anti-inflammatory, antihypertensive, antiepileptic, and anticancer effects among others. Anticancer activity is one of its promising effect as five membered heterocyclic rings have widely been investigated by researchers in the recent years. Herein, we reviewed the chemical structures bearing 1,3,4-thiadiazole template exerting anticancer activity. PMID:27484056

  5. Gas phase production of NHD2 in L134N

    CERN Document Server

    Rodgers, S D

    2001-01-01

    We show analytically that large abundances of NH2D and NHD2 can be produced by gas phase chemistry in the interiors of cold dense clouds. The calculated fractionation ratios are in good agreement with the values that have been previously determined in L134N and suggest that triply-deuterated ammonia could be detectable in dark clouds. Grain surface reactions may lead to similar NH2D and NHD2 enhancements but, we argue, are unlikely to contribute to the deuteration observed in L134N.

  6. Determination of distribution coefficients for 134 Cs, 60 Co and 234 Th radionuclides in Pinheiro river sediment

    International Nuclear Information System (INIS)

    The distribution coefficients (K α) were determined in order to foresee the fate of the radionuclides discharged to the environment. Based upon the source-term released by IPEN's facilities in Pinheiros River during the year of 1988, three radionuclides were chosen as being the more critical, according to the radiation protection standards: 137 Cs, 60 Co and 232 Th. Their K α were determined experimentally in laboratory by using the corresponding radioactive tracers 134 Cs, 60 Co and 234 Th. Three different experimental methodologies were used: the static method, the shaken method and the dynamic method. The parameters studied were the effects of pH, aerobic condition and time of contact. The results obtained experimentally for the Kds confirm the predictions that: the cesium is slowly retained by the sediment along the Pinheiros River, the cobalt is an unstable element, therefore its retention by the sediment is affected by variations in the pH values, and finally, the thorium is almost completely retained in the vicinity of the discharge point. (author)

  7. 19 CFR 134.45 - Approved markings of country name.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.45... origin, unless another marking to indicate the English name of the country of origin is specifically... the country of origin shall be published in the Federal Register and the Customs Bulletin. (2) A...

  8. 38 CFR 21.134 - Limitation on flight training.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Limitation on flight.... Chapter 31 Educational and Vocational Training Services § 21.134 Limitation on flight training. Flight... that include required flight training. This type of training is otherwise subject to the...

  9. 12 CFR 13.4 - Recommendations to customers.

    Science.gov (United States)

    2010-01-01

    ... PRACTICES § 13.4 Recommendations to customers. In recommending to a customer the purchase, sale or exchange... reasonable grounds for believing that the recommendation is suitable for the customer upon the basis of the facts, if any, disclosed by the customer as to the customer's other security holdings and as to...

  10. HFC-134a Export Expansion in Great Urgency

    Institute of Scientific and Technical Information of China (English)

    Zhang Lizhe

    2007-01-01

    @@ 1,1,1,2-tetrafluoroethane (HFC- 134a) is a new refrigerant. It has the features of no toxicity, no odor, no color, no inflammability, no explosion, good thermal stability and stable chemical property. Its ODP (ozone depletion potential) is zero. It has a refrigerating ability similar to F12.

  11. Measurement Limits to $^{134}$Cs Concentration in Soil

    CERN Document Server

    Ahn, J K; Lee, H M; Kim, T H; Park, J N; Kang, Y S; Lee, H S; Kim, S J; Park, J Y; Ryu, S Y; Kim, H Ch; Kang, W G; Kim, S K

    2009-01-01

    We investigate the caesium concentrations in soils in mountain areas near Gori nuclear power plant in Korea, focusing on the measurement limits to the $^{134}\\mathrm{Cs}$. In order to lower the minimum detectable amount (MDA) of activity for the $134}\\mathrm{Cs}$, we have used the ammonium molybdophosphase (AMP) precipitation method to get rid of the $^{40}$K existing in natural radioactivity, which reduces the MDA of activity about ten times smaller than those without the AMP precipitation method. The MDA results for the $^{134}\\mathrm{Cs}$ were found to be in the range between 0.015 and 0.044 Bq/kg-dry weight. In order to diminish the background, we also have measured a part of the soil samples in Yangyang, a small town in the east coast of Korea. However, it turns out that in order to detect the $^{134}\\mathrm{Cs}$ in the samples the MDA should be reduced to the level of mBq/kg-dry weight.

  12. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    International Nuclear Information System (INIS)

    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 ± 15 Bq.m-2 for South region to 15 ± 2 Bq.m-2 for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  13. Peculiarities of presence of cesium-137 in soil at Azgir test site grounds

    International Nuclear Information System (INIS)

    The granulometric composition of soil and the distribution of cesium-137 by soil fractions at the Azgir test site was determined. The characterization of cesium-137 presence in the layer of the thickness of 1 cm of the surface soil was gave. (author)

  14. Velocity Distribution of Effective Atoms in a Small Optically Pumped Cesium Beam Frequency Standard

    Institute of Scientific and Technical Information of China (English)

    CHEN Jingbiao; WANG Fengzhi; YANG Donghai; WANG YiQiu

    2001-01-01

    In this paper, the velocity distribution of effective atoms in a small optically pumped cesium beam frequency standard has been achieved from the Fourier transforms of the experimentally recorded Ramsey patterns. The result fits well with the theoretical calculation. The second order Doppler shift correction of the small cesium atomic clock is obtained from the velocity distribution of effective atoms.

  15. Vacuum squeezed light for atomic memories at the D2 cesium line

    CERN Document Server

    Burks, Sidney; Giacobino, Elisabeth; Laurat, Julien; Ortalo, Jérémie; Jia, Xiaojun; Villa, Fabrizio; Chuimmo, Antonino

    2008-01-01

    We report the experimental generation of squeezed light at 852 nm, locked on the Cesium D2 line. 50% of noise reduction down to 50 kHz has been obtained with a doubly resonant optical parametric oscillator operating below threshold, using a periodically-polled KTP crystal. This light is directly utilizable with Cesium atomic ensembles for quantum networking applications

  16. Ionizing mechanisms in a cesium plasma irradiated with a ruby laser

    Science.gov (United States)

    Shimada, K.; Robinson, L. B.

    1975-01-01

    A cesium filled diode--laser plasmadynamic converter was built to investigate the feasibility of converting laser energy to electrical energy at large power levels. Experiments were performed with a pulsed ruby laser to determine the quantity of electrons and cesium ions generated per pulse of laser beam and to determine the output voltage. A current density as high as 200 amp/sq cm from a spot of approximately 1 sq mm area and an open circuit voltage as high as 1.5 volts were recorded. A qualitative theory was developed to explain these results. In the operation of the device, the laser beam evaporates some of the cesium and ionizes the cesium gas. A dense cesium plasma is formed to absorb further the laser energy. Results suggest that the simultaneous absorption of two ruby laser photons by the cesium atoms plays an important role in the initial ionization of cesium. Inverse bremsstrahlung absorption appears to be the dominant mechanism in subsequent processes. Recombinations of electrons and cesium ions appear to compete favorably with the simultaneous absorption of two photons.

  17. Sorption of iodine, chlorine, technetium and cesium in soil

    International Nuclear Information System (INIS)

    The safety assessment of final disposal of spent nuclear fuel will include an estimate for the behavior of waste nuclides in the biosphere. As a part of this estimate also the sorption of radioactive iodine, chlorine, technetium and cesium in soil is to be considered. The chemistry and the sorption of these radionuclides in soils are described in this literature survey. Behavior of I-129, Cl-36 and Tc-99 in the environment is of great interest because of their long half-lives and relatively high mobilities. The importance of Cs-135 arises from its high content in spent nuclear fuel and long physical half-life, even though it is considered relatively immobile in soil. Factors affecting the migration and sorption of radionuclides in soils can be divided into elemental and soil specific parameters. The most important elemental factor is the speciation of the element, which is influenced by the soil redox potential, pH and complex forming ligands. Soil micro-organisms can either serve as sorbents for radionuclides or affect their speciation by altering the prevailing soil redox conditions. Soil organic matter content and mineral properties have a marked influence on the retention of radionuclides. The sorption of anionic radionuclides such as I-, Cl- and TcO4 - is pronounced in the presence of organic matter. Clay minerals are known to bound cesium effectively. The effect of speciation of radioactive iodine, chlorine, technetium and cesium in soil is considered in this study, as well as the effect of soil micro-organisms, organic matter and mineral properties. (orig.)

  18. Cesium-137 inventory of the undisturbed soil areas in the Londrina Region, Parana, Brazil

    International Nuclear Information System (INIS)

    Cesium-137 is an artificial radionuclide introduced in the environment through the radioactive fallout of the superficial tests of nuclear weapons. The cesium-137 deposition occurred to middles of the 1980-decade and, due to the Chernobyl accident, great part of Europe had a additional fallout of cesium-137. The contaminations of this accident do not have reached Southern Hemisphere. Cesium-137 is an alkaline metal, high electropositive, that in contact with the soil is strongly adsorbed to the clay in the FES (Frayed Edge Sites) and RES (Regular Edge Sites) positions, and it movement by chemical processes in the soil is insignificant. Because of this, cesium-137 became a good soil marker, and its movement is related to the soil movement particles, so that the cesium-137 have been used in the study of the soil redistribution processes, as a tool of quantifying the rates of soil losses and gain. To use this methodology, it is necessary the knowledge of the reference inventory of cesium-137, that is given as function of the total concentration of cesium-137 deposited in an area by the radioactive fallout. If a sampling point presents less cesium-137 than the reference inventory, this point is considered a point with soil loss; otherwise, the point is considered a point with soil deposition. To evaluate the cesium-137 inventory in the Londrina region, four areas of the undisturbed soil were sampling in grid of 3x3, with a distance of 9 meters among the points. Of these four sampling areas, three areas were of native forest (labeled Mata1, Mata2 and Mata UEL), and one was a pasture area. Cesium-137 inventory was 223 ± 41 Bq m-2, 240 ± 65 Bq m-2 and 305 ± 36 Bq m-2 for Mata UEL, Mata1 and Mata2, respectively, and of 211 ± 28 Bq m-2 for the native pasture. Considering the deviation in each value, it is not possible to conclude that there are differences among the values of cesium-137 inventory, so that the average reference inventory of cesium-137 for the Londrina

  19. Rational Design of Cesium-Selective Ionophores and Chemosensors: Dihydrocalix[4]arene Crown-6 Ethers

    Energy Technology Data Exchange (ETDEWEB)

    Sachleben, Richard A.; Bryan, Jeffrey C.; Brown, Gilbert M.; Engle, Nancy L.; Haverlock, Tamara J.; Hay, Benjamin P.; Urvoas, Agathe; Moyer, Bruce A.

    2003-12-15

    Molecular mechanics calculations performed on calix[4]arene crown-6 ethers predict that the 1,3-dihydro derivatives will exhibit greater complementarity for potassium and cesium ions than the parent 1,3-dialkoxy calix crowns. The X-ray crystal structures of 1,3-alt bis-octyloxycalix[4]arene benzocrown-6 ether, dihydrocalix[4]arene benzocrown-6 ether, and the cesium nitrate complex of dihydrocalix[4]arene benzocrown-6 ether were determined. The cesium complex structure corresponds closely to the structure predicted by molecular mechanics. The dihydrocalix[4]arene crown-6 ethers exhibit enhanced cesium selectivity in the extraction of alkali metal salts and provide a platform for a highly sensitive and selective cesium chemosensor.

  20. [Variation in amount of radioactive cesium before and after cooking dry shiitake and beef].

    Science.gov (United States)

    Nabeshi, Hiromi; Tsutsumi, Tomoaki; Hachisuka, Akiko; Matsuda, Rieko

    2013-01-01

    We investigated the change of radioactive cesium content in food due to cooking in order to estimate the internal radiation exposure due to from radioactive materials in food. Our results revealed that soaking dry shiitake in water decreased the radioactive cesium content by about 50%, compared with that present in uncooked shiitake. Radioactive cesium in beef was decreased by about 10%, 12%, 60-65% and 80% by grilling, frying, boiling and stewing, respectively, compared to uncooked beef. For cooked beef, the decrease in the ratio of radioactive cesium was significantly different among the types of cooking. The decrease ratio of radioactive cesium in boiled and stewed beef was 8 times higher than that in grilled and fried beef.

  1. Sensitive Detection of Cold Cesium Molecules by Radiative Feshbach Spectroscopy

    OpenAIRE

    Chin, Cheng; Kerman, Andrew J.; Vuletić, Vladan; Chu, Steven

    2002-01-01

    We observe the dynamic formation of $Cs_2$ molecules near Feshbach resonances in a cold sample of atomic cesium using an external probe beam. This method is 300 times more sensitive than previous atomic collision rate methods, and allows us to detect more than 20 weakly-coupled molecular states, with collisional formation cross sections as small as $\\sigma =3\\times 10^{-16}$cm$^2$. We propose a model to describe the atom-molecule coupling, and estimate that more than $2 \\times 10^5$ $Cs_2$ mo...

  2. Characterizing optical dipole trap via fluorescence of trapped cesium atoms

    Institute of Scientific and Technical Information of China (English)

    LIU; Tao; GENG; Tao; YAN; Shubin; LI; Gang; ZHANG; Jing; WANG; Junmin; PENG; Kunchi; ZHANG; Tiancai

    2006-01-01

    Optical dipole trap (ODT) is becoming an important tool of manipulating neutral atoms. In this paper ODT is realized with a far-off resonant laser beam strongly focused in the magneto-optical trap (MOT) of cesium atoms. The light shift is measured by simply monitoring the fluorescence of the atoms in the magneto-optical trap and the optical dipole trap simultaneously. The advantages of our experimental scheme are discussed, and the effect of the beam waist and power on the potential of dipole trap as well as heating rate is analyzed.

  3. Determinants of Human CD134 Essential for Entry of Human Herpesvirus 6B

    OpenAIRE

    Tang, Huamin; Mori, Yasuko

    2015-01-01

    We identified two key amino acid residues within human CD134 (hCD134) that are required for its interaction with human herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to hCD134. Murine CD134 (mCD134) functioned as an HHV-6B receptor when these two amino acid residues were replaced with homologous human residues. This study identifies both the HHV-6B receptor-ligand interaction and the species-specific determinants of hCD134...

  4. Direct observation of 134Cs and 137Cs in surface seawater in the western and central North Pacific after the Fukushima Dai-ichi nuclear power plant accident

    Directory of Open Access Journals (Sweden)

    H. Kaeriyama

    2013-06-01

    Full Text Available The horizontal distribution of radioactive cesium (Cs derived from the Fukushima Dai-ichi nuclear power plant (FNPP in the North Pacific is still unclear due to the limitation of direct measurement of the seawater in the open ocean. We present the result of direct observation of radioactive Cs in surface seawater collected from a broad area in the western and central North Pacific in July 2011, October 2011 and July 2012. We also conducted a simple particle tracking experiment to estimate the qualitative spatial distribution of radioactive Cs in the North Pacific. 134Cs was detected at 94 stations out of 123 stations, and 137Cs was detected at all stations. High 134Cs and 137Cs concentrations more than 10 m Bq kg−1 were observed in the area of the northern part of Kuroshio Extension at 144° E and 155° E in July 2011, in the area 147–175° E around 40° N in October 2011, and the northern part of Kuroshio Extension at 155° E and 175°30´ E in July 2012. Combining the result of direct observations and particle tracking experiment, the radioactive Cs derived from the FNPP had been dispersed eastward to the central North Pacific during 2011. It was considered from the horizontal distribution that radioactive Cs was dispersed not only eastward but also north- and southward in the central North Pacific. Pronounced dilution process of radioactive Cs from the FNPP during study period is suggested from temporal change in the activity ratio of 134Cs / 137Cs, which was decay-corrected on 6 April 2011, and relationships between radioactive Cs and temperature.

  5. Morphological and electrical properties of zirconium vanadate doped with cesium

    Directory of Open Access Journals (Sweden)

    Marwa F. Elkady

    2014-09-01

    Full Text Available Cesium doped zirconium vanadate ZrV2O7 with different Cs dopant content (Cs/Zr varied from 0 to 0.5 in weight ratio were fabricated by hydrothermal technique at 120 °C for 60 min. The synthesized materials are thermally treated using microwave technique. The structural and morphological properties of the synthesized materials and thermally treated samples were investigated using XRD and SEM respectively. It was evident that all synthesized specimens have cubic phase structural without any extra phase but after heat treatment Orthorhombic phase appear with doped samples. However, the morphological structure of the doped synthesized materials has transferred from nanoparticles into rods aspect with heat treatment for the different dopant ratio. Moreover, the electrical properties of both the synthesized and thermally treated materials are studied by AC impedance measurements. The results indicated that the ionic conductivity of Cs-doped ZrV2O7 materials decreased by increasing the dopant ratio while that thermally treated samples the ionic conductivity increase by increasing the dopant ratio. Finally, the concentration of cesium dopants is found to play crucial role in tuning the morphology and electrical properties of nanostructures.

  6. Transportable cesium irradiator (TPCI): Final safety analysis report: Revision 1

    International Nuclear Information System (INIS)

    This Final Safety Analysis Report describes the Transportable Cesium Irradiator (TPCI) and assesses the hazards associated with its operation. The TPCI consists of a mobile, lead-shielded, irradiation unit with support equipment mounted within an enclosed trailer. The irradiation unit has two basic compartments; a source chamber sized to mate with the transportation cask which houses the source capsules, and an irradiation chamber formed as a large shielded cylinder (drum) with a window. The irradiation chamber is mounted on a large diameter support bearing. As this chamber is rotated its window moves from the product access door, where produce is inserted or extracted, to a position in line with a similar window in the source chamber. When the windows are aligned the produce is irradiated, while the back wall of the irradiation chamber shields the product access door. The TPCI is designed to be transported throughout the continental United States. The transportation cask containing the cesium source capsules is transported separately from the irradiation unit and is installed when the TPCI unit has been readied for operation at a particular site. The transportation cask is a separate unit and is documented in a separate FSAR

  7. Kelvin probe studies of cesium telluride photocathode for AWA photoinjector

    Energy Technology Data Exchange (ETDEWEB)

    Wisniewski, Eric E., E-mail: ewisniew@anl.gov [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Velazquez, Daniel [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Yusof, Zikri, E-mail: zyusof@hawk.iit.edu [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Spentzouris, Linda; Terry, Jeff [Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Sarkar, Tapash J. [Rice University, 6100 Main, Houston, TX 77005 (United States); Harkay, Katherine [Accelerator Science Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States)

    2013-05-21

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (≈50nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating. -- Highlights: ► The correlation between Quantum Efficiency (QE) and work function. ► How QE and work function evolve together. ► Rejuvenation of the photocathode via heating and the effect on work function. ► The effects on the work function due to exposure to UV light.

  8. Structure and bonding in crystalline cesium uranyl tetrachloride under pressure.

    Science.gov (United States)

    Osman, Hussien H; Pertierra, Pilar; Salvadó, Miguel A; Izquierdo-Ruiz, F; Recio, J M

    2016-07-21

    A thorough investigation of pressure effects on the structural properties of crystalline cesium uranyl chloride was performed by means of first-principles calculations within the density functional theory framework. Total energies, equilibrium geometries and vibrational frequencies were computed at selected pressures up to 50 GPa. Zero pressure results present good agreement with available experimental and theoretical data. Our calculated equation of state parameters reveal that Cs2UO2Cl4 is a high compressible material, similar to other ionic compounds with cesium cations, and displays a structural anisotropic behavior guided by the uranyl moiety. An unexpected variation of the U-O bond length, dUO, is detected as pressure is applied. It leads to a dUO-stretching frequency relationship that cannot be described by the traditional Badger's rule. Interestingly enough, it can be explained in terms of a change in the main factor controlling dUO. At low pressure, the charge transferred to the uranyl cation induces an increase of the bond length and a red shift of the stretching frequencies, whereas it is the mechanical effect of the applied pressure above 10 GPa that is the dominant factor that leads to a shortening of dUO and a blue shift of the stretching frequencies. PMID:27340008

  9. Spectrally selective optical pumping in Doppler-broadened cesium atoms

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun-Hai; Zeng Xian-Jin; Li Qing-Meng; Huang Qiang; Sun Wei-Min

    2013-01-01

    The D1 line spectrally selective pumping process in Doppler-broadened cesium is analyzed by solving the optical Bloch equations.The process,described by a three-level model with the A scheme,shows that the saturation intensity of broadened atoms is three orders of magnitude larger than that of resting atoms.The |Fg =3> → |Fe-4> resonance pumping can result in the ground state |Fg =4,mF =4> sublevel having a maximum population of 0.157 and the population difference would be about 0.01 in two adjacent magnetic sublevels of the hyperfine (HF) state Fg =4.To enhance the anisotropy in the ground state,we suggest employing dichromatic optical HF pumping by adding a laser to excite D1 line |Fg =4> → |Fe =3>transition,in which the cesium magnetometer sensitivity increases by half a magnitude and is unaffected by the nonlinear Zeeman effect even in Earth's average magnetic field.

  10. Structure and bonding in crystalline cesium uranyl tetrachloride under pressure.

    Science.gov (United States)

    Osman, Hussien H; Pertierra, Pilar; Salvadó, Miguel A; Izquierdo-Ruiz, F; Recio, J M

    2016-07-21

    A thorough investigation of pressure effects on the structural properties of crystalline cesium uranyl chloride was performed by means of first-principles calculations within the density functional theory framework. Total energies, equilibrium geometries and vibrational frequencies were computed at selected pressures up to 50 GPa. Zero pressure results present good agreement with available experimental and theoretical data. Our calculated equation of state parameters reveal that Cs2UO2Cl4 is a high compressible material, similar to other ionic compounds with cesium cations, and displays a structural anisotropic behavior guided by the uranyl moiety. An unexpected variation of the U-O bond length, dUO, is detected as pressure is applied. It leads to a dUO-stretching frequency relationship that cannot be described by the traditional Badger's rule. Interestingly enough, it can be explained in terms of a change in the main factor controlling dUO. At low pressure, the charge transferred to the uranyl cation induces an increase of the bond length and a red shift of the stretching frequencies, whereas it is the mechanical effect of the applied pressure above 10 GPa that is the dominant factor that leads to a shortening of dUO and a blue shift of the stretching frequencies.

  11. A study of strontium and cesium sorption on granite

    International Nuclear Information System (INIS)

    The diffusion and sorption of cesium and strontium in crushed granite particles is discussed. Sorption experiments have been performed with one granite from Finnsjoen outside Forsmark on the east coast of Sweden and one granite from the Stripa mine in central Sweden. Granite samples have been crushed and screened, and six different particle size fractions from 0.10-0.12 mm to 4-5 mm of each rock have been used in the experiments. The initial concentrations of inactive cesium and strontium were 10-15 ppm. The experimental data indicate that the amount of sorption is dependent not only on the mass of granite particles, but also to some extent on the size of the particles. An attempt has been made to distinguish between sorption on external surfaces and inner surfaces. The amount of external surface adsorption was found to vary from 15-40 % of the total adsorption capacity for the particle size fraction 0.10-0.12 mm to a few percent or less for the largest particles used. (Auth.)

  12. Diffusion of strontium, technetium, iodine and cesium in granitic rock

    International Nuclear Information System (INIS)

    The migration of strontium, technetium, iodine and cesium in granitic rock has been studied. Rock samples were taken from drilling cores in granitic and granodioritic rock, and small (2x2x2 cm) rock tablets from the drilling cores were exposed to a groundwater solution containing one of the studied elements at trace levels. The concentration of the element versus penetration depth in the rock tablet was measured radiometrically. The sorption on the mineral faces and the diffusion into the rock were studied by an autoradiographic technique. The cationic strontium and cesium have apparent diffusivities of 10-13 - 10-14 m2/s. The migration is confined to microfissures or filled fractures containing e.g., calcite, epidote or chlorite or in veins with high capacity minerals (e.g. biotite). The anionic iodine and technetium have apparent diffusivities of about 10-14 m2/s. These species migrate along mineral boundaries and in open fractures and to a minor extent in high capacity mineral veins. (orig.)

  13. Studies on cesium sorption in hydrous zirconium and titanium oxides

    International Nuclear Information System (INIS)

    Significant quantities of 137Cs (T1/2 = 30.1 y) and 90Sr (T1/2 = 28.5 y) are produced as fission products in nuclear reactors. These long-lived gamma-emitting radionuclides, regarded as a waste few decades ago, are being termed now as valuables owing to the upsurge in the utilization of these radioisotopes in the area of medicine, food irradiation, and sewage treatment technologies in recent years. For long-term waste management it is necessary to minimize the volume and toxicity of the waste. Selective recovery and utilization of these radionuclides from the waste is the concept of growing interest to many researchers. Inorganic sorbents are proven candidates for the separation and recovery of cesium and strontium from aqueous waste streams. They are chemically durable and stable against ionizing radiation. In addition, these materials can be converted into unleachable ceramic form for final disposal. Hydrous metal oxides belong to a particular class of inorganic ion exchangers extensively investigated for various applications in nuclear waste treatment. The present study deals with the preparation of hydrous zirconium and titanium oxide and the studies aimed at separation of cesium from aqueous wastes

  14. Innovative computational intelligence a rough guide to 134 clever algorithms

    CERN Document Server

    Xing, Bo

    2014-01-01

    The present book Innovative Computational Intelligence: A Rough Guide to 134 Clever Algorithms is compilation of recent trends in computational intelligence (CI) research using inspiration from various sources such as biology, physics, chemistry, and mathematics. Innovative CI, unlike its counterparts, i.e., highly developed and refined traditional CI, is a new CI category introduced in the present book. The major notable feature of this book is its innovation and comprehensiveness: 134 new paradigms of CI are covered and most of them are usually spread over a number of unrelated publishing directions. This book is useful to multidisciplinary students including such as aeronautic engineering, mechanical engineering, industrial engineering, electrical and electronic engineering, chemical engineering, computer science, applied mathematics, physics, economy, biology, and social science, particularly those pursuing postgraduate studies in advanced subjects. Moreover, the algorithms introduced in this book can mot...

  15. EXPERIMENTAL STUDY OF R-404A AND R-134A IN DOMESTIC REFRIGERATOR

    Directory of Open Access Journals (Sweden)

    ABHISHEK TIWARI

    2011-08-01

    Full Text Available This paper presents an experimental study of R404a and R134a, environment-friendly refrigerants with zero ozone depletion potential (ODP and low global warming potential (GWP, to replace R134a in domestic refrigerator. A refrigerator designed and developed to work with R134a was tested, and its performance using R-404a was evaluated and compared with its performance when R134a was used. The results obtained showed that the design temperature and pull-down time set by International Standard Organization (ISO for small refrigerator were achieved earlier using refrigerant R-404a than using R-134a. The system consumed less energy when R-134a was used. The performance of R-404a in the domestic refrigerator was constantly better than those of R134a throughout all the operating conditions, which shows that R-404a can be used as replacement for R134a in domestic refrigerator.

  16. Calibration of the SH134-20 Standard Gain Horn

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Breinbjerg, Olav

    This report documents the measurement of the linearly polarized SH134-20 Standard Gain Horn. The measurement comprises on-axis gain, on-axis polarization characteristics, and reflection coefficient at 111 frequencies in the frequency range from 22-33 GHz. The measurement was carried out at the DT......-ESA Spherical Near-Field Antenna Test Facility in December 2012 for SE Laboratories, Santa Clara, CA, USA....

  17. Equilibrium, kinetic and thermodynamic study of cesium adsorption onto nanocrystalline mordenite from high-salt solution.

    Science.gov (United States)

    Lee, Keun-Young; Park, Minsung; Kim, Jimin; Oh, Maengkyo; Lee, Eil-Hee; Kim, Kwang-Wook; Chung, Dong-Yong; Moon, Jei-Kwon

    2016-05-01

    In this study, the equilibrium, kinetics and thermodynamics of cesium adsorption by nanocrystalline mordenite were investigated under cesium contamination with high-salt solution, simulating the case of an operation and decommissioning of nuclear facilities or an accident during the processes. The adsorption rate constants were determined using a pseudo second-order kinetic model. The kinetic results strongly demonstrated that the cesium adsorption rate of nano mordenite is extremely fast, even in a high-salt solution, and much faster than that of micro mordenite. In the equilibrium study, the Langmuir isotherm model fit the cesium adsorption data of nano mordenite better than the Freundlich model, which suggests that cesium adsorption onto nano mordenite is a monolayer homogeneous adsorption process. The obtained thermodynamic parameters indicated that the adsorption involved a very stable chemical reaction. In particular, the combination of rapid particle dispersion and rapid cesium adsorption of the nano mordenite in the solution resulted in a rapid and effective process for cesium removal without stirring, which may offer great advantages for low energy consumption and simple operation. PMID:26683820

  18. Preliminary Evaluation of Cesium Distribution for Wet Sieving Process Planned for Soil Decontamination in Japan - 13104

    Energy Technology Data Exchange (ETDEWEB)

    Enokida, Y.; Tanada, Y.; Hirabayashi, D. [Graduate School of Engineering, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan); Sawada, K. [EcoTopia Science Institute, Nagoya University, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan)

    2013-07-01

    For the purpose of decontaminating radioactive cesium from a huge amount of soil, which has been estimated to be 1.2x10{sup 8} m{sup 3} by excavating to a 5-cm depth from the surface of Fukushima Prefecture where a severe nuclear accident occurred at TEPCO's power generating site and has emitted a significant amount of radioactive materials, mainly radioactive cesium, a wet sieving process was selected as one of effective methods available in Japan. Some private companies have demonstrated this process for soil treatment in the Fukushima area by testing at their plants. The results were very promising, and a full-fledged application is expected to follow. In the present study, we spiked several aqueous samples containing soil collected from an industrial wet sieving plant located near our university for the recycling of construction wastes with non-radioactive cesium hydroxide. The present study provides scientific data concerning the effectiveness in volume reduction of the contaminated soil by a wet sieving process as well as the cesium distribution between the liquid phase and clay minerals for each sub-process of the full-scale one, but a simulating plant equipped with a process of coagulating sedimentation and operational safety fundamentals for the plant. Especially for the latter aspect, the study showed that clay minerals of submicron size strongly bind a high content of cesium, which was only slightly removed by coagulation with natural sedimentation (1 G) nor centrifugal sedimentation (3,700 G) and some of the cesium may be transferred to the effluent or recycled water. By applying ultracentrifugation (257,000 G), most of submicron clay minerals containing cesium was removed, and the cesium amount which might be transferred to the effluent or recycled water, could be reduced to less than 2.3 % of the original design by the addition of a cesium barrier consisting of ultracentrifugation or a hollow fiber membrane. (authors)

  19. 19 CFR 134.36 - Inapplicability of marking exception for articles processed by importer.

    Science.gov (United States)

    2010-04-01

    ... processed by importer. 134.36 Section 134.36 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT... Requirements § 134.36 Inapplicability of marking exception for articles processed by importer. An article which is to be processed in the United States by the importer or for his account shall not be considered...

  20. 28 CFR 13.4 - Procedures: Responsibilities of the Attorney General.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Procedures: Responsibilities of the Attorney General. 13.4 Section 13.4 Judicial Administration DEPARTMENT OF JUSTICE ATOMIC WEAPONS AND SPECIAL NUCLEAR MATERIALS REWARDS REGULATIONS § 13.4 Procedures: Responsibilities of the Attorney General. When a submission is made to the Department...

  1. Factors affecting the sorption of cesium in a nutrient-poor boreal bog

    International Nuclear Information System (INIS)

    135Cs is among the most important radionuclides in the long-term safety assessments of spent nuclear fuel, due to its long half-life of 2.3 My and large inventory in spent nuclear fuel. Batch sorption experiments were conducted to evaluate the sorption behavior of radiocesium (134Cs) in the surface moss, peat, gyttja, and clay layers of 7-m-deep profiles taken from a nutrient-poor boreal bog. The batch distribution coefficient (Kd) values of radiocesium increased as a function of sampling depth. The highest Kd values, with a geometric mean of 3200 L/kg dry weight (DW), were observed in the bottom clay layer and the lowest in the 0.5–1.0 m peat layer (50 L/kg DW). The maximum sorption in all studied layers was observed at a pH between 7 and 9.5. The in situ Kd values of 133Cs in surface Sphagnum moss, peat and gyttja samples were one order of magnitude higher than the Kd values obtained using the batch method. The highest in situ Kd values (9040 L/kg DW) were recorded for the surface moss layer. The sterilization of fresh surface moss, peat, gyttja and clay samples decreased the sorption of radiocesium by 38%, although the difference was not statistically significant. However, bacteria belonging to the genera Pseudomonas, Paenibacillus, Rhodococcus and Burkholderia isolated from the bog were found to remove radiocesium from the solution under laboratory conditions. The highest biosorption was observed for Paenibacillus sp. V0-1-LW and Pseudomonas sp. PS-0-L isolates. When isolated bacteria were added to sterilized bog samples, the removal of radiocesium from the solution increased by an average of 50% compared to the removal recorded for pure sterilized peat. Our results demonstrate that the sorption of radiocesium in the bog environment is dependent on pH and the type of the bog layer and that common environmental bacteria prevailing in the bog can remove cesium from the solution phase. - Highlights: • pH and the type of the bog layer affect the sorption

  2. Factors affecting the sorption of cesium in a nutrient-poor boreal bog.

    Science.gov (United States)

    Lusa, M; Bomberg, M; Virtanen, S; Lempinen, J; Aromaa, H; Knuutinen, J; Lehto, J

    2015-09-01

    (135)Cs is among the most important radionuclides in the long-term safety assessments of spent nuclear fuel, due to its long half-life of 2.3 My and large inventory in spent nuclear fuel. Batch sorption experiments were conducted to evaluate the sorption behavior of radiocesium ((134)Cs) in the surface moss, peat, gyttja, and clay layers of 7-m-deep profiles taken from a nutrient-poor boreal bog. The batch distribution coefficient (Kd) values of radiocesium increased as a function of sampling depth. The highest Kd values, with a geometric mean of 3200 L/kg dry weight (DW), were observed in the bottom clay layer and the lowest in the 0.5-1.0 m peat layer (50 L/kg DW). The maximum sorption in all studied layers was observed at a pH between 7 and 9.5. The in situ Kd values of (133)Cs in surface Sphagnum moss, peat and gyttja samples were one order of magnitude higher than the Kd values obtained using the batch method. The highest in situ Kd values (9040 L/kg DW) were recorded for the surface moss layer. The sterilization of fresh surface moss, peat, gyttja and clay samples decreased the sorption of radiocesium by 38%, although the difference was not statistically significant. However, bacteria belonging to the genera Pseudomonas, Paenibacillus, Rhodococcus and Burkholderia isolated from the bog were found to remove radiocesium from the solution under laboratory conditions. The highest biosorption was observed for Paenibacillus sp. V0-1-LW and Pseudomonas sp. PS-0-L isolates. When isolated bacteria were added to sterilized bog samples, the removal of radiocesium from the solution increased by an average of 50% compared to the removal recorded for pure sterilized peat. Our results demonstrate that the sorption of radiocesium in the bog environment is dependent on pH and the type of the bog layer and that common environmental bacteria prevailing in the bog can remove cesium from the solution phase. PMID:26010098

  3. Hydrogen and Cesium Monitor for H- Magnetron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Cheng-Yang [Fermilab; Bollinger, Dan [Fermilab; Schupbach, Brian [Fermilab; Seiya, Kiyomi [Fermilab

    2014-07-01

    The relative concentration of cesium to hydrogen in the plasma of a H- magnetron source is an important parameter for reliable operations. If there is too much cesium, the surfaces of the source become contaminated with it and sparking occurs. If there is too little cesium then the plasma cannot be sustained. In order to monitor these two elements, a spectrometer has been built and installed on a test and operating source that looks at the plasma. It is hypothesized that the concentration of each element in the plasma is proportional to the intensity of their spectral lines.

  4. Effect of Rare Earth Elements on Exchange Performances of Cesium Ion-Sieve

    Institute of Scientific and Technical Information of China (English)

    张惠源; 王榕树; 林灿生; 张先业

    2003-01-01

    The exchange performances and the distribution coefficient of Cesium Ion-Sieve (Cs-IS) for cesium and for some rare earth elements were compared. In particular, the effects of neodymium on the cesium ion exchange and the Cs+ selectivity variation on Cs-IS owing to introduction of rare earth elements into HLLW were studied. Though rare earth elements exhibit a small influence on the distribution coefficient for Cs+, they impair Cs-exchange capacity of Cs-IS to some extent. This interruption on the selectivity to Cs+ can be significantly eliminated provided an appropriate ratio of liquid to solid V:m is used.

  5. High voltage holding in the negative ion sources with cesium deposition

    Energy Technology Data Exchange (ETDEWEB)

    Belchenko, Yu.; Abdrashitov, G.; Ivanov, A.; Sanin, A.; Sotnikov, O., E-mail: O.Z.Sotnikov@inp.nsk.su [Budker Institute of Nuclear Physics, Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation)

    2016-02-15

    High voltage holding of the large surface-plasma negative ion source with cesium deposition was studied. It was found that heating of ion-optical system electrodes to temperature >100 °C facilitates the source conditioning by high voltage pulses in vacuum and by beam shots. The procedure of electrode conditioning and the data on high-voltage holding in the negative ion source with small cesium seed are described. The mechanism of high voltage holding improvement by depletion of cesium coverage is discussed.

  6. Specific interaction of cesium with the surface of calcium silicate hydrates

    International Nuclear Information System (INIS)

    The sorption of cesium at the calcium silicate hydrates (CSH) surface was investigated, both through sorption isotherm data and by solid-state NMR experiments. The sorption ability of CSH towards cesium is favored for low solid Ca/Si molar ratios, in agreement with the negative surface charge they develop then. A significant proportion of these sorbed cesium cations remains tightly bound to the surface sites forming, in dehydrated CSH, inner-sphere complexes, which can not be removed by alcohol washing. Chloride seems to present a lower affinity for CSH, even for high Ca/Si molar ratios, where the surface charge becomes positive. (orig.)

  7. First-principles study of cesium adsorption to weathered micaceous clay minerals

    Science.gov (United States)

    Okumura, Masahiko; Nakamura, Hiroki; Machida, Masahiko

    2014-05-01

    A large amount of radioactive nuclides was produced into environment due to the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident. Residents near FDNPP were suffering from radioactive cesium and then evacuated, because which has long half-life and is retained by surface soil for long time. The Japanese government has been decontaminating the cesium by removing the surface soil in order to return them to their home. This decontamination method is very effective, but which produces huge amount of waste soil. This becomes another big problem in Fukushima, because it is not easy to find large storage sites. Then effective and economical methods to reduce the volume of the waste soil are needed. However, it has not been invented yet. One of the reasons is lack of knowledge about microscopic process of adsorption/desorption of cesium to/from soil. It is known that weathered micaceous clay minerals play crucial role on adsorption and retention of cesium. They are expected to have special sorption sites, called frayed edge sites (FESs), which adsorb cesium selectively and irreversibly. Properties of FES have been intensely investigated by experiments. But microscopic details of the adsorption process on FES are still unclear. Because direct observation of the process with current experimental techniques is quite difficult. We investigated the adsorption of cesium to FES in muscovite, which is a typical micaceous clay mineral, via first-principles calculations (density functional theory). We made a minimal model of FES and evaluate the energy difference before and after cesium adsorption to FES. This is the first numerical modeling of FES. It was shown that FES does adsorb cesium if the weathering of muscovite has been weathered. In addition, we revealed the mechanism of cesium adsorption to FES, which is competition between ion radius of cesium and the degree of weathering. I plan to discuss volume reduction of the waste soil based on our result. Reference M. Okumura

  8. Test procedures and instructions for single shell tank saltcake cesium removal with crystalline silicotitanate

    Energy Technology Data Exchange (ETDEWEB)

    Duncan, J.B.

    1997-01-07

    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Single Shell Tank Saltcake from tanks 24 t -BY- I 10, 24 1 -U- 108, 24 1 -U- 109, 24 1 -A- I 0 1, and 24 t - S-102, in a bench-scale column. The cesium sorbent to be tested is crystalline siticotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-024, Hanford Single Shell Tank Saltcake Cesium Removal Test Plan.

  9. A New Pumping-Probing Scheme for the Optically Pumped Cesium Beam Frequency Standard

    Institute of Scientific and Technical Information of China (English)

    陈景标; 朱程锦; 王凤芝; 杨东海

    2001-01-01

    A new pumping-probing scheme for the optically pumped cesium beam frequency standard has been experimentally tested in our laboratory. The stability of the optically pumped cesium beam frequency standard was measured by comparing its 10 MHz output with an HP5071A commercial cesium atomic clock. The result shows that the frequency stability for the 1 s and 30000s sample times are 1.2 × 10-11 and 3.7 × 10-13, respectively. It was proved that the new pumping scheme works well.

  10. Investigation of adsorption and wetting of 3He on cesium and cesiated glass

    International Nuclear Information System (INIS)

    Experiments have been carried out to investigate the binding of 3He on cesium substrates, using optical pumping to spin-polarize the atoms. The behavior of 3He on the walls at low temperature can be analyzed through the evolution of the nuclear magnetization of the sample. Preliminary results are presented, including: (1) adsorption studies of gaseous 3He on cesiated glass; (2) magnetic relaxation time of polarized liquid 3He on cesium and cesiated glass; (3) evidence for wetting of liquid 3He on cesium. 8 refs., 2 figs

  11. a Biokinetic Model for CESIUM-137 in the Fetus

    Science.gov (United States)

    Jones, Karen Lynn

    1995-01-01

    Previously, there was no method to determine the dose to the embryo, fetus, fetal organs or placenta from radionuclides within the embryo, fetus, or placenta. In the past, the dose to the fetus was assumed to be equivalent to the dose to the uterus. Watson estimated specific absorbed fractions from various maternal organs to the uterine contents which included the fetus, placenta, and amniotic fluid and Sikov estimated the absorbed dose to the embryo/fetus after assuming 1 uCi of radioactivity was made available to the maternal blood.^{1,2} However, this method did not allow for the calculation of a dose to individual fetal organs or the placenta. The radiation dose to the embryo or fetus from Cs-137 in the fetus and placenta due to a chronic ingestion by the mother was determined. The fraction of Cs-137 in the maternal plasma crossing the placenta to the fetal plasma was estimated. The absorbed dose from Cs-137 in each modelled fetal organ was estimated. Since there has been more research regarding potassium in the human body, and particularly in the pregnant woman, a biokinetic model for potassium was developed first and used as a basis and confirmation of the cesium model. Available pertinent information in physiology, embryology, biokinetics, and radiation dosimetry was utilized. Due to the rapid growth of the fetus and placenta, the pregnancy was divided into four gestational periods. The numerous physiological changes that occurred during pregnancy were considered and an appropriate biokinetic model was developed for each of the gestational periods. The amount of cesium in the placenta, embryo, and fetus was estimated for each period. The dose to the fetus from cesium deposited in the embryo or fetus and in the placenta was determined for each period using Medical Internal Radiation Dosimetry (MIRD) methodology. An uncertainty analysis was also performed to account for the variability of the parameters in the biokinetic model based on the experimental data

  12. Diffusion of water, cesium and neptunium in pores of rocks

    International Nuclear Information System (INIS)

    Teollisuuden Voima Oy (TVO) is investigating the feasibility to dispose of spent nuclear fuel within Finland. The present plan calls for the repository to be located in crystalline rock at a depth of several hundred meters. The safety assessment of the repository includes calculations of migration of waste nuclides. The flow of waste elements in groundwater will be retarded through sorption interaction with minerals and through diffusion into rock. Diffusion is the only mechanism retarding the migration of non-sorbing species and, it is expected to be the dominating retardation mechanism of many of the sorbing elements. In the investigation the simultaneous diffusion of tritiated water (HTO), cesium and neptunium in rocks of TVO investigation sites at Kivetty, Olkiluoto and Romuvaara were studied. (11 refs., 33 figs., 9 tabs.)

  13. Cesium-137 accident lessons in Goiania, Goias State, Brazil

    International Nuclear Information System (INIS)

    This document relates the experience obtained by several professionals which had an important role in the cesium-137 accident occurred in Goiania, Goias State, Brazil in September, 1987. It's divided into chapters, according to the action area - medical, nursing, social assistance, odontological and psychological. At first, some notions of radioprotection are explained, followed by the accident history and by the doctors and nurses action during the emergency phase and the medical, odontological, social and psychological assistance to the victims. The social assistance report shows some statistical data about the economic, occupational and social conditions of the accident victims. It is shown some information about the health institutions and the sanitary care in the ionizing radiation and about the occupational radiological protection in Goiania

  14. Coherence Properties of Nanofiber-Trapped Cesium Atoms

    Science.gov (United States)

    Reitz, D.; Sayrin, C.; Mitsch, R.; Schneeweiss, P.; Rauschenbeutel, A.

    2013-06-01

    We experimentally study the ground state coherence properties of cesium atoms in a nanofiber-based two-color dipole trap, localized ˜200nm away from the fiber surface. Using microwave radiation to coherently drive the clock transition, we record Ramsey fringes as well as spin echo signals and infer a reversible dephasing time of T2*=0.6ms and an irreversible dephasing time of T2'=3.7ms. By modeling the signals, we find that, for our experimental parameters, T2* and T2' are limited by the finite initial temperature of the atomic ensemble and the heating rate, respectively. Our results represent a fundamental step towards establishing nanofiber-based traps for cold atoms as a building block in an optical fiber quantum network.

  15. Norbadione A: synthetic approach and cesium complexation studies

    International Nuclear Information System (INIS)

    This work was dedicated to the study of the synthesis and complexation studies of norbadione A: a pigment originating from a mushroom. A synthetic approach, based on a double Suzuki-Miyaura coupling, was developed. This strategy was applied with high yields to the synthesis of various norbadione A analogues, as well as to the synthesis of simple pulvinic acids. Access to functionalized precursors of the molecule was also studied and the final coupling remains to be done. Besides, a speciation study based on electro-spray ionization mass spectrometry was conducted with norbadione A and one of the analogues. This study allowed the assessment of the cesium complexation abilities of each molecule. Structural data was also obtained and complexation constants were calculated. Finally, norbadione A and various synthetic products have been tested via high-throughput screening methods and strong antioxidant properties were observed. Other biological results are also reported. (author)

  16. Vector Cesium Magnetometer for the nEDM Experiment

    International Nuclear Information System (INIS)

    Full text: We use optical pumping combined with magnetic resonance in a Cesium vapor cell in order to measure the magnetic field. A Vector Cs Magnetometer uses multiple laser beams to follow the dynamics of the spin in 3D. The 3D signal is used to extract the Larmor frequency of the spins, and to extract the direction of the magnetic field through the path of the spins. The magnetometer was successfully tested in a proof of principle experiment. Its measured performance is ∼50 pT/Hz1/2 for the directions perpendicular to the magnetic field, and ∼500 fT/Hz1/2 for the direction parallel to the magnetic field. (author)

  17. Coherence properties of nanofiber-trapped cesium atoms

    CERN Document Server

    Reitz, D; Mitsch, R; Schneeweiss, P; Rauschenbeutel, A

    2013-01-01

    We experimentally study the ground state coherence properties of cesium atoms in a nanofiber-based two-color dipole trap, localized 200 nm away from the fiber surface. Using microwave radiation to coherently drive the clock transition, we record Ramsey fringes as well as spin echo signals and infer a reversible dephasing time $T_2^\\ast=0.6$ ms and an irreversible dephasing time $T_2^\\prime=3.7$ ms. By theoretically modelling the signals, we find that, for our experimental parameters, $T_2^\\ast$ and $T_2^\\prime$ are limited by the finite initial temperature of the atomic ensemble and the heating rate, respectively. Our results represent a fundamental step towards establishing nanofiber-based traps for cold atoms as a building block in an optical fiber quantum network.

  18. Quantitative analysis of cesium in synthetic lithium molten salts

    International Nuclear Information System (INIS)

    An analytical technique for fission products in lithium molten salts of spent PWR (Pressurized Water Reactor) fuels has been studied for the establishment of optimum chemical engineering process and the evaluation of process material balance in developing Direct Oxide Reduction Process with lithium metal. As part of the basic research, synthetic dissolver solutions of lithium chloride containing trace amounts of fission product elements (La, Ce, Pr, Nd, Sm, Eu, Gd, Y, Cs, Ru, Rh, Pd, Mo, Zr, Cd, Ba, Sr, Te and Se) was prepared and used in establishing the selective separation technique of cesium from lithium chloride matrix using cation exchange chromatography. Its recovery was measured by flame atomic absorption spectrometry and the reliability of this technique was evaluate

  19. Elastic scattering of sodium and cesium atoms at ultracold temperatures

    Institute of Scientific and Technical Information of China (English)

    Zhang Ji-Cai; Wang Ke-Dong; Liu Yu-Fang; Sun Jin-Feng

    2011-01-01

    The elastic scattering properties in a mixture of sodium and cesium atoms are investigated at cold and ultracold temperatures. Based on the accurate interatomic potential for the NaCs mixture,the interspecies s-wave scattering lengths,the effective ranges and the p-wave scattering lengths are calculated by the quantal method and the semiclassical method,respectively. The s-wave scattering lengths are 512.7ao for the singlet state and 33.4ao for the triplet state. In addition,the spin-change and elastic cross sections are also calculated,and the g-wave shape resonance is found in the total elastic cross sections.

  20. Identification of Novel FAM134B (JK1) Mutations in Oesophageal Squamous Cell Carcinoma

    OpenAIRE

    Md. Hakimul Haque; Vinod Gopalan; Kwok-wah Chan; Shiddiky, Muhammad J. A.; Robert Anthony Smith; Alfred King-yin Lam

    2016-01-01

    Mutation of FAM134B (Family with Sequence Similarity 134, Member B) leading to loss of function of its encoded Golgi protein and has been reported induce apoptosis in neurological disorders. FAM134B mutation is still unexplored in cancer. Herein, we studied the DNA copy number variation and novel mutation sites of FAM134B in a large cohort of freshly collected oesophageal squamous cell carcinoma (ESCC) tissue samples. In ESCC tissues, 37% (38/102) showed increased FAM134B DNA copies whereas 3...

  1. Vitrification of cesium-contaminated organic ion exchange resin

    Energy Technology Data Exchange (ETDEWEB)

    Sargent, T.N. Jr. [Clemson Univ., SC (United States)

    1994-08-01

    Vitrification has been declared by the Environmental Protection Agency (USEPA) as the Best Demonstrated Available Technology (BDAT) for the permanent disposal of high-level radioactive waste. Savannah River Site currently uses a sodium tetraphenylborate (NaTPB) precipitation process to remove Cs-137 from a wastewater solution created from the processing of nuclear fuel. This process has several disadvantages such as the formation of a benzene waste stream. It has been proposed to replace the precipitation process with an ion exchange process using a new resorcinol-formaldehyde resin developed by Savannah River Technical Center (SRTC). Preliminary tests, however, showed that problems such as crust formation and a reduced final glass wasteform exist when the resin is placed in the melter environment. The newly developed stirred melter could be capable of overcoming these problems. This research explored the operational feasibility of using the stirred tank melter to vitrify an organic ion exchange resin. Preliminary tests included crucible studies to determine the reducing potential of the resin and the extent of oxygen consuming reactions and oxygen transfer tests to approximate the extent of oxygen transfer into the molten glass using an impeller and a combination of the impeller and an external oxygen transfer system. These preliminary studies were used as a basis for the final test which was using the stirred tank melter to vitrify nonradioactive cesium loaded organic ion exchange resin. Results from this test included a cesium mass balance, a characterization of the semi-volatile organic compounds present in the off gas as products of incomplete combustion (PIC), a qualitative analysis of other volatile metals, and observations relating to the effect the resin had on the final redox state of the glass.

  2. Candlestick oven with a silica wick provides an intense collimated cesium atomic beam

    Science.gov (United States)

    Pailloux, A.; Alpettaz, T.; Lizon, E.

    2007-02-01

    This article shows that readily available glass and silica fibers and braids are suitable capillary structure for recirculating ovens, such as candlestick ovens, becoming then an alternative wick material to conventional metal based capillary structures. In order to study wettability and capillarity of metallic liquid cesium on borosilicate and silica microstructures, samples were selected, prepared, and tested experimentally. The contact angle of cesium on silica glass was roughly measured: θ =35°±10°. A commercially available silica braid was then introduced inside a candlestick oven to transfer the metallic liquid cesium from the cold reservoir to the hot emission point of the candlestick. A collimated cesium atomic beam of intensity of 2×1016at./ssr was obtained, stable and reproducible. Furthermore, this modified oven is easy to handle daily.

  3. Preparation, structure and application of a new ecomaterials cesium ion-sieve

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A new ecomaterials cesium ion-sieve (Cs-IS), which has high selectivity to cesium and excellent acid resistance, is prepared with zirconyl molybdopyrophosphate as its matrix by specific chemical sieve-making means. Cs-IS has large exchange capacity ( 1.83mmol@g-1) and high distribution coefficient (4.09 x 104 mL@ L-1) in the medium of 3 mol@ L- 1 HNO3. In the static exchange with strongly acidic high-level radioactive liquid waste (HLLW) (3 mol@ L-1 HNO3), Cs-IS exhibits high exchange rate for cesium (above 96.53 % ) and large separation factor (greater than 958.41). These indicate the possible use of Cs-IS in cesium-137 selective removal and recovery from highly saline acidic HLLW system.

  4. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium.

    Science.gov (United States)

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru

    2012-05-30

    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent. PMID:22464752

  5. Synthesis of novel calix[4]crown telomers and selective extraction of cesium ions

    Institute of Scientific and Technical Information of China (English)

    Hai Bing Li; Yuan Yin Chen; De Jun Xiong; Jun Yan Zhan; Cui Ping Han

    2007-01-01

    p-tert-Butylcalix[4]diazacrown-4 telomer, which contains hard and soft ion binding sites, was synthesized. It exhibited high selectivity toward cesium ions. The binding sites may complex alkali metal ions selectively.

  6. Biological effects of cesium-137 injected in beagle dogs of different ages

    Energy Technology Data Exchange (ETDEWEB)

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others

    1995-12-01

    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.

  7. Assessment of food calcium radioprotection effectiveness against cesium-137, added alone and with iodine-131

    International Nuclear Information System (INIS)

    New fish product with addition of food calcium had radioprotective properties, resulted in decreased cesium-137 content in organs and tissues of animals by 40-60% and lesser changes in differential blood count and biochemical indexes of blood serum

  8. Cold cesium molecules produced directly in a magneto-optical trap

    Institute of Scientific and Technical Information of China (English)

    Zhang Hong-Shan; Ji Zhong-Hua; Yuan Jin-Peng; Zhao Yan-Ting; Ma Jie; Wang Li-Rong; Xiao Lian-Tuan; Jia Suo-Tang

    2011-01-01

    We report on the observation of ultracold ground electric-state cesium molecules produced directly in a magnetooptical trap with a good signal-to-noise ratio.These molecules arise from the photoassociation of magneto-optical trap lasers and they are detected by resonantly enhanced multiphoton ionization technology.The production rate of ultracold cesium molecules is up to 4× 104 s-1.We measure the characteristic time of the ground electric-state cesium molecules generated in the experiment and investigate the Cs2+ molecular ion intensity as a function of the trapping laser intensity and the ionization pulse laser energy.We conclude that the production of cold cesium molecules may be enhanced by using appropriate experimental parameters,which is useful for future experiments involving the production and trapping of ultracold ground electric-state molecules.

  9. Cs2 ‘diffuse bands’ emission from superheated cesium vapor

    Science.gov (United States)

    Pichler, G.; Makdisi, Y.; Kokaj, J.; Thomas, N.; Mathew, J.; Beuc, R.

    2016-07-01

    Thermal emission from superheated cesium vapor was studied to very high temperatures from 700 °C to 1000 °C. This was performed in the vapor condition only and with no liquid cesium present in the all-sapphire cell. We observed a number of atomic and molecular spectral features simultaneously in emission and absorption, especially peculiar thermal emission of cesium dimer diffuse bands (2 3Πg → a 3∑u + transitions) around 710 nm coexisting with absorption bands around first resonance lines at 852 and 894 nm. We performed appropriate calculations of the diffuse band emission profiles and compared them with measured profiles. We also performed absorption measurements and compared observed diffuse band profiles with calculated ones. Possible applications of the observed phenomena will be discussed in terms of the solar energy conversion using dense cesium vapor.

  10. Fission of Multiply Charged Cesium and Potassium Clusters in Helium Droplets - Approaching the Rayleigh Limit

    CERN Document Server

    Renzler, Michael; Daxner, Matthias; Kranabetter, Lorenz; Kuhn, Martin; Scheier, Paul; Echt, Olof

    2016-01-01

    Electron ionization of helium droplets doped with cesium or potassium results in doubly and, for cesium, triply charged cluster ions. The smallest observable doubly charged clusters are $Cs_{9}^{2+}$ and $K_{11}^{2+}$; they are a factor two smaller than reported previously. The size of potassium dications approaches the Rayleigh limit nRay for which the fission barrier is calculated to vanish, i.e. their fissilities are close to 1. Cesium dications are even smaller than nRay, implying that their fissilities have been significantly overestimated. Triply charged cesium clusters as small as $Cs_{19}^{3+}$ are observed; they are a factor 2.6 smaller than previously reported. Mechanisms that may be responsible for enhanced formation of clusters with high fissilities are discussed.

  11. Performance Test of a R134a Centrifugal Water Chiller

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hyeonkoo; Yoon, Pil Hyun; Kim, Choon Dong; Lee, Yong Duck; Jeong, Jinhee [LG Cable Ltd., Anyang (Korea)

    2001-05-01

    A centrifugal water chiller using alternative refrigerant R134a have been developed. The prototype was designed to have refrigeration capacity of 300 RT. Its compressor employs a single high-speed impeller, airfoil diffuser and collector. Newly developed enhanced tubes were installed in the evaporator and the condenser to reduce the required head for the compressor. Off-design characteristics at various conditions, performance test of the compressor and analysis of the refrigeration cycle were performed. So the probability of use in part load condition was checked and the direction for revision was suggested. 5 refs., 11 figs., 2 tabs.

  12. ANTIMICROBIAL ACTIVITIES OF 1,3,4-OXADIAZOLE : A REVIEW

    Directory of Open Access Journals (Sweden)

    Bachwani Mukesh

    2011-06-01

    Full Text Available 1, 3, 4-Oxadiazole is a highly privileged structure the derivatives of which exhibit a wide range of biological activities including antibacterial, antitubercular, vasodialatory, antifungal, cytotoxic, anti-inflammatory and analgesic, hypolipidemic, anticancer and ulcerogenic activities. Resistance to number of antimicrobial agents among a variety of clinically significant species of bacteria is becoming increasingly important global problem. The search for new antimicrobial agents will consequently always remain as an important and challenging task for medicinal chemists. This Review has basic information about 1,3,4-oxadiazole and its antimicrobial activity work for further development in this field.

  13. Fabrication and performance of fl y ash granule filter for trapping gaseous cesium

    Directory of Open Access Journals (Sweden)

    Park Jang Jin

    2015-09-01

    Full Text Available Although a disk-type fly ash filter has shown a good performance in trapping gaseous cesium, it has difficulty in charging filters into a filter container and discharging waste filters containing radioactive cesium from a container by remote action. To solve the difficulty of the disk-type fly ash filter, five types of granule filters, including a ball type, tube type, and sponge-structure type have been made. Among them, the best filter type was chosen through simple crucible tests. The five types of granule filters packed into containers were loaded into five alumina crucibles of 50 cc. Five grams of CsNO3 was used as a gaseous cesium source. They were then placed in a muffle furnace and heated to 900°C and maintained for 2 hours. After the experiment, the weights of the cesium trapped filters were measured. Among the five types of granule filters, the sponge-structure type granule filter was the best, which has the highest trapping capacity of cesium. Its capacity is 0.42 g-Cs/g-filter. The chosen sponge-structure type granule filters and disk-type filters have been tested using a two-zone tube furnace. Cs volatilization and Cs trapping zones were maintained at 900 and 1000°C, respectively. Sixteen grams of CsNO3 was used as a gaseous cesium source. The cesium trapping profile of the sponge-structure type granule filters was almost similar to that of the disk-type fly ash filters. For both cases, cesium was successfully trapped within the third filter.

  14. Sorption and diffusion of cobalt, nickel, strontium, iodine, cesium and americium in natural fissure surfaces and drill core cups studied by autoradiography, 2

    International Nuclear Information System (INIS)

    Theoretical studies on geological disposal of radioactive waste in fractured crystalline rock and migration of radionuclides in groundwater circulating through the fractured zones have indicated the importance of diffusion into the rock matrix. Samples chosen for this study were filled and unfilled natural fracture surfaces and drill cores having a central drilled cavity ('drill core cups'). Samples originated from the two nuclear power plant sites in Finland: mica gneiss and tonalite from Olkiluoto and rapakivi granite from Haestholmen in Loviisa. An autoradiographic method was used for determination of the penetration depths and calculation of diffusion coefficients of Cs-134, Sr-90, Co-60, Ni-63, I-125 and Am-241. Emphasis was also directed to testing the quantitative autoradiographic method for diffusion coefficient measurements. After one year's contact time the penetration depths of strontium in tonalite were 15 mm and 10 mm for the filled and unfilled natural fracture surface samples and 5 mm for drill core cups. In the filled natural fracture surface sample of rapakivi granite the penetration depth of strontium was 35 mm. For cesium penetration depths in tonalite from 2.0 mm (unfilled natural surface) to 3.0 mm (drill core cup) were observed. For cobalt a penetration depth of 0.9 mm was found in the drill core cup sample of tonalite after contact time of one year and 1.5 mm in the filled natural fracture surface of rapakivi granite after contact time of six months. The range of Da-values of strontium was 1.4 x 10-14 - 1.1 x 10-13 m2/s. The Da-values for cesium and cobalt in tonalite (drill core cup samples) were 7 x 10-15 m2/s and 5 x 10-16 m2/s, respectively

  15. Enhanced electronic injection in organic light-emitting diodes by incorporating silver nanoclusters and cesium carbonate

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Ying-Chung; Gao, Chia-Yuan [Department of Electrical Engineering, National Sun Yat-Sen University, Kaohsiung, Taiwan (China); Chen, Kan-Lin [Department of Electronic Engineering, Fortune Institute of Technology, Kaohsiung, Taiwan (China); Sze, Po-Wen [Department of Electro-Optical Science and Engineering, Kao Yuan University, Kaohsiung, Taiwan (China); Huang, Chien-Jung, E-mail: chien@nuk.edu.tw [Department of Applied Physics, National University of Kaohsiung, Kaohsiung, Taiwan (China)

    2015-10-01

    Highlights: • The localized electric field around SNCs is enhanced. • When the cesium carbonate/silver nanoclusters/cesium carbonate electron-injection structure replaces the cesium carbonate electron-injection structure, higher electron-injection ability is obtained. • The structure for efficient electron injection is critical to characteristics of the device. - Abstract: The influence of the cesium carbonate/silver nanoclusters/cesium carbonate electron-injection structure (CSC-EIS) on the performance of organic light-emitting diodes is investigated in this study. The silver nanoclusters (SNCs) are introduced between the electron-injection layers by means of thermal evaporation. When the CSC-EIS replaces the cesium carbonate electron-injection structure, higher electron-injection ability is obtained because the electron-injection barrier between the cathode and the electron-transport layer is remarkably reduced from 1.2 to 0 eV. In addition, surface plasmon resonance effect will cause the enhanced localized electric field around the SNCs, resulting that electron-injection ability is further enhanced from the cathode to the emitting layer.

  16. Measurement of cesium emissions during the vitrification of simulated high level radioactive waste

    International Nuclear Information System (INIS)

    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to eliminate a startup test that would involve adding small amounts of radioactive cesium-137 to simulated high-level waste. In order to eliminate this test, a reliable method for measuring non-radioactive cesium in the offgas system from the glass melter is required. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICPMS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. Typical particulate loadings ranged from 800 μg of cesium. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. The decontamination factors measured experimentally compared favorably with the process design basis values

  17. Modeling Ion-Exchange Processing With Spherical Resins For Cesium Removal

    Energy Technology Data Exchange (ETDEWEB)

    Hang, T.; Nash, C. A.; Aleman, S. E.

    2012-09-19

    The spherical Resorcinol-Formaldehyde and hypothetical spherical SuperLig(r) 644 ion-exchange resins are evaluated for cesium removal from radioactive waste solutions. Modeling results show that spherical SuperLig(r) 644 reduces column cycling by 50% for high-potassium solutions. Spherical Resorcinol Formaldehyde performs equally well for the lowest-potassium wastes. Less cycling reduces nitric acid usage during resin elution and sodium addition during resin regeneration, therefore, significantly decreasing life-cycle operational costs. A model assessment of the mechanism behind ''cesium bleed'' is also conducted. When a resin bed is eluted, a relatively small amount of cesium remains within resin particles. Cesium can bleed into otherwise decontaminated product in the next loading cycle. The bleed mechanism is shown to be fully isotherm-controlled vs. mass transfer controlled. Knowledge of residual post-elution cesium level and resin isotherm can be utilized to predict rate of cesium bleed in a mostly non-loaded column. Overall, this work demonstrates the versatility of the ion-exchange modeling to study the effects of resin characteristics on processing cycles, rates, and cold chemical consumption. This evaluation justifies further development of a spherical form of the SL644 resin.

  18. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    International Nuclear Information System (INIS)

    Highlights: ► Prussian blue was sealed in cavities of diatomite using carbon nanotubes. ► The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. ► Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  19. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Baiyang [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Fugetsu, Bunshi, E-mail: hu@ees.hokudai.ac.jp [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Yu, Hongwen [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Abe, Yoshiteru [Kyoei Engineering Corporation, Niigata 959-1961 (Japan)

    2012-05-30

    Highlights: Black-Right-Pointing-Pointer Prussian blue was sealed in cavities of diatomite using carbon nanotubes. Black-Right-Pointing-Pointer The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. Black-Right-Pointing-Pointer Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  20. Why was the macalot collection (Ps 120-134 written?

    Directory of Open Access Journals (Sweden)

    H. Viviers

    1994-01-01

    Full Text Available Why was the macalot collection (Ps 120-134 written? A dose reading of the macalot collection (Ps 120-134 proves that it is a work of unity and poetic worth. I f the ‘answer’ communicated by the text is ‘trust in Yahweh’, what might the ‘question’ or ‘problem’ be? How does the social context illuminate the text? With the sociological insights of C Geertz and W Brueggemann the sociological function of the collection is determined. Relevant sociohistoric data are used in reconstructing the possible social setting of the collection. Text and context match! The first in fact ‘mirrors’ the latter. The (macro- context is that of disconsolation (ca 445-350 B C in Jerusalem and a dire need for a message of trust and hope - which the text does provide. The theme of trust is given substance within the world view and ethos of Zion, national and Godwith- us-theology.

  1. Idiopathic urolithiasis in Tunisian children: A report of 134 cases

    Directory of Open Access Journals (Sweden)

    A Alaya

    2013-01-01

    Full Text Available We evaluated the metabolic and the nutritional aspects of 134 urolithiasis children in order to outline the characteristics of idiopathic urolithiasis in children. This prospective study group of 134 children (56 females, 78 males with renal calculi was evaluated. The age range of the patients was six months to 16 years. A dietary survey was performed on every child. All patients were investigated with respect to stone localization and serum and urine risk factors. Statistical analysis of data was carried out using software SPSS 11.0 for Windows. Hypercalciuria was the most common risk factor detected in this group (28.3%. A decrease of water intake was noted in all age groups, especially in the rural area (549.6 mL/day vs. 1150.6 mL/day, and there was an increase in animal protein intake in 17 cases (mean: 1.9 g/kg. In addition, increased intake of starchy foods and food with high oxalate content (sorgum were detected in the ten to 16 years age group (51% of our study. Calcium oxalate monohydrate represents the principal component of idiopathic stone (58.2%, which is more frequent in children (68% than in infants (51.7% (P <0.02. The major etiology of idiopathic urolithiasis highlights the influence of dietary habit in stone formers in our country. The increased occurrence of calcium oxalate stones in school age children confirms the change in the etiology of urolithiasis according to age.

  2. The effects of K+ growth conditions on the accumulation of cesium by the bacterium Thermus sp. TibetanG6

    Institute of Scientific and Technical Information of China (English)

    WANG; Hailei; KONG; Fanjing; ZHENG; Mianping

    2006-01-01

    The accumulation of cesium by the bacterium Thermus sp. TibetanG6 was examined under different K+ growth conditions. The effects of external pH and Na+ on the accumulation of cesium were also studied, and the mechanism involved was discussed. K+ regimes played an important role in the accumulation of cesium by the strain TibetanG6. The quantity of cesium accumulated (24 h) was much higher in K+-deficient regime than that in K+-sufficient regime. The pH and Na+ had different effects on the accumulation of cesium in the two K+ regimes. IR spectra analyses indicated that the biosorption is a process of homeostasis with cesium initially accumulated on the cell wall.

  3. Monitoring of radionuclides in the environment. Part. 4. Factors influencing depth profiles of radioactive cesium in soils

    International Nuclear Information System (INIS)

    In order to evaluate the vertical migration behavior of radioactive cesium, which contaminated by the Fukushima Dai-ichi NPP accident, the distribution of radioactive cesium in different type of soils, e.g., bare ground, grass land, conifer forest floor were measured on October 2011, 2012, 2013, in Abiko, Chiba, Japan. Even three years after the deposition, most of radioactive cesium were deposited in the depths of within 5 cm at anywhere in this area. Depth profiles of radioactive cesium in soil was significantly correlated with organic matter content in soils (r=0.82; p<0.0001), whereas the factors such as potassium ion and ammonium ion in soil, stable cesium content, and clay mineral content were not correlated clearly. This indicates that the vertical migration rate of radioactive cesium is very slow and it would be influenced by organic matter in soil, not just clay. (author)

  4. Behavior of cesium in municipal solid waste incineration.

    Science.gov (United States)

    Oshita, Kazuyuki; Aoki, Hiroshi; Fukutani, Satoshi; Shiota, Kenji; Fujimori, Takashi; Takaoka, Masaki

    2015-05-01

    As a result of the Fukushima Daiichi Nuclear Power Plant accident on March 11, 2011 in Japan radioactive nuclides, primarily (134)Cs and (137)Cs were released, contaminating municipal solid waste and sewage sludge in the area. Although stabilizing the waste and reducing its volume is an important issue differing from Chernobyl nuclear power plant accident, secondary emission of radioactive nuclides as a result of any intermediate remediation process is of concern. Unfortunately, there is little research on the behavior of radioactive nuclides during waste treatment. This study focuses on waste incineration in an effort to clarify the behavior of radioactive nuclides, specifically, refuse-derived fuel (RDF) with added (133)Cs (stable nuclide) or (134)Cs (radioactive nuclide) was incinerated in laboratory- and pilot-scale experiments. Next, thermogravimetric (TG) and differential thermal analysis (DTA) of stable Cs compounds, as well as an X-ray absorption fine structure (XAFS) analysis of Cs concentrated in the ashes were performed to validate the behavior and chemical forms of Cs during the combustion. Our results showed that at higher temperatures and at larger equivalence ratios, (133)Cs was distributed to the bottom ash at lower concentration, and the influence of the equivalence ratio was more significant at lower temperatures. (134)Cs behaved in a similar fashion as (133)Cs. We found through TG-DTA and XAFS analysis that a portion of Cs in RDF vaporizes and is transferred to fly ash where it exists as CsCl in the MSW incinerator. We conclude that Cs-contaminated municipal solid wastes could be incinerated at high temperatures resulting in a small amount of fly ash with a high concentration of radioactive Cs, and a bottom ash with low concentrations. PMID:25697082

  5. Behavior of cesium in municipal solid waste incineration

    International Nuclear Information System (INIS)

    As a result of the Fukushima Daiichi Nuclear Power Plant accident on March 11, 2011 in Japan radioactive nuclides, primarily 134Cs and 137Cs were released, contaminating municipal solid waste and sewage sludge in the area. Although stabilizing the waste and reducing its volume is an important issue differing from Chernobyl nuclear power plant accident, secondary emission of radioactive nuclides as a result of any intermediate remediation process is of concern. Unfortunately, there is little research on the behavior of radioactive nuclides during waste treatment. This study focuses on waste incineration in an effort to clarify the behavior of radioactive nuclides, specifically, refuse-derived fuel (RDF) with added 133Cs (stable nuclide) or 134Cs (radioactive nuclide) was incinerated in laboratory- and pilot-scale experiments. Next, thermogravimetric (TG) and differential thermal analysis (DTA) of stable Cs compounds, as well as an X-ray absorption fine structure (XAFS) analysis of Cs concentrated in the ashes were performed to validate the behavior and chemical forms of Cs during the combustion. Our results showed that at higher temperatures and at larger equivalence ratios, 133Cs was distributed to the bottom ash at lower concentration, and the influence of the equivalence ratio was more significant at lower temperatures. 134Cs behaved in a similar fashion as 133Cs. We found through TG–DTA and XAFS analysis that a portion of Cs in RDF vaporizes and is transferred to fly ash where it exists as CsCl in the MSW incinerator. We conclude that Cs-contaminated municipal solid wastes could be incinerated at high temperatures resulting in a small amount of fly ash with a high concentration of radioactive Cs, and a bottom ash with low concentrations. - Highlights: • Behaviors of Cs on the incineration of the model waste were investigated. • More Cs was moved to fly ash with increasing of equivalence ratio and temperature. • Chemical forms of Cs in the fly ash were

  6. Engineered Materials for Cesium and Strontium Storage Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Sean M. McDeavitt

    2010-04-14

    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at

  7. Engineered Materials for Cesium and Strontium Storage. Final Technical Report

    International Nuclear Information System (INIS)

    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at Purdue

  8. ZHANG Heng's Seismometer and Longxi earthquake in AD 134

    Institute of Scientific and Technical Information of China (English)

    FENG Rui; YU Yan-xiang

    2006-01-01

    Longxi earthquake was the only earthquake example, which ZHANG Heng's Seismometer had detected. Therefore this event attracted the attention of the academic circle and also served as crucial evidence to examine the rationality of the reconstructed model of the seismometer. But for a long time, owing to the fact that the Jincheng-Longxi earthquake on February 28, AD 138 was mistaken as the event went against the historical records, it was refuted by the researches of both in China and abroad. By making careful textual research of historical records, especially by analyzing the description of Longxi earthquake of Houhan Shu, by studying the historical background exposed by historical literatures at that time, ZHANG Heng's biography, his poems and place names of Han Dynasty, by comparing five earthquakes occurred in Qing Dynasty and their attenuation of seismic intensity, the conclusion can be drawn that the Longxi earthquake should take place on December 13, AD 134 (the third year of Yangjia reign). As a rough assessment, the epicenter was in Tianshui area and the magnitude was about 7. Due to the political corruption and inability to scientifically explain earthquake phenomenon at the end of Eastern Han Dynasty, a tragedy occurred during the later years of ZHANG Heng's life that had direct relations with the earthquake successively occurred in AD 133 and AD 134 after invention of seismometer in AD 132. In order to analyze the ground motion at Lingtai caused by the event in AD 134, the digital broad-band seismic records of three Longxi earthquakes in recent years recorded by Luoyang seismic station are used. The numerical modelings are made from three aspects of seismic magnitude definition, digital broad-band seismograms and empirical Green's function method. The results have shown that the maximum horizontal displacement at Lingtai is between 6~8 mm, and the maximum acceleration is less than 10-2 rn/s2. These results have played an important role in quantitative

  9. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    International Nuclear Information System (INIS)

    Twenty-seven fully loaded 137Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 15000C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of 137Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded 137Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10-10 kg m-2s-1, while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10-12 kg m-2s-1. The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level 137Cs aluminosilicate pellets were 1.29 x 10-16m2s-1, 6.88 x 10-17m2s-1, and 1.35 x 10-17m2s-1, respectively

  10. BeppoSAX observations of PKS 0528+134

    International Nuclear Information System (INIS)

    We report on the BeppoSAX observations of the γ-ray blazar PKS 0528+134 performed in Feb and Mar 1997, during a multiwavelength campaign involving EGRET and ground based telescopes. The source was in a faint and hard state, with energy spectral index α = 0.48 ± 0.04 between 0.1 and 10 keV, and keV flux of 2.7 x 10-12 erg cm-2 s-1. No significant variability was observed. The source was detected in the 20-120 keV band by the PDS, with a flux lying slightly above the extrapolation from lower X-ray energies. Comparing this low state with previous higher states of the source, there is an indication that the X-ray spectrum hardens and the γ-ray spectrum steepens when the source is fainter

  11. Role of Munc13-4 as a Ca2+-dependent tether during platelet secretion.

    Science.gov (United States)

    Chicka, Michael C; Ren, Qiansheng; Richards, David; Hellman, Lance M; Zhang, Jinchao; Fried, Michael G; Whiteheart, Sidney W

    2016-03-01

    The Munc13 family of exocytosis regulators has multiple Ca(2+)-binding, C2 domains. Here, we probed the mechanism by which Munc13-4 regulates in vitro membrane fusion and platelet exocytosis. We show that Munc13-4 enhances in vitro soluble NSF attachment protein receptor (SNARE)-dependent, proteoliposome fusion in a Ca(2+)- and phosphatidylserine (PS)-dependent manner that was independent of SNARE concentrations. Munc13-4-SNARE interactions, under the conditions used, were minimal in the absence or presence of Ca(2+). However, Munc13-4 was able to bind and cluster liposomes harbouring PS in response to Ca(2+). Interestingly, Ca(2+)-dependent liposome binding/clustering and enhancement of proteoliposome fusion required both Munc13-4 C2 domains, but only the Ca(2+)-liganding aspartate residues of the C2B domain. Analytical ultracentrifugation (AUC) measurements indicated that, in solution, Munc13-4 was a monomeric prolate ellipsoid with dimensions consistent with a molecule that could bridge two fusing membranes. To address the potential role of Munc13-4 as a tethering protein in platelets, we examined mepacrine-stained, dense granule mobility and secretion in platelets from wild-type and Munc13-4 null (Unc13d(Jinx)) mice. In the absence of Munc13-4, dense granules were highly mobile in both resting and stimulated platelets, and stimulation-dependent granule release was absent. These observations suggest that dense granules are stably docked in resting platelets awaiting stimulation and that Munc13-4 plays a vesicle-stabilizing or tethering role in resting platelets and also in activated platelets in response to Ca(2+). In summary, we show that Munc13-4 conveys Ca(2+) sensitivity to platelet SNARE-mediated membrane fusion and reveal a potential mechanism by which Munc13-4 bridges and stabilizes apposing membranes destined for fusion. PMID:26637270

  12. The crystal structures of potassium and cesium trivanadates

    Science.gov (United States)

    Evans, H.T.; Block, S.

    1966-01-01

    Potassium and cesium trivanadates are monoclinic and isomorphous, space group P21/m, with the following dimensions (Z = 2): KV3O8, a = 7.640 A, b = 8.380 A, c = 4.979 A, ??= 96?? 57???; CsV3O8, a = 8.176 A, b = 8.519 A, c = 4.988 A, ?? = 95?? 32???. The crystal structure of KV3O8 has been determined from hk0, 0kl, and h0l Weissenberg data with an R factor of 0.15. The structure of CsV3O8 has been refined with 1273 hkl Weissenberg data to an R factor of 0.089. The structures consist of corrugated sheets based on a linkage of distorted VO6, octahedra. Two of the vanadium atoms lie in double, square-pyramid groups V2O8, which are linked through opposite basal corners into chains along the b axis. The chains are joined laterally along the c axis into sheets by the third vanadium atom in VO groups, also forming part of a square-pyramid coordination. Various aspects of these structures are compared with other known oxovanadate structures.

  13. ATLAS tile calorimeter cesium calibration control and analysis software

    International Nuclear Information System (INIS)

    An online control system to calibrate and monitor ATLAS Barrel hadronic calorimeter (TileCal) with a movable radioactive source, driven by liquid flow, is described. To read out and control the system an online software has been developed, using ATLAS TDAQ components like DVS (Diagnostic and Verification System) to verify the hardware before running, IS (Information Server) for data and status exchange between networked computers, and other components like DDC (DCS to DAQ Connection), to connect to PVSS-based slow control systems of Tile Calorimeter, high voltage and low voltage. A system of scripting facilities, based on Python language, is used to handle all the calibration and monitoring processes from hardware perspective to final data storage, including various abnormal situations. A QT based graphical user interface to display the status of the calibration system during the cesium source scan is described. The software for analysis of the detector response, using online data, is discussed. Performance of the system and first experience from the ATLAS pit are presented

  14. Cesium sorption and desorption behavior of clay minerals

    International Nuclear Information System (INIS)

    Cesium sorption and desorption of clay minerals (montmorillonite, beidellite, nontronite, weathered biotite, rectorite and illite) were investigated by consecutive sorption-desorption (CSD) experiments. In batch sorption experiment, two solutions with different Cs concentration 10-3 and 10-7 mol/L) were used. In batch desorption experiments, Cs sorbed samples in sorption experiments were treated 5 times with 1 mol/L ammonium acetate solution. In the case of CSD experiments using 10-3 mol/L Cs solution, the exchangeable cations (Na, Ca, and K) in the clay samples affected to the sorption ratio of Cs, and this effect depended on the type of clay mineral. The desorption ratios of untreated, Na-exchanged and Ca-exchanged weathered biotite ranged from 23 to 33%, while that of other samples was over 80%. In the case of CSD experiments using 10-7 mol/L Cs solution, the sorption ratio of montmorillonite was smaller than that of the other clay samples. In desorption experiments, more than 10-9 mol sorbed Cs remained in 1.0 g of the sample after 5 extraction times. These results indicate that all examined clay samples are able to strongly adsorb Cs with a capacity of more than 10-9 mol/g. (author)

  15. Broadband Vibrational Cooling of Cold Cesium Molecules: Theory and Experiments

    Institute of Scientific and Technical Information of China (English)

    D. Sofikitis; A. Fioretti; S. Weber; M. Viteau; A. Chotia; R. Horchani; M. Allegrini; B. Chatel; D. Comparat; P. Pillet

    2009-01-01

    The use of a broadband, frequency shaped femtosecond laser on translationally cold cesium molecules has recently demonstrated to be a very efficient method of cooling also the vibrational degree of freedom. A sample of cold molecules, initially distributed over several vibrational levels, has thus been transfered into a single selected vibrational level of the singlet X1∑g ground electronic state. Our method is based on repeated optical pumping by laser light with a spectrum broad enough to excite all populated vibrational levels but limited in its frequency bandwidth with a spatial light modulator. In such a way we are able to eliminate transitions from the selected level, in which molecules accumulate. In this paper we briefly report the main experimental results and then address, in a detailed way by computer simulations, the perspectives for a "complete" cooling of the molecules, including also the rotational degree of freedom. Since the pumping process strongly depends on the rclative shape of the ground and excited potential curves, ro-vibrational cooling through different excited states is theoretically compared.

  16. Evaluation of a cesium adsorbent grafted with ammonium 12-molybdophosphate

    Science.gov (United States)

    Shibata, Takuya; Seko, Noriaki; Amada, Haruyo; Kasai, Noboru; Saiki, Seiichi; Hoshina, Hiroyuki; Ueki, Yuji

    2016-02-01

    A fibrous cesium (Cs) adsorbent was developed using radiation-induced graft polymerization with a cross-linked structure containing a highly stable adsorption ligand. The ligand, ammonium 12-molybdophosphate (AMP), was successfully introduced onto the fibrous polyethylene trunk material. The resulting Cs adsorbent contained 36% nonwoven fabric polyethylene (NFPE), 1% AMP, 2% triallyl isocyanurate (TAIC) and 61% glycidyl methacrylate (GMA). The adsorbent's Cs adsorption capacity was evaluated using batch and column tests. It was determined that the adsorbent could be used in a wide pH range. The amount of desorbed molybdenum, which can be used as an estimate for AMP stability on the Cs adsorbent, was minimized at the standard drinking water pH range of 5.8-8.6. Based from the inspection on the adherence of these results to the requirements set forth by the Food Sanitation Act by a third party organization, it can be concluded that the developed Cs adsorbent can be safely utilized for drinking water.

  17. Ion exchange performance of commercial crystalline silicotitanates for cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Braun, R.; Dangieri, T.J.; Fennelly, D.J. [and others

    1996-03-01

    A new class of inorganic ion exchangers called crystalline silicotitanates (CST), invented by researchers at Sandia National Laboratories and Texas A&M University, has been commercialized in a joint Sandia-UOP effort. The original developmental materials exhibited high selectivity for the ion exchange of cesium, strontium, and several other radionuclides from highly alkaline solutions containing molar concentrations of Na{sup +}. The materials also showed excellent chemical and radiation stability. Together, the high selectivity and stability of the CSTs made them excellent candidates for treatment of solutions such as the Hanford tank supernates and other DOE radwastes. Sandia National Laboratories and UOP have teamed under a Cooperative Research and Development Agreement (CRADA) to develop CSTs in the powdered form and in an engineered form suitable for column ion exchange use. A continuous-flow, column ion exchange process is expected to be used to remove Cs and other radionuclides from the Hanford supernatant. The powder material invented by the Sandia and Texas A&M team consists of submicron-size particles. It is not designed for column ion exchange but may be used in other applications.

  18. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  19. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    International Nuclear Information System (INIS)

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department's mission as stated in that document. ''The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.''

  20. Misinterpretation on the risk of radioactive cesium contained in the disaster wastes

    International Nuclear Information System (INIS)

    Osaka Prefectural Government accepted the disaster wastes contained radioactive cesium after investigation them during one year. I explained the process and discussed about the risk management by people and the self-government body. The environmental pollution by radioactive cesium and Act on Special Measures concerning the Handling of Pollution by Radioactive Materials, the progress of treatment of debris, the concentration of radioactive cesium in debris, the acceptance conditions of debris contained small amount of radioactive cesium, evaluation of effects of radioactive materials in debris on the environment, and citizen's opinion of Osaka prefecture are described. The important investigation area of radioactive contamination on the basis of Act on Special Measures concerning the Handling of Pollution by Radioactive Materials, total amount of waste from Fukushima nuclear accident and debris in Miyagi, Iwate and Fukushima prefecture, the concentration of radioactive cesium in debris in Rikuzentakata and Miyako city as of September, 2011, and cumulative number of citizen's opinion to Osaka are illustrated. (S.Y.)

  1. Local mat-forming cyanobacteria effectively facilitate decontamination of radioactive cesium in rice fields

    International Nuclear Information System (INIS)

    The most effective and widespread method to decontaminate radioactive cesium from the Fukushima Daiichi Nuclear Power Plant Disaster was peeling topsoil. But the method had problems, such as large amounts of discarded soil and large-scale work. In nature, cyanobacteria formed biomats on the ground surface and facilitated peeling topsoil when the biomats dried. The cyanobacteria-facilitating peeling decontamination method utilized these cyanobacterial properties. Cyanobacteria are located all over Japan and 'local' cyanobacteria could be used for decontamination without introducing new species. Utilizing cyanobacteria could decrease the amount of discarded soil to about 30% and downsize the execution-scale to individual locations. Cyanobacterial biomats were easily cultivated, especially in rice fields, by maintaining wet conditions and exposure to 100 - 83% solar radiation. Shading by a thin net was helpful in maintaining an environment suitable for cyanobacteria. Nowadays, to prevent uptake of radioactive cesium into rice, K+ is usually added to fertilizer in rice fields. The K+ fertilization in rice fields might also enhance cyanobacterial capture of radioactive cesium, because high concentrations of K+ enhanced cyanobacterial uptake of Cs+. Cyanobacteria could also mitigate the risk of radioactive cesium moving away from a decontaminating rice field. Therefore, the cyanobacteria-facilitating peeling decontamination method was proposed as an easy and safe 'D.I.Y.' method for both farmers and the environment. Besides, plowing rice fields with water before peeling improved the efficiency of this method, because plowing increased the radioactive cesium concentration in the topsoil. (author)

  2. Development program for magnetically assisted chemical separation: Evaluation of cesium removal from Hanford tank supernatant

    International Nuclear Information System (INIS)

    Magnetic particles (MAG*SEPSM) coated with various absorbents were evaluated for the separation and recovery of low concentrations of cesium from nuclear waste solutions. The MAG*SEPSM particles were coated with (1) clinoptilolite, (2) transylvanian volcanic tuff, (3) resorcinol formaldehyde, and (4) crystalline silico-titanate, and then were contacted with a Hanford supernatant simulant. Particles coated with the crystalline silico-titanate were identified by Bradtec as having the highest capacity for cesium removal under the conditions tested (variation of pH, ionic strength, cesium concentration, and absorbent/solution ratio). The MAG*SEPSM particles coated with resorcinol formaldehyde had high distribution ratios values and could also be used to remove cesium from Hanford supernant simulant. Gamma irradiation studies were performed on the MAG*SEPSM particles with a gamma dose equivalent to 100 cycles of use. This irradiation decreased the loading capacity and distribution ratios for the particles by greater than 75%. The particles demonstrated high sensitivity to radiolytic damage due to the degradation of the polymeric regions. These results were supported by optical microscopy measurements. Overall, use of magnetic particles for cesium separation under nuclear waste conditions was found to be marginally effective

  3. Efficiency of fly ash belite cement and zeolite matrices for immobilizing cesium.

    Science.gov (United States)

    Goñi, S; Guerrero, A; Lorenzo, M P

    2006-10-11

    The efficiency of innovative matrices for immobilizing cesium is presented in this work. The matrix formulation included the use of fly ash belite cement (FABC-2-W) and gismondine-type Na-P1 zeolite, both of which are synthesized from fly ash of coal combustion. The efficiency for immobilizing cesium is evaluated from the leaching test ANSI/ANS 16.1-1986 at the temperature of 40 degrees C, from which the apparent diffusion coefficient of cesium is obtained. Matrices with 100% of FABC-2-W are used as a reference. The integrity of matrices is evaluated by porosity and pore-size distribution from mercury intrusion porosimetry, X-ray diffraction and nitrogen adsorption analyses. Both matrices can be classified as good solidify systems for cesium, specially the FABC-2-W/zeolite matrix in which the replacement of 50% of belite cement by the gismondine-type Na-P1 zeolite caused a decrease of two orders of magnitude of cesium mean Effective Diffusion Coefficient (D(e)) (2.8e-09 cm(2)/s versus 2.2e-07 cm(2)/s, for FABC-2-W/zeolite and FABC-2-W matrices, respectively). PMID:16759800

  4. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    Directory of Open Access Journals (Sweden)

    Houssni El-Saied

    2013-01-01

    Full Text Available In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+ on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the kaolin. Paper handsheets were prepared containing various percentages of the modified kaolin. The mechanical and optical properties of paper handsheets were studied. The prepared paper handsheets were irradiated by gamma irradiation using different doses. Fourier transform infrared (FTIR spectroscopy was used to study the effect of kaolin modification by cesium and gamma irradiation on paper handsheets properties. The results indicated that modified kaolin enhanced the mechanical and optical properties of paper handsheets. Electron spin resonance (ESR spectroscopy and laser-induced breakdown spectroscopy (LIBS were also used. They provided rapid, sensitive and nondestructive techniques in differentiating between different questioned documents. This study presents a new concept in manufacturing security papers and anticounterfeiting applications.

  5. Cesium-137 in soil texture fractions and its impact on Cesium-137 soil-to-plant transfer

    International Nuclear Information System (INIS)

    Field studies at two sites contaminated by the Chernobyl fallout showed 137Cesium (Cs) soil-to-plant transfer factors in wheat, rye and potato. Transfer values ranged from 0.0017 (potato tuber) to 0.07 (wheat straw). Generally transfer coefficients in cereal grains and potato tubers were significantly below the values of the shoots. A comparison of the two sites led to the conclusion that for all plants investigated 137Cs transfer factors were higher in Lower Austria (Calcic Chernozem) than in Upper Austria (Eutric Cambisol). The specific activities of the texture fractions of the two soil types increased from sand to silt and clay. In the Calcic Chernozem the ratio of the 137Cs activity in the silt fraction to the total activity in the soil was considerably higher than in the Eutric Cambisol. At the same time extractability of 137Cs from the silt fraction of the latter soil was clearly lower. Both results mainly were attributed to the differences between the soils according to the organic matter content of the silt fractions, the Calcic Chernozem being seven times higher. Therefore, the differences in the 137Cs-soil-to-plant transfer can be attributed partly to these soil characteristics. (authors)

  6. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms; Sympathetisches Kuehlen in einer Rubidium-Caesium-Mischung: Erzeugung ultrakalter Caesiumatome

    Energy Technology Data Exchange (ETDEWEB)

    Haas, M.

    2007-07-01

    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m{sub f}=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m{sub f}=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m{sub f}=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The

  7. Comparison of organic and inorganic ion exchange materials for removal of cesium and strontium from tank waste

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G. [Pacific Northwest National Lab., Richland, WA (United States)

    1996-10-01

    This work is part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. Pacific Northwest National Laboratory (PNNL) staff are investigating novel ion exchangers for use in nuclear waste remediation (groundwater, high-level waste (HLW), and low-level waste (LLW)). Waste components targeted for remediation include cesium, strontium, and technetium.

  8. Cesium and Strontium Specific Exchangers for Nuclear Waste Effluent Remediation

    International Nuclear Information System (INIS)

    During the past 50 years, nuclear defense activities have produced large quantities of nuclear waste that now require safe and permanent disposal. The general procedure to be implemented involves the removal of cesium and strontium from the waste solutions for disposal in permanently vitrified media. This requires highly selective sorbents or ion exchangers. Further, at the high radiation doses present in the solution, organic exchangers or sequestrants are likely to decompose over time. Inorganic ion exchangers are resistant to radiation damage and can exhibit remarkably high selectivities. We have synthesized three families of tunnel-type ion exchangers. The crystal structures of these compounds as well as their protonated phases, coupled with ion exchange titrations, were determined and this information was used to develop an understanding of their ion exchange behavior. The ion exchange selectivities of these phases could be regulated by isomorphous replacement of the framework metals by larger or smaller radius metals. In the realm of layered compounds, we prepared alumina, silica, and zirconia pillared clays and sodium micas. The pillared clays yielded very high Kd values for Cs+ and were very effective in removing Cs+ from groundwaters. The sodium micas also had a high affinity for Cs+ but an even greater attraction for S42+. They also possess the property of trapping these ions permanently as the layers slowly decrease their interlayer distance as loading occurs. Sodium nonatitanate exhibited extremely high Kd values for Sr2+ in alkaline tank wastes and should be considered for removal of Sr2+ in such cases. For tank wastes containing complexing agents, we have found that adding Ca2+ to the solution releases the complexed Sr2+ which may then be removed with the CST exchanger

  9. Understanding of amount and dynamics of radioactive cesium deposited on trees in Fukushima

    Energy Technology Data Exchange (ETDEWEB)

    Endo, Izuki; Ohte, Nobuhito; Iseda, Kohei; Tanoi, Keitaro; Hirose, Atsushi; Kobayashi, Natsuko I. [The University of Tokyo, 113-8657, 1-1-1 Yayoi Bunkyo-ku, Tokyo (Japan); Ishii, Nobuyoshi [National Institute of Radiological Sciences, 263-8555, 4-9-1 Anagawa, Inage-ku, Chiba-shi, Chiba (Japan); Ohashi, Mizue [University of Hyogo, 670-0092, 1-1-12 Shinzaike-Honcho, Himeji, Hyogo (Japan)

    2014-07-01

    The accident of Fukushima Daiichi nuclear power plant after the earthquake and Tsunami in March 11, 2011 caused large amount of radioactive cesium ({sup 134}Cs, {sup 137}Cs) deposition onto the forest in the surrounding areas. River water from the forest area is used for food production and also for drinking water in these regions. In order to predict how radioactive Cs diffuse and discharge from the forest catchments, it is important to understand the amount and dynamics of radioactive Cs deposited on the trees. In this report, we show our preliminary results of {sup 137}Cs deposition in forest. Study was conducted in the forest at the upstream of Kami-Oguni River catchment, northern part of Fukushima Prefecture. Three plots (2 deciduous stands and 1 Japanese cedar (Cryptomeria japonica) plantation) were set in the forest. Quercus serrata and C. japonica, a representative of deciduous and evergreen tree species in this region, were chosen from each plot. Sample trees were logged in October 2012. Stem samples were collected every 2 m from above the ground to tree top and separated into bark, sapwood and heartwood. Litter traps were set in each plot and collected every month. Leaf litter was classified among species. Also, soil samples were collected in the cylinder of 5 cm in diameter and maximum 30 cm in depth from the forest floor every month. {sup 137}Cs concentration of all samples were measured by germanium semiconductor detector or NaI(Tl) scintillation counter. Deposited {sup 137}Cs was attached strongly on the bark of Q. serrata at high concentration (9-18 kBq/kg) but there were no clear relationship with tree height. In C. japonica, {sup 137}Cs concentration was about half times lower than that of Q. serrata at 0-10 m part of the tree. {sup 137}Cs concentration in wood of C. japonica was higher than Q. serrata. {sup 137}Cs concentration of sapwood was as high as that of heartwood in C. japonica, but in Q. serrata, {sup 137}Cs concentration in sapwood was

  10. Immobilisation and solidification of cesium on 11 A calcium silicate hydroxy hydrate column

    International Nuclear Information System (INIS)

    Calcium silicate hydrate closely resembling silicate mineral 11 A tobermorite has been synthesised by hydrothermal treatment of lime and silica at 175 degC. The synthetic mineral exhibits selectivity for Cs+ in the presence of strong solutions of alkali and alkaline earth cations, viz, Na+, K+, Mg2+, Ca2+, Sr2+, etc. The Al-substituted form of this mineral effectively separates cesium ion when used as an exchanger in column of size 35x5 mm (hxr). It is possible to remove 98.65±0.5%Cs+ from a mixed solution of cesium and sodium (0.0001N Cs+ + 0.5N Na+). Column separation of cesium from simulated intermediate level waste solution shows that from the first run ∼ 76% Cs+ can be immobilised on a small column, 18x10mm (hxr), having 2.0 g of exchanger. (author)

  11. Studies of cesium and strontium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    Distribution coefficients (Ksub(d)) were measured for cesium and strontium in 16 samples of Canadian unconsolidated geological materials. The samples were collected to cover a wide range of grain size, clay-mineral composition, cation exchange capacity and carbonate mineral content. Distribution coefficients ranged between 102 and 2.0 x 104 ml/g for cesium and between 2.5 and 102 ml/g for strontium, indicating that most unconsolidated geological materials have a substantial ability to retard the migration of cesium, while strontium could generally be expected to be somewhat more mobile. The measured K values were not significantly correlated with the measured soil properties, but appeared to be significantly affected by the background concentration of stable isotopes of the respective radionuclides

  12. The effects of using Cesium-137 teletherapy sources as a radiological weapon (dirty bomb)

    CERN Document Server

    Liolios, Theodore

    2009-01-01

    While radioactive sources used in medical diagnosis do not pose a great security risk due to their low level of radioactivity, therapeutic sources are extremely radioactive and can presumably be used as a radiological weapon. Cobalt-60 and Cesium-137 sources are the most common ones used in radiotherapy with over 10,000 of such sources currently in use worldwide, especially in the developing world, which cannot afford modern accelerators. The present study uses computer simulations to investigate the effects of using Cesium-137 sources from teletherapy devices as a radiological weapon. Assuming a worst-case terrorist attack scenario, we estimate the ensuing cancer mortality, land contamination, evacuation area, as well as the relevant evacuation, decontamination, and health costs in the framework of the linear risk model. The results indicate that an attack with a Cesium-137 dirty bomb in a large metropolitan city (especially one that would involve several teletherapy sources) although would not cause any sta...

  13. Phosphate ceramic solidification and stabilization of cesium-containing crystalline silicotitanate resins.

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C. A.

    1999-05-11

    This paper reports on the fabrication and testing of magnesium potassium phosphate (MKP)-bonded cesium-loaded crystalline silicotitanate (CST) resins. Typical waste loading of CST resins in the final waste forms was 50 wt.%. Physical and chemical characterization of the MKP materials has shown them to be physically, chemically, and mineralogically stable. Long-term durability studies (using the AN 16.1 standard test) showed a leachability index of {approx}18 for cesium in the phosphate matrix when exposed to deionized water under ambient and elevated temperatures. Leaching of cesium was somewhat higher than in glass waste forms as per PCT and MCC-1 tests. MKP-based final waste forms showed no significant weight changes after exposure to aqueous media for {approx}90 days, indicating the highly insoluble nature of the phosphate matrix. In addition, durability of the CST-MKP waste forms was further established by freeze-thaw cycling tests.

  14. Reduction of cesium levels in the diet through management of food

    International Nuclear Information System (INIS)

    Several processes influence the radionuclide concentration of food products during processing: dilution, losses, concentration. Boiling of leaf vegetables yields a decontamination effect of up to 80% in the case of radioiodine. Peeling of potato tubers results in a reduction of the cesium concentration of 30%. The cesium and strontium concentration of flour is a factor of two lower as compared to the corresponding cereal grain due to the milling process. Significant discrimination occurs during the milk processing. The skimmed milk is significantly richer in cesium, iodine and especially in strontium than the cream. It follows that butter is depleted in its radionuclide contents as compared to other milk produce. Strontium is concentrated in the casein. Pressurized cooking in combination with salting or a treatment with acetic acid results in an Cs-activity loss of beef, veal and lamb meat of 50 to 90%. (Author) 3 figs., 7 tabs., 13 refs

  15. Continuous Separation of Cesium Based on NiHCF/PTCF Electrode by Electrochemically Switched Ion Exchange

    Institute of Scientific and Technical Information of China (English)

    孙斌; 郝晓刚; 王忠德; 张忠林; 刘世斌; 官国清

    2012-01-01

    Nickel hexacyanoferrate (NiHCF) film was synthesized on porous three-dimensional carbon felt (PTCF) substrate by repetitious batch chemical depositions, and the NiHCF/PTCF electrode was used as electrochemically switched ion exchange (ESIX) electrode in a packed bed for continuous separation for cesium ions. The morphologies of the prepared electrodes were characterized by scanning electron microscopy and the effects of solution concentration on the ion-exchange capacity of the electrodes were investigated by cyclic voltammetry technique. Cycling stability and long-term storage stability of NiHCF/PTCF electrodes were also studied. The NiHCF/PTCF electrodes with excellent ion-exchange ability were used to assemble a diaphragm-isolated ESIX reactor for cesium separation. Continuous separation of cesium and regeneration of NiHCF/PTCF electrode based on the diaphragm-isolated reactor were performed in a laboratory-scale two-electrode system.

  16. Synthesis and thermolysis of oxo chloro-2-ethyl-1.3.4-thiadiazole rhenium complex

    International Nuclear Information System (INIS)

    Present article is devoted to synthesis and thermolysis of oxo chloro-2-ethyl-1.3.4-thiadiazole rhenium complex. The synthesis method of oxo chloro-2-ethyl-1.3.4-thiadiazole rhenium complex is elaborated. The kinetics of its thermolysis process is studied. The thermodynamic functions of thermolysis process are evaluated.

  17. Uptake of {sup 134}Cs in the shoots of Amaranthus tricolor and Amaranthus cruentus

    Energy Technology Data Exchange (ETDEWEB)

    Tang Shirong; Chen Ziyuan; Li Hongyan; Zheng Jiemin

    2003-10-01

    Amaranthus tricolor and Amaranthus cruentus responded differently to {sup 134}Cs and addition of (NH{sub 4}){sub 2}SO{sub 4}. - Amaranthus tricolor L. and Amaranthus cruentus L. were grown in pots containing 7.5 kg soils artificially contaminated with three levels of {sup 134}Cs activity: 5.55x10{sup 5} Bq pot{sup -1}, 1.11x10{sup 6} Bq pot{sup -1}, and 1.665x10{sup 6} Bq pot{sup -1}, respectively. Forty-nine days after sowing and growth, plants were harvested. The plants growing in soils with increasing {sup 134}Cs concentrations showed increasing concentration of this radionuclide in shoots. There were significant differences in uptake of {sup 134}Cs applied to soils between and within the plant species, depending on the initial {sup 134}Cs concentrations. The plant species showed different responses to the addition of (NH{sub 4}){sub 2}SO{sub 4} to soils. Biomass production of both species was reduced in pots treated with (NH{sub 4}){sub 2}SO{sub 4}. (NH{sub 4}){sub 2}SO{sub 4} application decreased the uptake of {sup 134}Cs by A. tricolor but increased the accumulation of {sup 134}Cs by A. cruentus, showing that chemicals with the highest efficiency to enhance the desorption of {sup 134}Cs might play an unexpected role in transferring the radionuclide to shoots.

  18. 10 CFR 60.134 - Design of seals for shafts and boreholes.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Design of seals for shafts and boreholes. 60.134 Section....134 Design of seals for shafts and boreholes. (a) General design criterion. Seals for shafts and... closure. (b) Selection of materials and placement methods. Materials and placement methods for seals...

  19. Metabolic peculiarity of 134Cs and its radioimmunotoxicological effect on central and peripheral immune cells

    Institute of Scientific and Technical Information of China (English)

    朱寿彭; 夏芬

    1996-01-01

    A fitted equation with least square method to describe the retention of 134Cs in whole body is obtained by a whole body counter.That is R(t)=18.04exp(-9.3175t)+ 45.13exp(-0.0423t),where R(t) is in %,and t in d.The equationn consists of two half-life components,the fast component is T1/2=0.07d,and the slow is T1/2=16.14d,Study on the localization of 134Cs at cellular level was carried out by freezing microautoradiography.The results indicate of 134Cs at cellular level was carried out by freezing microautoradiography.The results indicate that 134Cs was chiefly in ionizing form accumulated in red as well as white blood cells.In bone marrow cells 134Cs predominantly deposited in young cells and less in mature cells.Distribution of 134Cs penetrated quickly into the tissue cells.The observation of investigating radioimmunotoxicological effect induced by 134Cs shows that the inhibition of thymocytes is higher than bone marrow cells,the spleen T lynmphocytes are more sensitive to 134Cs than B lymphocytes and lymphocytes of peripheral immune cells are more sensitive to radiation than central immune cells.

  20. Uptake of 134Cs in the shoots of Amaranthus tricolor and Amaranthus cruentus

    International Nuclear Information System (INIS)

    Amaranthus tricolor and Amaranthus cruentus responded differently to 134Cs and addition of (NH4)2SO4. - Amaranthus tricolor L. and Amaranthus cruentus L. were grown in pots containing 7.5 kg soils artificially contaminated with three levels of 134Cs activity: 5.55x105 Bq pot-1, 1.11x106 Bq pot-1, and 1.665x106 Bq pot-1, respectively. Forty-nine days after sowing and growth, plants were harvested. The plants growing in soils with increasing 134Cs concentrations showed increasing concentration of this radionuclide in shoots. There were significant differences in uptake of 134Cs applied to soils between and within the plant species, depending on the initial 134Cs concentrations. The plant species showed different responses to the addition of (NH4)2SO4 to soils. Biomass production of both species was reduced in pots treated with (NH4)2SO4. (NH4)2SO4 application decreased the uptake of 134Cs by A. tricolor but increased the accumulation of 134Cs by A. cruentus, showing that chemicals with the highest efficiency to enhance the desorption of 134Cs might play an unexpected role in transferring the radionuclide to shoots

  1. 13 CFR 134.401 - Scope of the rules in this subpart D.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Scope of the rules in this subpart D. 134.401 Section 134.401 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... finding(s) of social disadvantage, economic disadvantage, ownership or control pursuant to § 124.206...

  2. 13 CFR 134.505 - What are the requirements for an appeal petition?

    Science.gov (United States)

    2010-01-01

    ... Law, U.S. Small Business Administration, 409 3rd Street, SW., Washington, DC 20416, facsimile number... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.505 Section 134.505 Business Credit and Assistance SMALL BUSINESS...

  3. 13 CFR 134.705 - What are the requirements for an appeal petition?

    Science.gov (United States)

    2010-01-01

    ... Counsel for Procurement Law, U.S. Small Business Administration, 409 3rd Street, SW., Washington, DC 20416... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for an appeal petition? 134.705 Section 134.705 Business Credit and Assistance SMALL BUSINESS...

  4. 13 CFR 134.314 - Standard of review and burden of proof.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Standard of review and burden of proof. 134.314 Section 134.314 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF... law. The appellant has the burden of proof, by a preponderance of the evidence, in both size and...

  5. 13 CFR 134.407 - Evidence beyond the record and discovery.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence beyond the record and discovery. 134.407 Section 134.407 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF..., the Administrative Law Judge may not admit evidence beyond the written administrative record...

  6. 76 FR 10328 - Approval of Manufacturing Authority, Foreign-Trade Zone 134, Volkswagen Group of America...

    Science.gov (United States)

    2011-02-24

    ...-2009); Whereas, notice inviting public comment has been given in the Federal Register (74 FR 43670, 8... Foreign-Trade Zones Board Approval of Manufacturing Authority, Foreign-Trade Zone 134, Volkswagen Group of... of FTZ 134, has requested manufacturing authority on behalf of Volkswagen Group of...

  7. 19 CFR 134.12 - Foreign articles reshipped from a U.S. possession.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Foreign articles reshipped from a U.S. possession. 134.12 Section 134.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... articles reshipped from a U.S. possession. Articles of foreign origin imported into any possession of...

  8. Cesium removal from high-pH, high-salt wastwater using crystalline silicotitanate sorbent

    Energy Technology Data Exchange (ETDEWEB)

    Walker, J.F. Jr.; Taylor, P.A.; Lee, D.D.

    1997-11-01

    Treatment and disposal options for Department of Energy (DOE) underground storage tank waste at Hanford, Savannah River, and Oak Ridge National Laboratory (ORNL) are limited by high gamma radiation fields that are produced by high concentrations of cesium in the waste. Treatment methods are needed to remove the cesium from the liquid waste and thus concentrate the cesium into high-activity, remote-handled waste forms. The treated liquids could then be processed and disposed of by more cost-effective means with less radiation exposure to workers. A full-scale demonstration of one cesium removal technology is currently being conducted at ORNL. This demonstration utilizes a modular, mobile ion-exchange system and existing facilities for the off-gas system, secondary containment, and utilities. The ion-exchange material, crystalline silicotitanate (CST), was chosen on the basis of its effectiveness in laboratory tests. The CST, which was developed through a Cooperative Research and Development Agreement between DOE and private industry, has several advantages over current organic ion-exchange technologies. These advantages include (1) the ability to remove cesium in the presence of high concentrations of potassium, (2) a high affinity for cesium in both alkaline and acidic conditions, (3) physical stability over wide alkaline and acidic ranges, and (4) the elimination of large volumes of secondary waste required for regeneration of organic ion exchangers. Approximately 100,000 L of wastewater will be processed during the demonstration. The wastewater being processed has a high salt content, about 4 M NaNO{sub 3}, and a pH of 12 to 13. This paper discusses the results of the full-scale demonstration and compares these results with data from the laboratory tests.

  9. Separation of cesium from simulated active waste using zinc hexacyanoferrate supported composite

    International Nuclear Information System (INIS)

    Potassium zinc hexacyanoferrate (KZnHCF) was prepared and supported on polyacrylonitrile (PAN) binding polymer. This composite was characterized and used to study the elimination of cesium from acidic radioactive waste containing Sr(II), Eu(II), Am(II), Zr(IV), Hf(IV) and Nb(V) using batch and column techniques. The sorption capacity of this composite for cesium was found to be 1.14 meq/g for column technique. The effect of presence of NH4SCN, NaNo3 and other complexing agents in the aqueous solutions was studied

  10. A preliminary deposit model for lithium-cesium-tantalum (LCT) pegmatites

    Science.gov (United States)

    Bradley, Dwight; McCauley, Andrew

    2013-01-01

    This report is part of an effort by the U.S. Geological Survey to update existing mineral deposit models and to develop new ones. We emphasize practical aspects of pegmatite geology that might directly or indirectly help in exploration for lithium-cesium-tantalum (LCT) pegmatites, or for assessing regions for pegmatite-related mineral resource potential. These deposits are an important link in the world’s supply chain of rare and strategic elements, accounting for about one-third of world lithium production, most of the tantalum, and all of the cesium.

  11. Heat Transfer During Evaporation of Cesium From Graphite Surface in an Argon Environment

    Directory of Open Access Journals (Sweden)

    Bespala Evgeny

    2016-01-01

    Full Text Available The article focuses on discussion of problem of graphite radioactive waste formation and accumulation. It is shown that irradiated nuclear graphite being inalienable part of uranium-graphite reactor may contain fission and activation products. Much attention is given to the process of formation of radioactive cesium on the graphite element surface. It is described a process of plasma decontamination of irradiated graphite in inert argon atmosphere. Quasi-one mathematical model is offered, it describes heat transfer process in graphite-cesium-argon system. Article shows results of calculation of temperature field inside the unit cell. Authors determined the factors which influence on temperature change.

  12. Synthesis of novel calixcrown derivatives with selective complexation towards cesium ions

    Institute of Scientific and Technical Information of China (English)

    Lu Zhang; Juan Du; Li Hua Yuan; Dong Zhang; Gui Ping Dan; Yuan You Yang; Wen Feng

    2011-01-01

    A series of novel calix [4]arenecrown-6 derivatives with an alkenyl loop of various sizes 5-8 were synthesized via intramolecular ring closing olefin metathesis and characterized by 1H NMR, 13C NMR and ESI-HRMS. Their complexation property towards cesium ion was studied by 'H NMR technique. Two-phase extraction of alkali metal ions using UV-vis spectroscopy revealed remarkably different extractabilities. These results indicate that the complexation capacities towards cesium ions can be tuned and controlled through cooperative regulation of the strain of the loop and conformational change of calixcrown skelton.

  13. Measurement of Ionization Threshold of Ultracold Cesium Rydberg Atoms in Static Electric Field

    Institute of Scientific and Technical Information of China (English)

    FENG Zhi-Gang; ZHANG Lin-Jie; ZHAO Jian-Ming; LI Chang-Yong; LI An-Ling; JIA Suo-Tang

    2008-01-01

    We investigate the field ionization spectra of ultracold cesium Rydberg atoms in dc electric field. The ionization thresholds of different electric fields are measured and shift of the ionization threshold relative to field-free ionization threshold is accurately described by (6.06±0.14) F1/2, which is in good agreement with the classical saddle-point model for field ionization. We obtain the field-free ionization threshold of cesium (6P,3/2) as 19674.89士2.99cm-1 by fitting experimental data.

  14. A direct frequency comb for two-photon transition spectroscopy in a cesium vapor

    Institute of Scientific and Technical Information of China (English)

    Zhang Yi-Chi; Wu Ji-Zhou; Li Yu-Qing; Jin Li; Ma Jie; Wang Li-Rong; Zhao Yan-Ting; Xiao Lian-Tuan; Jia Suo-Tang

    2012-01-01

    A phase-stabilized femtosecond frequency comb is used to measure high-resolution spectra of two-photon transition 62S1/2-62P1/2,3/2-82S1/2 in a cesium vapor.The broadband laser output from a femtosecond frequency comb is split into counter-propagating parts,shaped in an original way,and focused into a room-temperature cesium vapor.We obtain high-resolution two-photon spectroscopy by scanning the repetition rate of femtosecond frequency comb,and through absolute frequency measurements.

  15. Recent progress in optically-pumped cesium beam clock at Peking University

    Science.gov (United States)

    Liu, C.; Zhou, S.; Wan, J.; Wang, S.; Wang, Y.

    2016-06-01

    A compact, long-life, and low-drift cesium beam clock is investigated at Peking University, where the atoms are magnetic-state selected and optically detected. Stability close to that of the best commercial cesium clocks has been achieved from 10 to 105 s. As previously shown, the short-term stability is determined by atomic shot noise or laser frequency noise. The stabilizations of microwave power and C-field improve the long-term stability, with the help of a digital servo system based on field-programmable gate array.

  16. Separation of cesium from rad waste solutions with hexacyanoferrate(II) resins of copper and cobalt

    International Nuclear Information System (INIS)

    The separation of radiocesium from low and intermediate level waste solutions by ion exchange with potassium cobalt hexacyanoferrate(II) and potassium copper-cobalt hexacyanoferrate(II) loaded resins was studied. The distribution coefficient(Kd) of cesium as a function of sodium ion concentration was determined. High batch capacity of these resins with regards to cesium make them ideal sorbents that can be used in once through mode in the treatment of rad waste solutions. (author). 3 refs., 1 fig., 1 tab

  17. Concentration Ratios for Cesium and Strontium in Produce Near Los Alamos

    Energy Technology Data Exchange (ETDEWEB)

    S. Salazar, M.McNaughton, P.R. Fresquez

    2006-03-01

    The ratios of the concentrations of radionuclides in produce (fruits, vegetables, and grains) to the concentrations in the soil have been measured for cesium and strontium at locations near Los Alamos. The Soil, Foodstuffs, and Biota Team of the Meteorology and Air Quality Group of the Los Alamos National Laboratory (LANL) obtained the data at locations within a radius of 50 miles of LANL. The concentration ratios are in good agreement with previous measurements: 0.01 to 0.06 for cesium-137 and 0.1 to 0.5 for strontium-90 (wet-weight basis).

  18. Computational study of organo-cesium complexes and the possibility of lanthanide/actinide ions substitution

    Science.gov (United States)

    Rabanal-León, Walter A.; Martinez-Ariza, Guillermo; Roberts, Sue A.; Hulme, Christopher; Arratia-Pérez, Ramiro

    2015-11-01

    Relativistic DFT calculations suggest that two organo-cesium complexes studied herein afford large HOMO-LUMO gaps of around 2.4 eV with the PBE xc-functional, which accounts for their stability. Energy decomposition studies suggest these two complexes are largely ionic with about 20% covalency. However, when the Cs+ ions are substituted by the isoelectronic La3+ and Th4+, their predicted ionicity decreases significantly. The significant increase in covalence indicates that employing Ugi reaction cascades that afford tetramic acid-based organo-cesium complexes may be extended to La3+ and Th4+ organometallics.

  19. Effect of Deinococcus radiodurans on uptake of 134Cs by Brassica oleracea

    International Nuclear Information System (INIS)

    Deinococcus radiodurans was inoculated into the soil which was spiked with 134Cs to investigate its effect on chemical speciation of 134Cs. The relationship between chemical speciation of 134Cs and its absorbtion capacity by cabbage (Brassica oleracea) in the presence of D. radiodurans was also investigated. The results showed that an increase of 28.64%-38.17 % in content of 134Cs in residual phase was observed with presence of D. radiodurans in comparison with the aseptic control. The amounts of radiocesium uptaken by cabbage were about 12100Bq/g under aseptic conditions, however, which were about 8500Bq/g with the presence of D. radiodurans. The proportion of 134Cs taken up by cabbage decreased about 29% in comparison with the aseptic control. The chemical speciation could be influenced by D. radiodurans so that its uptake by plants could be reduced. (authors)

  20. {sup 134}Cs in heather seed plants grown with and without mycorrhiza

    Energy Technology Data Exchange (ETDEWEB)

    Strandberg, M. [Risoe National Laboratory, DK-4000 Roskilde (Denmark); Johansson, M. [Department of Mycology, Botanical Institute, University of Copenhagen, Oester Farimagsgade 2D, DK-1353 Copenhagen K. (Denmark)

    1988-08-01

    Experiments were carried out to determine differences between mycorrhized and non-mycorrhized seed plants of heather, Calluna vulgaris(L)Hull, as regards the uptake of {sup 134}Cs. In most treatments heather with mycorrhiza had a significantly higher transfer of {sup 134}Cs to the shoots than heather without mycorrhiza. As an average the concentration of {sup 134}Cs was 18% higher in the mycorrhized plants than in the non-mycorrhized. Application of 10 kg K/ha reduced the concentration of {sup 134}Cs in shoots of heather by 49% as an average. Because of improved growth in the potassium fertilized pots the reduction viewed on the basis of the area was only 33%. Nitrogen application does not significantly influence the concentration of {sup 134}Cs in shoots of heather regardless of mycorrhizal status. (Copyright (c) 1988 Elsevier Science B.V., Amsterdam. All rights reserved.)

  1. Coordinated Multiwavelength Observations of PKS 0528+134 in Quiescence

    Science.gov (United States)

    Boettcher, Markus; Palma, N.

    2011-01-01

    We report results of an intensive multiwavelength campaign on the prominent high-redshift (z = 2.06) gamma-ray bright blazar PKS 0528+134 in September - October 2009. The campaign was centered on four 30 ksec pointings with XMM-Newton, supplemented with ground-based optical (MDM, Perkins) and radio (UMRAO, Medicina, Metsaehovi, Noto, SMA) observations as well as long-term X-ray monitoring with RXTE and gamma-ray monitoring by Fermi. We find significant variability on 1 day time scales in the optical regime, accompanied by a weak redder-when-brighter trend. X-ray variability is found on longer ( 1 week) time scales, while the Fermi light curve shows no evidence for variability, neither in flux nor spectral index. We constructed four simultaneous spectral energy distributions, which can all be fit satisfactorily with a one-zone leptonic jet model. This work was supported by NASA through XMM-Newton Guest Observer Grant NNX09AV45G.

  2. Triaxiality and exotic rotations at high spins in 134Ce

    Science.gov (United States)

    Petrache, C. M.; Guo, S.; Ayangeakaa, A. D.; Garg, U.; Matta, J. T.; Nayak, B. K.; Patel, D.; Carpenter, M. P.; Chiara, C. J.; Janssens, R. V. F.; Kondev, F. G.; Lauritsen, T.; Seweryniak, D.; Zhu, S.; Ghugre, S. S.; Palit, R.

    2016-06-01

    High-spin states in 134Ce have been investigated using the 116Cd(22Ne,4 n ) reaction and the Gammasphere array. The level scheme has been extended to an excitation energy of ˜30 MeV and spin ˜54 ℏ . Two new dipole bands and four new sequences of quadrupole transitions were identified. Several new transitions have been added to a number of known bands. One of the strongly populated dipole bands was revised and placed differently in the level scheme, resolving a discrepancy between experiment and model calculations reported previously. Configurations are assigned to the observed bands based on cranked Nilsson-Strutinsky calculations. A coherent understanding of the various excitations, both at low and high spins, is thus obtained, supporting an interpretation in terms of coexistence of stable triaxial, highly deformed, and superdeformed shapes up to very high spins. Rotations around different axes of the triaxial nucleus, and sudden changes of the rotation axis in specific configurations, are identified, further elucidating the nature of high-spin collective excitations in the A =130 mass region.

  3. X-ray imaging performance of structured cesium iodide scintillators.

    Science.gov (United States)

    Zhao, Wei; Ristic, Goran; Rowlands, J A

    2004-09-01

    Columnar structured cesium iodide (CsI) scintillators doped with Thallium (Tl) have been used extensively for indirect x-ray imaging detectors. The purpose of this paper is to develop a methodology for systematic investigation of the inherent imaging performance of CsI as a function of thickness and design type. The results will facilitate the optimization of CsI layer design for different x-ray imaging applications, and allow validation of physical models developed for the light channeling process in columnar CsI layers. CsI samples of different types and thicknesses were obtained from the same manufacturer. They were optimized either for light output (HL) or image resolution (HR), and the thickness ranged between 150 and 600 microns. During experimental measurements, the CsI samples were placed in direct contact with a high resolution CMOS optical sensor with a pixel pitch of 48 microns. The modulation transfer function (MTF), noise power spectrum (NPS), and detective quantum efficiency (DQE) of the detector with different CsI configurations were measured experimentally. The aperture function of the CMOS sensor was determined separately in order to estimate the MTF of CsI alone. We also measured the pulse height distribution of the light output from both the HL and HR CsI at different x-ray energies, from which the x-ray quantum efficiency, Swank factor and x-ray conversion gain were determined. Our results showed that the MTF at 5 cycles/mm for the HR type was 50% higher than for the HL. However, the HR layer produces approximately 36% less light output. The Swank factor below K-edge was 0.91 and 0.93 for the HR and HL types, respectively, thus their DQE(0) were essentially identical. The presampling MTF decreased as a function of thickness L. The universal MTF, i.e., MTF plotted as a function of the product of spatial frequency f and CsI thickness L, increased as a function of L. This indicates that the light channeling process in CsI improved the MTF of

  4. Physical barrier effect of geopolymeric waste form on diffusivity of cesium and strontium.

    Science.gov (United States)

    Jang, J G; Park, S M; Lee, H K

    2016-11-15

    The present study investigates the physical barrier effect of geopolymeric waste form on leaching behavior of cesium and strontium. Fly ash-based geopolymers and slag-blended geopolymers were used as solidification agents. The leaching behavior of cesium and strontium from geopolymers was evaluated in accordance with ANSI/ANS-16.1. The diffusivity of cesium and strontium in a fly ash-based geopolymer was lower than that in Portland cement by a factor of 10(3) and 10(4), respectively, showing significantly improved immobilization performance. The leaching resistance of fly ash-based geopolymer was relatively constant regardless of the type of fly ash. The diffusivity of water-soluble cesium and strontium ions were highly correlated with the critical pore diameter of the binder. The critical pore diameter of the fly ash-based geopolymer was remarkably smaller than those of Portland cement and slag-blended geopolymer; consequently, its ability physically to retard the diffusion of nuclides (physical barrier effect) was superior.

  5. Immobilisation of radio cesium loaded ammonium molybdo phosphate in glass matrices

    International Nuclear Information System (INIS)

    Long half life and easy availability from high level wastes make 137Cesium most economical radiation source. High level liquid waste processing for 137 Cesium removal has become easier due to development of Cesium specific granulated ammonium molybdophosphate (AMP) composite. In such applications, resulting spent composite AMP itself represents high active solid waste and immobilization of these materials in cement may not be acceptable. Studies on immobilization of 137Cs loaded AMP were taken up in order to achieve twin goals of increasing safety and minimizing processing costs of the final matrix. Studies indicated that phosphate modified sodium borosilicate SPNM glasses prepared under usual oxidizing conditions are not suitable for immobilization of 137Cs loaded on AMP .Phosphate glasses containing Na2O, P2O5, B2O3, Fe2O3, Al2O3 and SiO2 as major constituents are capable of incorporating 6 to 8 % AMP. The Normalized Leach rates of these glasses for sodium, cesium, boron and silica are 10-4 to 10-6 gm/cm2/day which are comparable to or better than those reported for NBS glasses incorporating HLW. Homogeneity of the final matrix was confirmed by x-ray diffraction analysis. Further studies on characterization of these glasses would establish their acceptability. (author)

  6. Removal of cesium ions from waste solution using sericite incorporated into nickel hexacyanoferrate

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Choong; Cha, Ju-Hyun [Gangneung-Wonju National University, Wonju (Korea, Republic of)

    2015-11-15

    To increase adsorption capacity and selectivity for cesium ions from waste solution, sericite was chemically modified by means of nickel hexacyanoferrate (NiHCF) with a high selectivity trap agent for cesium. Scanning electron microscopy (SEM) and energy dispersive X-ray (EDX) spectroscopy were used for the characteristic analysis of surface onto the NiHCF-sericite. The adsorption capacity of cesium ions for the NiHCF-sericite increased about 2.5 times, as compared with natural sericite at initial pH 5.0 of waste solution. Adsorption equilibrium was investigated by Langmuir and Freundlich isotherm model, respectively. Maximum adsorption capacity was estimated as 16.583mg/g, and the Langmuir isotherm fits the adsorption data better than Freundlich model. The adsorption process was determined as an exothermic reaction and all adsorption was completed in 30 min. In addition, the adsorption capacity of cesium ions was not greatly affected by ionic strength (-0.1M NaCl concentration) and other metals in mixed waste solution.

  7. Assessment of commercially available ion exchange materials for cesium removal from highly alkaline wastes

    Energy Technology Data Exchange (ETDEWEB)

    Brooks, K.P.; Kim, A.Y.; Kurath, D.E.

    1996-04-01

    Approximately 61 million gallons of nuclear waste generated in plutonium production, radionuclide removal campaigns, and research and development activities is stored on the Department of Energy`s Hanford Site, near Richland, Washington. Although the pretreatment process and disposal requirements are still being defined, most pretreatment scenarios include removal of cesium from the aqueous streams. In many cases, after cesium is removed, the dissolved salt cakes and supernates can be disposed of as LLW. Ion exchange has been a leading candidate for this separation. Ion exchange systems have the advantage of simplicity of equipment and operation and provide many theoretical stages in a small space. The organic ion exchange material Duolite{trademark} CS-100 has been selected as the baseline exchanger for conceptual design of the Initial Pretreatment Module (IPM). Use of CS-100 was chosen because it is considered a conservative, technologically feasible approach. During FY 96, final resin down-selection will occur for IPM Title 1 design. Alternate ion exchange materials for cesium exchange will be considered at that time. The purpose of this report is to conduct a search for commercially available ion exchange materials which could potentially replace CS-100. This report will provide where possible a comparison of these resin in their ability to remove low concentrations of cesium from highly alkaline solutions. Materials which show promise can be studied further, while less encouraging resins can be eliminated from consideration.

  8. Transfer of radioactive cesium from soil to rape plants, rape blossoms and rape honey

    International Nuclear Information System (INIS)

    Due to the test of atomic weapons and the accident in the nuclear power plant at Chernobyl, the vegetation in Germany has been exposed to cesium contamination in the soil. It was to be expected that activity would migrate from soil to plants and to food products. In this work, the transfer of radioactive cesium from soil to rape plants (Brassica napus var. oleifera), rape blossoms and further to rape honey was investigated. By measuring the gamma activity of cesium using germanium detectors with measuring capacity up to 30 h per sample (limit of detection about 0.14 Bq/kg to 0.19 Bq/kg), we determined a mean transfer factor fcs = 0,116 ± 0,080 for the system soil-rape plant, fcs = 0.065 + 0.075 for the system soil-rape blossom and F!S = 0.098 + 0.044 for the system soil-rape honey (plants and honey wet mass, soil dry mass) (Table IV). Additionally, for the transfer of cesium from rape plants to rape honey, a factor of fcs = 2.04 ± 7.23 (both wet mass) was determined. Due to some environmental circumstances, which can hardly ever be taken into account, the results obtained sometimes differ considerably. Nevertheless, the mean transfer factors are within the range of values found in literature (Table V)

  9. Cesium-137 and americium-241 distribution by granulometric fractions of soil at Azgir test site grounds

    International Nuclear Information System (INIS)

    In measurements of radionuclide specific content in surface soil layer of contaminated territories it is important to determine in what agglomerations of soil particles there is the highest radionuclide concentration. For this purpose granulometric composition of soil at Azgir test site was studied and cesium-137 and americium-241 distribution by soil fractions was researched. (author)

  10. Strontium-90 and cesium-137 in sea fish (from Jun. 1982 to Dec. 1982)

    International Nuclear Information System (INIS)

    Strontium-90 and cesium-137 in sea fish (from Jun. to Dec. 1982) were determined. Fish was collected from 22 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are sown in a table. (Namekawa, K.)

  11. Strontium-90 and cesium-137 in sea fish (from Nov. 1982 to Jun. 1983)

    International Nuclear Information System (INIS)

    Strontium-90 and cesium-137 in sea fish (from Nov. 1982 to Jun. 1983) were determined. Fishes were collected from eight sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are shown in a table. (J.P.N.)

  12. Strontium-90 and cesium-137 in sea fish (from Oct. 1981 to Jun. 1982)

    International Nuclear Information System (INIS)

    Strontium-90 and cesium-137 in sea fishes (from Oct. 1981 to Jun. 1982) were determined. Fish was collected from eight sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are shown in a table. (Namekawa, K.)

  13. Leachability of cobalt and cesium from natural and chemically treated zeolites

    International Nuclear Information System (INIS)

    The determination of leachability of radioisotopes of cesium and cobalt from preloaded zeolites in distilled water, base solution and acid solution has been studied. For the experiment, we used natural and chemically treated zeolites. The zeolites before leaching were calcined at different temperatures. (author). 8 refs., 5 figs., 2 tabs

  14. Nanophotonic hybridization of narrow atomic cesium resonances and photonic stop gaps of opaline nanostructures

    NARCIS (Netherlands)

    Harding, P.J.; Pinkse, P.W.H.; Mosk, A.P.; Vos, W.L.

    2015-01-01

    We study a hybrid system consisting of a narrow-band atomic optical resonance and the long-range periodic order of an opaline photonic nanostructure. To this end, we have infiltrated atomic cesium vapor in a thin silica opal photonic crystal. With increasing temperature, the frequencies of the opal'

  15. Electromagnetically-induced transparency in a multi-V-type system in cesium atomic vapour

    Institute of Scientific and Technical Information of China (English)

    赵建明; 尹王保; 汪丽蓉; 肖连团; 贾锁堂

    2002-01-01

    Electromagnetically-induced transparency is observed in a three-level multi-V-type system in cesium vapour atroom temperature. The absorption property is measured and the hyperfine structures of atomic states can be determined.The results of the experiment agree with the theoretical analysis.

  16. Dual cesium and rubidium atomic fountain with a 10-16 level accuracy and applications

    International Nuclear Information System (INIS)

    Atomic fountains are the most accomplished development of the atomic clocks based on the cesium atom whose hyperfine resonance defines the SI second since 1967. Today these systems are among those which realize the second with the best accuracy. We present the last developments of the cold cesium and rubidium atom dual fountain experiment at LNE-SYRTE. This unique dual setup would allow to obtain an outstanding resolution in fundamental physics tests based on atomic transition frequency comparisons. In order to enable operation with both atomic species simultaneously, we designed, tested and implemented on the fountain new collimators which combine the laser lights corresponding to each atom. By comparing our rubidium fountain to another cesium fountain over a decade, we performed a test of the stability of the fine structure constant at the level of 5 * 10-16 per year. We carried on the work on the clock accuracy and we focused on the phase gradients effects in the interrogation cavity and on the microwave leakage. The fountain accuracy has been evaluated to 4 * 10-16 for the cesium clock and to 5 * 10-16 for the refurbished rubidium clock. As a powerful instrument of metrology, our fountain was implicated in many clock comparisons and contributed many times to calibrate the International Atomic Time. Furthermore, we used the fountain to perform a new test of Lorentz local invariance. (author)

  17. Cesium Sorption from Concentrated Acidic Tank Wastes Using Ammonium Molybdophosphate-polyacrylonitrile Composite Sorbents

    Energy Technology Data Exchange (ETDEWEB)

    Todd, Terry Allen; Mann, Nicholas Robert; Tranter, Troy Joseph; Sebesta, F.; John, J.; Motl, A.,

    2002-10-01

    Ammonium molybdophosphate-polyacrylonitrile (AMP-PAN) composite sorbents have been evaluated for the removal of cesium from Idaho National Engineering and Environmental Laboratory (INEEL) concentrated acidic tank waste. Batch contacts were performed to qualitatively evaluate the effects of increased nitric acid, sodium and potassium. An equilibrium isotherm was generated with simulated concentrated tank waste solutions and fit to the Langmuir equation. Additional batch contact experiments were performed to determine if mercury, plutonium and americium would sorb onto AMP-PAN. Dynamic sorption was evaluated in column tests employing 1.5 cm3 columns operating at 5, 10 and 20 bed volumes of flow per hour. Results indicate, as expected, that dynamic cesium sorption capacity is reduced as the flowrate is increased. Calculated dynamic capacities for cesium were 22.5, 19.8 and 19.6 mg Cs/g sorbent, for 5, 10 and 20 bed volume per hour flows, respectively. The thermal stability of loaded AMP-PAN was evaluated by performing thermogrovimetric analysis (TGA) on samples of AMP, PAN (polymer), and AMP-PAN. Results indicate that AMP-PAN is stable to 400 °C, with less than a 10% loss of weight, which is at least partially due to loss of water of hydration. The evaluation of AMP-PAN indicates that it will effectively remove cesium from concentrated acidic tank waste solutions.

  18. Sorption behavior of cesium from aqueous solution on magnetic hexacyanoferrate materials

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hengxuan; Zhao, Xuan, E-mail: zhxinet@tsinghua.edu.cn; Wei, Jiying; Li, Fuzhi

    2014-08-15

    Highlights: • A novel pathway of synthesizing magnetic hexacyanoferrate material was developed. • The synthesized material can offer a high capacity for sorption of cesium. • The material can offer a fast removal of cesium in kinetic performance. • The fine M-PTH particle can be easily separated from wastewater for recirculation. - Abstract: The rapid development of the nuclear power plant in China leads to increasing attention to the treatment of low-level radioactive wastewater (LLRW). One of possibilities is the application of inorganic adsorbent like potassium titanium hexacyanoferrate (PTH), which can exhibit the effective adsorption of cesium. In this paper, the PTH material was optimized by means of being loaded on magnetite substrate. The synthesized material (magnetic PTH, M-PTH), with a particle size of less than 100 nm, can offer a high capacity and favorable kinetic performance, however, without difficulties of separation from the LLRW due to its magnetic characterizations. The batch experiments demonstrate that cesium sorption isotherm of M-PTH coincide well with Langmuir model. The calculated capacity amounts to 0.517 mmol/g, approximately 1.5 times the capacity of zeolite materials. The sorption process follows the pseudo-second-order sorption model. In the initial phase the rate-controlling step is intraparticle diffusion. With the Cs accumulation on the particle surface, external diffusion performs an important role together with intraparticle diffusion.

  19. Z' indication from new APV data in Cesium and searches at linear colliders

    OpenAIRE

    Casalbuoni, R.; De Curtis, S.; Dominici, D.; Gatto, R.; Riemann, S.

    2000-01-01

    New data on parity violation in atomic cesium can be explained by a new neutral vector boson almost unmixed with Z, with a mass in the TeV range and sizeable couplings to the fermions. The properties of such additional Z' can be investigated at future linear colliders.

  20. Cobalt-60 and cesium-137 for the sterilization of food. Radiation treatment of food

    International Nuclear Information System (INIS)

    The brief article discusses the reasons justifying in the eyes of the authors the irradiation of food with ionizing readiation, the irradiation technique applied using cobalt-60 and cesium-137 as a radiation source, and the possible secondary effects of the method. (VHE)

  1. High-temperature cesium capture using activated kaolinite in the presence of chlorine and volatile heavy metals

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee Chul; Kim, Jeoung Guk; Yoo, Jae Hyung; Kim, Joon Hyung [KAERI, Taejon (Korea, Republic of); Yoon, Jong Sung [Chungnam National Univ., Taejon (Korea, Republic of)

    2002-05-01

    This study investigated the use of porous activated kaolin particles in the size range of 300- 400 {mu}m as high-temperature sorbents for cesium capture in the presence of chlorine and/or in the presence of cadmium and lead. Packed bed sorption tests by passing CsCl-carrying flue gas through the packed bed of activated porous kaolin particles were first performed at the temperature range of 973-1173 K and a CsCl partial pressure range of 7.4-11.1 Pa. The observed structural change of the sorbent mineral at the stage of sorption revealed the characteristics of an irreversible chemical reaction as a major cesium capturing mechanism. In the fully saturated kaolin sorbent, Cs{sub 2}O{center_dot}Al{sub 2}O{sub 3}{center_dot}SiO{sub 2} is present as a sorption reaction product, together with much smaller amount of water-soluble cesium species. The increase in sorbent bed temperature resulted in an increase in the rate of sorption, but it had no effect on maximum cesium uptake. In the presence of other condensable gas-phase metal chlorides such as cadmium and lead, cesium was preferentially adsorbed onto tested activated kaolinite, but a half of cesium appeared to be physically-sorbed cesium species, CsCl.

  2. Foliar uptake of cesium, iodine and strontium and their transfer to the edible parts of beans, potatoes and radishes

    Science.gov (United States)

    Oestling, O.; Kopp, P.; Burkart, W.

    Considerable fractions of radionuclide solutions deposited on the surface of the leaves may be transferred to the edible parts of plants. In radishes we observed a transfer of more than 40% of the applied cesium radioisotope within a few days. A rather similar uptake was found for beans and potatoes when harvested a month after application of radioactivity. As much as 60% of the applied cesium-isotope remained in (or on) the potato leaves even 8 days after application. The major part could however be washed off the leaves a few hours after application. When radishes were showered with water within 7 h after the application of activity the uptake was greatly reduced. No competitive effect of potassium chloride for the foliar uptake of cesium was found. A 10 -2 M colloidal suspension of Prussian Blue, a chelating agent for monovalent alkali metals such as potassium, cesium, or other monovalent cations, applied as droplets to the leaves one day prior to application of active cesium was found to strongly inhibit the transfer of cesium to the radish. The transfer of iodine and strontium to the edible parts was found to be negligible (or slower) as compared to cesium. In most cases no detectable amounts of these two nuclides were transfered to the edible parts of the radish after 2-5 weeks.

  3. 134Cs transfer factors to green gram and soybean as influenced by waste mica

    International Nuclear Information System (INIS)

    Greenhouse pot culture experiment was carried out to study the 134Cs transfer factors from soils to green gram and soybean as influenced by waste mica application (0, 10, 20, 40 g mica kg−1 soil) and compared with muriate of potash (MOP) application (0.17 g kg−1 soil). For the study, the soils were contaminated with 134Cs radionuclide 37 kBq kg−1 soil. The shoot biomass and K uptake by crops were significantly improved with waste mica application (40 g kg−1 soil). Compared to control, waste mica and MOP application significantly improved the yield, K content in plant and its uptake. Amongst the soils, crops grown in vertisol recorded higher shoot biomass compared to inceptisol and ultisol. Irrespective of the treatments, higher 134Cs transfer factors were seen in ultisol (0.30) as compared to inceptisol (0.16) and vertisol (0.13). It was observed that higher the K concentration in soil and plant, lowered 134Cs transfer to green gram and soybean. The study recommended that waste mica 20 g kg−1 would be useful for checking the 134Cs transfer factors from soils to green gram and soybean. - Highlights: ►Effect of waste mica on 134Cs transfer factors (TF) to green gram and soybean was studied. ►134Cs TF were higher in ultisol as compared to inceptisol and vertisol. ►Higher the K concentration in shoot drastically lowered 134Cs TF to crops. ►Waste mica 20 g/kg was useful to check 134Cs TF without compromising on crop yield.

  4. Ion exchange kinetics of cesium for various reaction designs using crystalline silicotitanate, UOP IONSIV IE-911

    Science.gov (United States)

    Kim, Sung Hyun

    Through collaborative efforts at Texas A&M University and Sandia National Laboratories, a crystalline silicotitanate (CST), which shows extremely high selectivity for radioactive cesium removal in highly concentrated sodium solutions, was synthesized. The effect of hydrogen peroxide on a CST under cesium ion exchange conditions has been investigated. The experimental results with hydrogen peroxide showed that the distribution coefficient of cesium decreased and the tetragonal phase, the major component of CST, slowly dissolved at hydrogen peroxide concentrations greater than 1 M. A simple and novel experimental apparatus for a single-layer ion exchange column was developed to generate experimental data for estimation of the intraparticle effective diffusivity. A mathematical model is presented for estimation of effective diffusivities for a single-layer column of CST granules. The intraparticle effective diffusivity for Cs was estimated as a parameter in the analytical solution. By using the least square method, the effective diffusivities of 1.56 +/- 0.14 x 10-11 m2/s and 0.68 +/- 0.09 x 10-11 m2/s, respectively, were obtained. The difference in the two values was due to the different viscosities of the solutions. A good fit of the experimental data was obtained which supports the use of the homogeneous model for this system. A counter-current ion exchange (CCIX) process was designed to treat nuclear waste at the Savannah River Site. A numerical method based on the orthogonal collocation method was used to simulate the concentration profile of cesium in the CCIX loaded with CST granules. To maximize cesium loading onto the CST and minimize the volume of CST, two design cases of a moving bed, where the fresh CST is pulsed into the column at certain periods or at certain concentration of cesium, were investigated. Simulation results showed that cesium removal behavior in the pilot-scale test of CCIX experiment, where the column length is 22 ft and the CST is pulsed

  5. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    Energy Technology Data Exchange (ETDEWEB)

    Schultz, F.J.; Tompkins, J.A.; Haff, K.W.; Case, F.N.

    1981-07-01

    Twenty-seven fully loaded /sup 137/Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 1500/sup 0/C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of /sup 137/Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded /sup 137/Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10/sup -10/ kg m/sup -2/s/sup -1/, while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10/sup -12/ kg m/sup -2/s/sup -1/. The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level /sup 137/Cs aluminosilicate pellets were 1.29 x 10/sup -16/m/sup 2/s/sup -1/, 6.88 x 10/sup -17/m/sup 2/s/sup -1/, and 1.35 x 10/sup -17/m/sup 2/s/sup -1

  6. Biosorption of cesium by native and chemically modified biomass of marine algae: introduce the new biosorbents for biotechnology applications

    Energy Technology Data Exchange (ETDEWEB)

    Jalali-Rad, R. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of)]. E-mail: rjalali@aeoi.org.ir; Ghafourian, H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Asef, Y. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Dalir, S.T. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Sahafipour, M.H. [Department of Biotechnology, Nuclear Research Center, Atomic Energy Organization of Iran, Tehran (Iran, Islamic Republic of); Gharanjik, B.M. [Offshore Fisheries Research Center, Chabahar (Iran, Islamic Republic of)

    2004-12-10

    Biosorption batch experiments were conducted to determine the cesium binding ability of native biomass and chemically modified biosorbents derived from marine algae, namely ferrocyanide algal sorbents type 1 and type 2 (FASs1 and FASs2). The applicability of the Langmuir and Freundlich isotherms for representation of the experimental data was investigated. The cesium sorption performances of the various types of sorbents were compared using the maximum capacities (q{sub max} values) obtained from fitting the Langmuir isotherm to the values calculated from the sorption experiments, which FASs type 1 and type 2 showed better sorption performances for cesium. FASs1 and FASs2 derived from formaldehyde and glutaraldehyde crosslinked Padina australis exhibited lower sorption capacities than those prepared from the non-crosslinked one. Most of the cesium ions were bound to FASs1, derived from Sargassum glaucescens and P. australis, in <2 min and equilibrium reached within the first 30 min of contact. Biosorption of cesium by FASs1 derived from P. australis and Cystoseria indica was constantly occurred at a wide range of pH, between 1 and 10, and the highest removal took place at pH 4. The presence of sodium and potassium at 0.5 and 1 mM did not inhibit cesium biosorption by algae biomass. The maximum cesium uptake was acquired using the large particles of FAS2 originated from S. glaucescens (2-4 mm). Desorption of cesium from the metal-laden FASs1 (from P. australis, S. glaucescens and Dictyota indica) was completely achieved applying 0.5 and 1 M NaOH and KOH, although the cesium sorption capacity of the biosorbents (from C. indica and S. glaucescens) decreased by 46-51% after 9 sorption-desorption cycles.

  7. 19 CFR 134.46 - Marking when name of country or locality other than country of origin appears.

    Science.gov (United States)

    2010-04-01

    ... than country of origin appears. 134.46 Section 134.46 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Method and Location of Marking Imported Articles § 134.46 Marking when name of country or locality other than country of...

  8. Performance modeling of an integral, self-regulating cesium reservoir for the ATI-TFE

    International Nuclear Information System (INIS)

    This work covers the performance modeling of an integral metal-matrix cesium-graphite reservoir for operation in the Advanced Thermionic Initiative-Thermionic Fuel Element (ATI-TFE) converter configuration. The objectives of this task were to incorporate an intercalated cesium-graphite reservoir for the 3C24Cs→2C36Cs+Cs(g) two phase equilibrium reaction into the emitter lead region of the ATI-TFE. A semi two-dimensional, cylindrical TFE computer model was used to obtain thermal and electrical converter output characteristics for various reservoir locations. The results of this study are distributions for the interelectrode voltage, output current density, and output power density as a function of axial position along the TFE emitter. This analysis was accomplished by identifying an optimum cesium pressure for three representative pins in the ATI ''driverless'' reactor core and determining the corresponding position of the graphite reservoir in the ATI-TFE lead region. The position for placement of the graphite reservoir was determined by performing a first-order heat transfer analysis of the TFE lead region to determine its temperature distribution. The results of this analysis indicate that for the graphite reservoirs investigated the 3C24Cs→2C36Cs+Cs(g) equilibrium reaction reservoir is ideal for placement in the TFE emitter lead region. This reservoir can be directly coupled to the emitter, through conduction, to provide the desired cesium pressure for optimum performance. The cesium pressure corresponding to the optimum converter output performance was found to be 2.18 torr for the ATI core least power TFE, 2.92 torr for the average power TFE, and 4.93 torr for the maximum power TFE

  9. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    International Nuclear Information System (INIS)

    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe3O4 nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired

  10. An isotope dilution-precipitation process for removing radioactive cesium from wastewater

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, Harold, E-mail: rogers22@llnl.gov [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA, 94550 (United States); Bowers, John; Gates-Anderson, Dianne [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, CA, 94550 (United States)

    2012-12-15

    Highlights: Black-Right-Pointing-Pointer Developed an isotope dilution-precipitation treatment process for Cs-137 contaminated water. Black-Right-Pointing-Pointer Waste seeded with non-radioactive Cs-133 prior to precipitation with sodium tetraphenylborate. Black-Right-Pointing-Pointer Final Cs-137 concentrations below DOE discharge limit of 3.0 Multiplication-Sign 10{sup -6} {mu}Ci/mL can be achieved. Black-Right-Pointing-Pointer Synthetic wastewater, and industrial low level radioactive proof of principle studies completed. - Abstract: A novel isotope dilution-precipitation method has been developed to remove cesium-137 from radioactive wastewater. The process involves adding stable cesium chloride to wastewater in order to raise the total cesium concentration, which then allows both the stable and radioactive cesium ions to be precipitated together using sodium tetraphenylborate. This process was investigated utilizing laboratory solutions to determine stable cesium dose rates, mixing times, effects of pH, and filtration requirements. Once optimized, the process was then tested on synthetic wastewater and aqueous low-level waste. Experiments showed the reaction to be very quick and stable in the pH range tested, 2.5-11.5. The wastewater may need to be filtered using a 0.45-{mu}m filter, though ferric sulfate has been shown to promote coagulation and settling, thereby eliminating the necessity for filtration. This investigation showed that this isotope dilution-precipitation process can remove Cs-37 levels below the U.S. Department of Energy's (DOE) Derived Concentration Standard (DCS) of 3.0 Multiplication-Sign 10{sup -6} {mu}Ci/mL using a single dosage, potentially allowing the wastewater to be discharged directly to sanitary sewers.

  11. Synthesis of Iron-ferrocyanide functionalized magnetic nanocluster for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Man; Jang, Sung-Chan; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-10-15

    In the present study, magnetite nanocluster was synthesized by hydrothermal method, and coated with iron ferrocyanide for the adsorption of cesium in an aqueous solution through simple addition of iron ferrocyanide in acid condition. We describe the morphology, structure, and physical property of these nanoparticles. In addition, their ability to eliminate cesium from water was also evaluated. In this study, we fabricated Iron ferrocyanide immobilized magnetite nanocluster (IFC-MNC) using hydrothermal methods. The CIFC-MNC exhibited easy separation ability from water by an external magnet, and showed a high removal efficiency of cesium in aqueous solutions. Therefore, the IFC-MNC demonstrated good potential for the treatment of water contaminated with radioactive cesium. gnetic nanoadsorbents composed of a magnetic particles core and functional shell, which adsorb the contaminants, has attracted significant attention in environmental remediation owing to their high surface area and unique superparamagnetism. The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment. Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. Among various adsorbents to treat Cs-137 contaminated water, metal ferrocyanides were widely applied to remove the Cs-137 in water. For better separation of metal ferrocyanide from water, recently, our group reported the fabrication of copper ferrocyanide-functionalized magnetic nanoparticles (Cu-FC-EDA-MNPs) using alkoxysilanes, having ethylenediamine (EDA) group, modified Fe{sub 3}O{sub 4} nanoparticles (EDA-MNPs) for the fast and easy magnetic separation of metal ferrocyanide. However, the fabrication method was multistep procedure. Thus, a more simplified fabrication procedure is still desired.

  12. Preparation and use of polymeric materials containing hydrophobic anions and plasticizers for separation of cesium and strontium

    International Nuclear Information System (INIS)

    Preparation and use is described for polymeric materials containing hydrophobic anions and plasticizers for extraction of cesium and strontium. The use of polymeric materials containing plasticizers which are solvents for hydrophobic anions such as derivatives of cobalt dicarbollide or tetraphenylborate which are capable of extracting cesium and strontium ions from aqueous solutions in contact with the polymeric materials, is described. The polymeric material may also include a synergistic agent for a given ion like polyethylene glycol or a crown ether, for removal of radioactive isotopes of cesium and strontium from solutions of diverse composition and, in particular, for solutions containing large excess of sodium nitrate

  13. Sorption and diffusion of cobalt, nickel, strontium, iodine, cesium and americium in natural fissure surfaces and drill core cups studied by autoradiography, 3

    International Nuclear Information System (INIS)

    This report summarizes the studies on sorption and diffusion of Cs, Sr, Co, Ni, Am and I in common rocks in Finnish bedrock carried out in laboratory experiments. Samples used in these studies were sections of drill cores containing filled and unfilled natural fracture surfaces and drill cores with a diamond drilled longitudinal cavity in the middle of the sample (drill core cups). Samples originated from the two nuclear power plant sites in Finland: tonalite and mica gneiss from Olkiluoto in Eurajoki and rapakivi granite from Haestholmen in Loviisa. The water used in the experiments was synthetic groundwater spiked at a time with one of the radionuclides: Cs-134, Sr-90, Co-60, Ni-63, Am-241 and I-125. Contact times from one week to one year were used to evaluate time dependence of diffusion. An autoradiographic method was used for determination of the penetration depths and diffusion pathways of elements. For determination of diffusion coefficients a quantitative computerized autoradiographic method was used to get the concentration profiles of the radionuclides in the drill cores. Sorption on natural fracture surfaces was more effective than on freshly drilled core samples. Filling materials on natural fracture surfaces, except calcite, increased sorption. The distribution coefficients for drill core cups were about the same as those for unfilled natural fracture surfaces after a contact time of one week and the sorption tendency of radionuclides was: Ka(Cs) > Ka(Co) > Ka(Am) > Ka(Ni) > Ka(Sr) > Ka(I). Radionuclides were observed to penetrate into fissures of the rock matrix and high-capacity minerals. Strontium was found as far as 35 mm in a filled natural fracture surface sample of rapakivi granite after a contact time of one year. The corresponding values were 3.0 mm for cesium, 2.1 mm for cobalt and 2.6 mm for nickel. For americium no diffusion could be observed (a-values for strontium was 6.6 x 10-16-1.1 x 10-13 m2/s, for cesium 4.7 x 10-16-7.2 x 10-15 m2/s

  14. Increase in HFC-134a emissions in response to the success of the Montreal Protocol

    Science.gov (United States)

    Fortems-Cheiney, A.; Saunois, M.; Pison, I.; Chevallier, F.; Bousquet, P.; Cressot, C.; Montzka, S. A.; Fraser, P. J.; Vollmer, M. K.; Simmonds, P. G.; Young, D.; O'Doherty, S.; Weiss, R. F.; Artuso, F.; Barletta, B.; Blake, D. R.; Li, S.; Lunder, C.; Miller, B. R.; Park, S.; Prinn, R.; Saito, T.; Steele, L. P.; Yokouchi, Y.

    2015-11-01

    The 1,1,1,2-tetrafluoroethane (HFC-134a), an important alternative to CFC-12 in accordance with the Montreal Protocol on Substances that Deplete the Ozone Layer, is a high global warming potential greenhouse gas. Here we evaluate variations in global and regional HFC-134a emissions and emission trends, from 1995 to 2010, at a relatively high spatial and temporal (3.75° in longitude × 2.5° in latitude and 8 day) resolution, using surface HFC-134a measurements. Our results show a progressive increase of global HFC-134a emissions from 19 ± 2 Gg/yr in 1995 to 167 ± 5 Gg/yr in 2010, with both a slowdown in developed countries and a 20%/yr increase in China since 2005. A seasonal cycle is also seen since 2002, which becomes enhanced over time, with larger values during the boreal summer.

  15. CONDENSATION HEAT TRANSFER OF R-134a IN A HELICAL PIPE

    Institute of Scientific and Technical Information of China (English)

    HAN Ji-tian; LIN Cheng-xian; EBADIAN M.A.

    2004-01-01

    Alternative refrigerant R-134a is considered to be ozone-friendly and a potential candidate for replacing the refrigerant R-12 in refrigeration and air-conditioning applications. This paper presents an experimental investigation on condensation heat transfer of the alternative refrigerant R134a flowing inside a helicoidal pipe with the cooling water flowing through the annular helicoidal passage in a counterflow direction. The heat transfer experiments were performed for R-134a mass flow flux ranging from 100 to 420 kg/m2 s with the superheat of the inlet vapor of 2. 8℃ and 8. 3℃, respectively. The average Nusselt numbers were experimentally determined for a helicoidal pipe with the helix axis of vertical direction. In addition, the obtained experimental results were compared with the results for R-134a condensation in straight and helicoidal pipes available in the open literature.

  16. Measurement of the effective thermal cross section of {sup 134}Cs by triple neutron capture reaction

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Shoji; Harada, Hideo; Katoh, Toshio [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro; Kobayashi, Katsutoshi; Motoishi, Shoji; Tanase, Masakazu

    1998-03-01

    The effective thermal cross section ({sigma}{sub eff}) of the {sup 134}Cs(n,{gamma}){sup 135}Cs reaction was measured by the activation method and the {gamma}-ray spectroscopic method in order to obtain fundamental data for research on the transmutation of nuclear wastes. The effective thermal cross section of the reaction {sup 134}Cs(n,{gamma}){sup 135}Cs was found to be 140.6{+-}8.5 barns. (author)

  17. EXPERIMENTAL PERFORMANCE OF R134a AND R152a USING MICROCHANNEL CONDENSER

    OpenAIRE

    Bhatkar, V. W.

    2015-01-01

    An experimental performance study on vapour compression refrigeration system with R134a and drop in substitute R152a with aluminium microchannel condenser was carried out for condensation temperature of 48°C while evaporation temperature varied from -10 to 15°C. Refrigerant charge of R152a was reduced by 40% over R134a with the microchannel condenser. Performance parameters like work input to the compressor, coefficient of performance, refrigerating capacity, condenser capacity and the produc...

  18. HFC-134a refrigerant gas hydrate formation process and RIN model

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    In this paper, the macroscopic visualization experiments of HFC-134a refrigerant gas hydrate formation are investigated. According to the macroscopic photos and Mori's microscopic photos of HFC-134a hydrate formation process, the mechanism of gas hydrate formation is analyzed.A random inducement nucleation model is presented to describe the hydrate formation process. The factors affecting the fractal growth dimension in the model, such as step,branch increment and angle, are discussed.``

  19. Removal of cesium using coconut fiber in raw and modified forms for the treatment of radioactive liquid wastes

    Energy Technology Data Exchange (ETDEWEB)

    Jesus, Nella N.M. de; Nobre, Vanessa B.; Potiens Junior, Ademar J.; Sakata, Solange K., E-mail: sksakata@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Di Vitta, Patricia B. [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Quimica

    2013-07-01

    Sorption is one of the most studied methods to reduce the volume of radioactive waste streams. Cesium-137 is a radioisotope formed by the fission of uranium and it can cause health problems due to its easy assimilation by cells. The aim of this study is to evaluate the potential of coconut fiber in removing cesium from radioactive liquid wastes; this process can help in disposing radioactive waste. The experiments were performed in batch and the particle size of the fiber ranged between 0.30 mm and 0.50 mm. The fiber was treated with hydrogen peroxide in alkaline medium. The following parameters were analyzed: contact time, pH and concentration of cesium ions in aqueous solution. After the experiments the samples were filtered and cesium remaining in solution was quantified by inductively coupled plasma optical emission spectrometry. (author)

  20. Frequency doubling with periodically poled KTiOPO4 at the fundamental wave of cesium D2 transition

    Institute of Scientific and Technical Information of China (English)

    Xiaoling Song; Zhigang Li; Pengfei Zhang; Gang Li; Yuchi Zhang; Junmin Wang; Tiancai Zhang

    2007-01-01

    @@ We report the continuous wave (CW) second harmonic generation (SHG) with a periodically poled KTiOPO4 (PPKTP) pumped by a diode laser at 852.356 nm, which is exactly resonant on the cesium D2 transition.

  1. Application of a composite sorbent based om natural and synthetic zeolites for cesium ion elimination from water solutions

    International Nuclear Information System (INIS)

    The study has been carried out to determine the effect of variations in the content of natural and synthetic zeolites, being the components of the composite sorbent, on the cesium sorption from the water solution

  2. Spin-dependent asymmetry functions in the elastic and inelastic electron-cesium scattering at intermediate energies

    International Nuclear Information System (INIS)

    In this thesis the measurements of the relative differential cross section, the exchange asymmetry, the spin-orbit asymmetry, and the interference asymmetry for the electron scattering on cesium atoms from 4 to 18 eV is described. (HSI)

  3. Cesium-137 in ash from combustion of biofuels. Application of regulations from the Swedish Radiation Safety Authority; Cesium-137 i aska fraan foerbraenning av biobraenslen. Tillaempning av Straalsaekerhetsmyndighetens regler

    Energy Technology Data Exchange (ETDEWEB)

    Sjoeblom, Rolf (Tekedo AB, Nykoeping (SE))

    2009-03-19

    The Swedish Radiation Safety Authority, SSM, has issued an ordinance on ash contaminated with Cesium-137. It implies amongst other things that ash containing 0,5 - 10 kBq/kg Cesium-137 (so-called contaminated ash) can be used for geotechnical purposes provided that the content in a near-by well does not exceed 1 Bq/litre and that the increase in a near-by fish producing recipient does not exceed 0,1 Bq/litre. The initial plan with the presently reported work was to provide a compilation of how the ordinance for Cesium-137 can be applied in practical work. It became evident, however, in the course of the work that issues related to the co-variation between potassium and Cesium needed further investigation. As a result, the present report comprises also a compilation of this extended information search. Cesium-137 is present in ash as a result of the accident in a nuclear power reactor in Chernobyl in 1986 during which material having a very small grain size was spread to a high altitude. A few days later, Cesium-137 was deposited during rains over large parts of Sweden. This activity penetrated to a depth of one or a few decimetres during the course of the subsequent few days and weeks, after which it was partially taken up by plants and spread in the ecosystem. Section 2 has the character of a handbook. It provides basic information on radiation, and also about the ordinance and other material from the SSI. Section 3 comprises compilations of relevant international status of knowledge. This regards how potassium and Cesium behave in soil and ash, and also how spreading of Cesium can be modelled. Cesium behaves similarly to Potassium but with the difference that Cesium is bonded much more strongly to mineral soil and ash. Potassium and Cesium appears in soil in four different forms: dissolved in the pore water, exchangeable, non-exchangeable and as bonded to minerals. The amount dissolved in the pore water is the smallest and that bonded to minerals is the largest

  4. The promotional effects of cesium promoter on higher alcohol synthesis from syngas over cesium-promoted Cu/ZnO/Al2O3 catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Jie; Cai, Qiuxia; Wan, Yan; Wan, Shaolong; Wang, Li; Lin, Jingdong; Mei, Donghai; Wang, Yong

    2016-09-02

    In this study, the promotional effects of cesium promoter on higher alcohol (C2+OH) synthesis from syngas over Cs-Cu/ZnO/Al2O3 catalysts were investigated using a combined experimental and theoretical density functional theory (DFT) calculation method. In the presence of cesium, the C2+OH productivity increases from 77.1 g•kgcat-1•h-1 to 157.3 g•kgcat-1•h-1 at 583 K due to the enhancement of the initial C–C bond formation. Detailed analysis of chain growth probabilities (CGPs) confirms that initial C–C bond formation is the rate-determining step in the temperature range of 543-583 K. Addition of cesium promoter significantly increases the productivities of 2-methyl-1-propanol, while the CGPs values (C3* to 2-methyl-C3*) is almost unaffected. With the assistance of cesium promoter, the CGPs of the initial C–C bond formation step (C1* to C2*) could be increased from 0.13 to 0.25 at 583 K. DFT calculations indicate that the initial C–C bond formation is mainly contributed by the HCO+HCO coupling reaction over the ZnCu(211) model surface. In the presence of the Cs2O, the stabilities of key reaction intermediates such as HCO and H2CO are enhanced which facilitates both HCO+HCO and HCO+H2CO coupling reaction steps with lower activation barriers over the Cs2O-ZnCu(211) surface. The promotional effects of cesium on the C2+OH productivity are also benefited from the competitive CH+HCO coupling reaction over CH hydrogenation that leads to lower alkane formation. In addition, Bader charge analysis suggests that the presence of cesium ions would facilitate the nucleophilic reaction between HCO and H2CO for initial C–C bond formation. This work was supported by the National Natural Science Foundation of China (No. 91545114 and No. 91545203). We appreciate the joint PhD scholarship support from the China Scholarship Council. The authors would also like to thank the support from Collaborative Innovation Center of Chemistry for Energy Materials (2011-iChEM). DM

  5. Sugar-metal ion interactions: the complicated coordination structures of cesium ion with D-ribose and myo-inositol.

    Science.gov (United States)

    Hu, Haijian; Xue, Junhui; Wen, Xiaodong; Li, Weihong; Zhang, Chao; Yang, Limin; Xu, Yizhuang; Zhao, Guozhong; Bu, Xiaoxia; Liu, Kexin; Chen, Jia'er; Wu, Jinguang

    2013-11-18

    The novel cesium chloride-D-ribose complex (CsCl·C5H10O5; Cs-R) and cesium chloride-myo-inositol complex (CsCl·C6H12O6; Cs-I) have been synthesized and characterized using X-ray diffraction and FTIR, FIR, THz, and Raman spectroscopy. Cs(+) is eight-coordinated to three chloride ions, O1 and O2 from one D-ribose molecule, O1 from another D-ribose molecule, and O4 and O5 from the third D-ribose molecule in Cs-R. For one D-ribose molecule, the oxygen atom O1 in the ring is coordinated to two cesium ions as an oxygen bridge, O2 is cocoordinated with O1 to one of the two cesium ions, and O4 and O5 are coordinated to the third cesium ion, respectively. O3 does not coordinate to metal ions and only takes part in forming hydrogen bonds. One chloride ion is connected to three cesium ions. Thus, a complicated structure of Cs-D-ribose forms. For Cs-I, Cs(+) is 10-coordinated to three chloride ions, O1 and O2 from one myo-inositol molecule, O3 and O4 from another myo-inositol molecule, O5 and O6 from the third myo-inositol molecule, and O6 from the fourth myo-inositol molecule. One metal ion is connected to four ligands, and one myo-inositol is coordinated to four Cs(+) ions, which is also a complicated coordination structure. Crystal structure results, FTIR, FIR, THz, and Raman spectra provide detailed information on the structure and coordination of hydroxyl groups to metal ions in the cesium chloride-D-ribose and cesium chloride-myo-inositol complexes.

  6. Mechanisms of desorption of 134Cs and 85Sr aerosols deposited on urban surfaces

    International Nuclear Information System (INIS)

    The radioactive isotopes of cesium and strontium may be deposited on urban surfaces in the case of an accidental atmospheric discharge from a nuclear facility and thus imply a health hazard. In order to handle the decontamination of these surfaces, we have carried out experiments under controlled conditions on tiles and concrete and we have studied the physical and chemical mechanisms at the solid-liquid interface. The deposition of radionuclides was carried out in the form of aerosols indicating an accidental source term. Their desorption by rainwater is low in all cases, of the order of 5-6% for cesium for any material and 29 and 12% for strontium on tile and concrete, respectively. The low desorption values of cesium may be explained by the strong bonding that occurs with the silicates constituting the tile due to virtually irreversible processes of exchange of ions and by the formation of insoluble complexes with the C-S-H gel of concrete. The strontium-tile bonds are weaker, while strontium precipitates with the carbonates of concrete in the form of SrCO3. In view of these characteristics, washing solutions with high concentrations of chloride and oxalate of ammonium chosen for their ion-exchanging and sequestering properties were tested on these surfaces. The desorption of cesium improved strongly since it reached 70% on tile and 90% on concrete after 24 h of contact, which is consistent with our knowledge of the bonds between this element and the surfaces. Strontium, given the greater complexity of physical and chemical forms that it may take is less well desorbed. The ammonium chloride improves the desorption (50% and 40%, for tile and concrete, respectively) but the oxalate, while it does not affect desorption on the tiles, decreases that on the concrete since by strongly etching the concrete, it causes the release of carbonate ions that precipitate with strontium

  7. Next Generation Extractants for Cesium Separation from High-Level Waste: From Fundamental Concepts to Site Implementation

    Energy Technology Data Exchange (ETDEWEB)

    Moyer, Bruce A; Bazelaire, Eve; Bonnesen, Peter V; Custelcean, Radu; Delmau, Laetitia H; Ditto, Mary E; Engle, Nancy L; Gorbunova, Maryna G; Haverlock, Tamara J; Levitskaia, Taiana G; Bartsch, Richard A; Surowiec, Malgorzata A; Zhou, Hui

    2005-07-06

    This project unites expertise at Oak Ridge National Laboratory (ORNL) and Texas Tech University (TTU, Prof. Richard A. Bartsch) to answer fundamental questions addressing the problem of cesium removal from high-level tank waste. Efforts focus on novel solvent-extraction systems containing calixcrown extractants designed for enhanced cesium binding and release. Exciting results are being obtained in three areas: (1) a new lipophilic cesium extractant with a high solubility in the solvent; (2) new proton-ionizable calixcrowns that both strongly extract cesium and "switch off" when protonated; and (3) an improved solvent system that may be stripped with more than 100-fold greater efficiency. Scientific questions primarily concern how to more effectively reverse extraction, focusing on the use of amino groups and proton-ionizable groups to enable pH-switching. Synthesis is being performed at ORNL (amino calixcrowns) and TTU (proton-ionizable calixcrowns). At ORNL, the extraction behavior is being surveyed to assess the effectiveness of candidate solvent systems, and systematic distribution measurements are under way to obtain a thermodynamic understanding of partitioning and complexation equilibria. Crystal structures obtained at ORNL are revealing the structural details of cesium binding. The overall objective is a significant advance in the predictability and efficiency of cesium extraction from high-level waste in support of potential implementation at U. S. Department of Energy (USDOE) sites.

  8. Next Generation Extractants for Cesium Separation from High-Level Waste: From Fundamental Concepts to Site Implementation

    Energy Technology Data Exchange (ETDEWEB)

    Moyer, Bruce A.; Bazelaire, Eve; Bonnesen, Peter V.; Custelcean, Radu; Delmau, Laetitia H.; Ditto, Mary E.; Engle, Nancy L.; Gorbunova, Maryna G.; Haverlock, Tamara J.; Levitskaia, Tatiana G.; Bartsch, Richard A.; Surowiec, Malgorzata A.; Zhou, Hui

    2005-07-06

    This project unites expertise at Oak Ridge National Laboratory (ORNL) and Texas Tech University (TTU, Prof. Richard A. Bartsch) to answer fundamental questions addressing the problem of cesium removal from high-level tank waste. Efforts focus on novel solvent-extraction systems containing calixcrown extractants designed for enhanced cesium binding and release. Exciting results are being obtained in three areas: (1) a new lipophilic cesium extractant with a high solubility in the solvent; (2) new proton-ionizable calixcrowns that both strongly extract cesium and ''switch off'' when protonated; and (3) an improved solvent system that may be stripped with more than 100-fold greater efficiency. Scientific questions primarily concern how to more effectively reverse extraction, focusing on the use of amino groups and proton-ionizable groups to enable pH-switching. Synthesis is being performed at ORNL (amino calixcrowns) and TTU (proton-ionizable calixcrowns). At ORNL, the extraction behavior is being surveyed to assess the effectiveness of candidate solvent systems, and systematic distribution measurements are under way to obtain a thermodynamic understanding of partitioning and complexation equilibria. Crystal structures obtained at ORNL are revealing the structural details of cesium binding. The overall objective is a significant advance in the predictability and efficiency of cesium extraction from high-level waste in support of potential implementation at U. S. Department of Energy (USDOE) sites.

  9. Experiments and simulations for the dynamics of cesium in negative hydrogen ion sources for ITER N-NBI

    Energy Technology Data Exchange (ETDEWEB)

    Gutser, Raphael

    2010-07-21

    The injection of fast neutral particles (NBI) into a fusion plasma is an important method for plasma heating and current drive. A source for negative deuterium ions delivering an 1 MeV beam that is accelerated to a specific energy and neutralized by a gas target is required for the ITER-NBI. Cesium seeding is required to extract high negative ion current densities from these sources. The optimization of the cesium homogeneity and control are major objectives to achieve the source requirements imposed by ITER. Within the scope of this thesis, the Monte Carlo based numerical transport simulation CsFlow3D was developed, which is the first computer model that is capable of simulating the flux and the accumulation of cesium on the surfaces of negative-ion sources. Basic studies that support the code development were performed at a dedicated experiment at the University of Augsburg. Input parameters of the ad- and desorption of cesium at ion source relevant conditions were taken from systematic measurements with a quartz micro balance, while the injection rate of the cesium oven at the ion source was determined by surface ionization detection. This experimental setup was used for further investigations of the work function of cesium-coated samples during plasma exposure. (orig.)

  10. Experiments and simulations for the dynamics of cesium in negative hydrogen ion sources for ITER N-NBI

    International Nuclear Information System (INIS)

    The injection of fast neutral particles (NBI) into a fusion plasma is an important method for plasma heating and current drive. A source for negative deuterium ions delivering an 1 MeV beam that is accelerated to a specific energy and neutralized by a gas target is required for the ITER-NBI. Cesium seeding is required to extract high negative ion current densities from these sources. The optimization of the cesium homogeneity and control are major objectives to achieve the source requirements imposed by ITER. Within the scope of this thesis, the Monte Carlo based numerical transport simulation CsFlow3D was developed, which is the first computer model that is capable of simulating the flux and the accumulation of cesium on the surfaces of negative-ion sources. Basic studies that support the code development were performed at a dedicated experiment at the University of Augsburg. Input parameters of the ad- and desorption of cesium at ion source relevant conditions were taken from systematic measurements with a quartz micro balance, while the injection rate of the cesium oven at the ion source was determined by surface ionization detection. This experimental setup was used for further investigations of the work function of cesium-coated samples during plasma exposure. (orig.)

  11. Possibilities of decontamination of fruit juices containing 134Cs and 137Cs

    International Nuclear Information System (INIS)

    The nuclear disaster of Chernobyl resulted in a regional contamination with radioactive cesium for certain fruit varieties in the subsequent harvesting period. The present paper first examines and compares the transfer of cesium from fruit into juice, applying different juice dejuicing techniques. The effect of conventional clarifying agents has been examined with regard to a possible reduction of the Cs-load in usual juice clarification procedures. In fact for the application of bentonite and kaolin a definite decrease of the radioactive cesium content has been found. The application of unconventional technological methods, especially the use of hexacyanoferrate-II ion exchangers, zeolites and strong acidic ion exchangers are tested and discussed as possibilities for further fruit juice decontamination. For that purpose potassium cobalt hexacyanoferrate-II (KKHCF), ammonium ferric hexacyanoferrate-II (AEHCF) as well as zeolites prove to have a high effectivity and good selectivity. The characterisation of the fruit juices is done by accompanied analyses of important fruit juice components. By indicating quality changes an evaluation of the applied procedures and clarifying agents applied is possible. (orig.)

  12. The beta strength function structure in \\beta + decay of lutecium, thulium and cesium isotopes

    CERN Document Server

    Alkhazov, G D; Naumov, Yu V; Orlov, S Yu; Vitman, V D

    1981-01-01

    The spectra of total gamma -absorption in the decays of some lutetium, thulium and cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in beta /sup +/ decay of light thulium and cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with mu /sub tau /=+1. This result is the first direct observation of the Gamov-Teller resonance in beta /sup +/ decay of nuclei with T/sub z/>0. (21 refs).

  13. Light storage via coherent population oscillation in a thermal cesium vapor

    CERN Document Server

    de Almeida, A J F; Maynard, M -A; Laupretre, T; Bretenaker, F; Felinto, D; Goldfarb, F; Tabosa, J W R

    2014-01-01

    We report on the storage of light via the phenomenon of Coherent Population Oscillation (CPO) in an atomic cesium vapor at room temperature. In the experiment the optical information of a probe field is stored in the CPO of two ground states of a Lambda three-level system formed by the Zeeman sublevels of the hyperfine transition F = 3 - F' = 2 of cesium D2 line. We show directly that this CPO based memory is very insensitive to stray magnetic field inhomogeneities and presents a lifetime which is mainly limited only by atomic motion. A theoretical simulation of the measured spectra was also developed and is in very good agreement with the experiment.

  14. Leaching Study in Immobilization of Cesium and Cobalt Radionuclides In Fly Ash- Zeolite Cement

    International Nuclear Information System (INIS)

    Fly ash-zeolite cement was synthesized from industrial by-product fly ash obtained from the thermal electric power station. The synthesis process is based on the hydrothermal-calcination-route of the fly ash. The microstructure of fly ash-zeolite cement was characterized by X-ray diffraction, FT infrared spectroscopy and surface area (F-N2). The efficiency of innovative matrices for immobilizing cesium and cobalt radionuclides is presented in this work. The aim of the present study is to investigate the possibility of solidifying 137Cs and 60Co radionuclides in synthetic fly ash zeolite cement. Leaching behavior of the radionuclides have been studied. The leachability index measured indicated that fly ash zeolite cement matrix can be utilized as an efficient material for immobilizing cesium and cobalt radionuclides than portland cement.

  15. Static and dynamic experiments for the retention of cesium in nitrate containing, nitric acid solutions

    International Nuclear Information System (INIS)

    The separation of cesium from medium active waste (MAW) of the Purex-Process by chromatographic methods is demonstrated using the inorganic ion exchanger ammoniummolybdatophosphate (AMP-1). Other inorganic exchangers like ammoniumhexacyanocobaltousferrate (NCFC), zirkoniumphosphate (ZPH) and antimonypentoxid (HAP) have shown for different pH-values a reasonable retention for cesium (NCFC (pH 12) : 35 g Cs/kgNCFC, ZPH(pH 7) : 100 g Cs/kgZPH and HAP (pH 2) : 55 g Cs/kgHAP). But with a high salt loading (300 g/l NaNO3) a loss of capacities occurs which does not allow the use of these exchangers, whereas AMP-1 is useful from a pH of 9 to conc. HNO3 with this high salt loadings with a capacity of 60 g Cs/kg AMP-1. (orig.)

  16. Kelvin probe studies of cesium telluride photocathode for the AWA photoinjector

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez, D.; Wisniewski, E. E.; Yusof, Z.; Harkay, K.; Spentzouris, L.; Terry, J. [Physics Department at Illinois Institute of Technology, Chicago, IL 60616 and High Energy Physics Division at Argonne National Laboratory, Lemont, IL 60439 (United States); High Energy Physics Division at Argonne National Laboratory, Lemont, IL 60439 (United States); Accelerator Science Division at Argonne National Laboratory, Lemont, IL 60439 (United States); Physics Department at Illinois Institute of Technology, Chicago, IL 60616 (United States)

    2012-12-21

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (> 1%), is robust in a photoinjector, and long lifetime. This photocathode is fabricated in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch ({approx}50 nC) in a long bunch train. We present some results from a study of the work function of cesium telluride photocathode using the Kelvin Probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV light exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating.

  17. Strontium-90 and cesium-137 in soil from May 1984 to July 1984

    International Nuclear Information System (INIS)

    Strontium-90 and cesium-137 in soil measured throughout Japan from May to July 1984 are given in pCi/kg and mCi/km2. Sampling points are total of 8 from Kawabe-gun (Akita) to Ibasuki-gun (Kagoshima). Collection and pretreatment of samples, preparation of samples for analysis, separation of strontium-90 and cesium-137, determination of stable strontium, calcium and potassium, and counting are described. Soil was collected from the location in the spacious and flat area without past disturbance on the surface. Soil was taken from two layers of different depths, 0 aproximately 5 cm and 5 approximately 20 cm. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 minutes. (Mori, K.)

  18. Characterization of cesium uptake mediated by a potassium transport system of bacteria in a soil conditioner

    International Nuclear Information System (INIS)

    We found that bacteria in a commercial soil conditioner sold in Ishinomaki, Miyagi, exhibited concentrative and saturable cesium ion (Cs+) uptake in the natural range of pH and temperature. The concentration of intracellular Cs+ could be condensed at least a few times higher compared with the outside medium of the cells. This uptake appeared to be mediated by a K+ transport system, since Cs+ uptake was dose-dependently inhibited by potassium ion (K+). Eadie-Hofstee plot analysis indicated that the Cs+ uptake involved a single saturable process. The maximum uptake amount (Jmax) was the same in the presence and absence of K+, suggesting that Cs+ and K+ uptakes were competitive with respect to each other. These bacteria might be useful for bioremediation of cesium-contaminated soil. (author)

  19. Low Level Gamma Spectroscopy Measurements of Radium and Cesium in Lucerne (Medicago Sativa)

    Science.gov (United States)

    Fokapić, S.; Bikit, I.; Mrđa, D.; Vesković, M.; Slivka, J.; Mihaljev, Ž.; Ćupić, Ž.

    2007-04-01

    Nineteen years after Chernobyl nuclear accident, activity concentration of 137Cs still could be detected in food and soil samples in Central and Eastern Europe. In this paper radiation levels of radium and cesium in Lucerne will be presented. It is a perennial plant with a deep root system and it is widely grown throughout the world as forage for cattle. The samples of Lucerne were taken from twelve different locations in Vojvodina in the summer period July-September 2004. The samples were specially dried on the air and after that ground, powdered and mineralized by method of dry burning on the temperature of 450°C. Gamma spectrometry measurements of the ash were performed by means of actively shielded germanium detector with maximal background reduction. For cesium 137Cs 10 mBq/kg order of magnitude detection limits were achieved.

  20. Determination of modelling parameter in the fluctuation and migration of Cesium in soils

    International Nuclear Information System (INIS)

    Cesium radionuclide is one of fission products with high level activity and long life, of about 30 years, therefore it is used as an indicator of a fission product released from a nuclear reactor or a radioactive waste storage. The migration process of cesium in soil is influent by physical and chemical properties of soil and environment in which the sorption process occurred. The data of the physical and chemical properties and the radionuclide retardation in such area are needed for the study of mathematical models of radionuclide migration. The experiment has been performed in laboratory by using soils with particle sizes of -4 - 4.48x10-2 cm/second; the longitudinal dispersivity 0.030 - 0.241 cm; the coefficient of longitudinal dispersion was 4.96x10-5 - 7.69x10-3 cm2/second and retardation factor was 2.30 - 3.39

  1. Chemical treatment of aqueous radioactive Cesium-137 waste using Ferri Chloride

    International Nuclear Information System (INIS)

    Ferric Chloride 6H2O was used for treatment of liquid radioactive wastes containing Cesium-137. Various concentration of ferric chloride 6H2O have been added into the waste at different pH and speed of stirrer. The treatment was based on the coagulans-flocculation and coprecipitation mechanisms. The best result of this experiment was achieved by adding 300 ppm of Ferric chloride 6 H2O into liquid waste on following condition the rate Stirrer was 250 rpm. At this condition, it was found that the separation efficiency and the decontamination factor were 83.32 % and 5.99. The activity of decreasing of aqueous radioactive Cesium-137 waste was 2.10 x 10-4 Ci/l to 3.50 x 10-5 Ci/l

  2. Spectroscopic approach for an electron EDM measurement using neutral cesium atoms

    Science.gov (United States)

    Zhu, Kunyan; Solmeyer, Neal; Weiss, David S.

    2012-06-01

    Observation of a permanent electric dipole moment of the electron (eEDM) would imply CP violating effects not contained in the Standard Model. We describe the state preparation and spectroscopy that will be used to measure the eEDM. Cesium atoms are guided into a measurement chamber, where they are laser-cooled and trapped in a pair of parallel one-dimensional optical lattices. The lattices thread three specially coated glass electric field plates. The measurement chamber is surrounded by a four layer magnetic shield inside of which eight magnetic field coils control the bias and gradient magnetic fields. A series of microwave and low frequency magnetic field pulses transfer the atoms into a superposition state that is sensitive to the eEDM signal. A measurement of the eEDM using neutral cesium atoms can obtain an ultimate shot noise limit of 3x10-30 e-cm.

  3. Adsorption of uranium, cesium and strontium onto coconut shell activated carbon

    International Nuclear Information System (INIS)

    The adsorption of uranium (VI), cesium and strontium ions from aqueous solutions onto a commercial activated carbon obtained by physical activation of coconut shell has been studied in batch systems. In particular the adsorption of uranium, studied as a function of contact time and metal ion concentration, followed pseudo-first-order kinetics. Equilibrium adsorption data were fitted by Langmuir and Freundlich isotherm models and the maximum adsorption capacity of the activated carbon resulted to be 55.32 mg/g. The study showed that the considered activated carbon could be successfully used for uranium adsorption from aqueous solutions. Feasibility of cesium and strontium adsorption onto the same activated carbon has been also investigated. Results showed that no affinities with both of these ions exist. (author)

  4. Stark spectra of Rydberg states in atomic cesium in the vicinity of n=18

    Institute of Scientific and Technical Information of China (English)

    Dong Hui-Jie; Wang Ting; Li Chang-Yong; Zhao Jian-Ming; Zhang Lin-Jie

    2013-01-01

    The Stark structures in a cesium atom around n =18 are numerically calculated.The results show that the components of 20D states with a small azimuthal quantum number |m| shift upward a lot,and those with a large |m| shift downward a little within 1100 V/cm.All components of P states shift downward.Experimental work has been performed in ultracold atomic cesium.Atoms initially in 6P3/2 state are excited to high-n Rydberg states by a polarization light perpendicular to the field,and Stark spectra with 丨m丨=1/2,3/2,5/2 are simultaneously observed with a large linewidth for the first time.The observed spectra are analyzed in detail.The relative transition probability is calculated.The experimental results are in good agreement with our numerical computation.

  5. Mössbauer study on the gamma radiolysis of anhydrous cesium tris (oxalato) ferrate(III)

    Science.gov (United States)

    Ladriere, J.; Senterre, V.; Apers, D.

    1992-04-01

    The final product of the gamma radiolysis of anhydrous cesium tris(oxalato) ferrate(III) has been identified by Mössbauer spectroscopy as Cs2Fe(ox)2. The radiolytic decomposition proceeds as a first-order process due to the original compound depletion and to the radiolytic stability of the ferrous compound. Lamb-Mössbauer factors measurements indicate that the recoilless fractions of the iron species are practically unaffected by the radiolysis.

  6. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    OpenAIRE

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru

    2012-01-01

    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/P...

  7. The effects of different factors at the cesium 137 accumulation by tree plants

    International Nuclear Information System (INIS)

    It was shown that cesium 137 accumulation by tree plants depended from numerous factors that had to be take into account by utilisation of forest production and conducting of forestry in the whole. It is necessary to elaborate a new classification of contaminated forests which could take into account not only radionuclide density of soils but existence of different tree species and their growth conditions

  8. Evaporative cooling of cesium atoms in the gravito-optical surface trap

    CERN Document Server

    Hammes, M; Grimm, R

    2000-01-01

    We report on cooling of an atomic cesium gas closely above an evanescent-wave. Our first evaporation experiments show a temperature reduction from 10muK down to 300nK along with a gain in phase-space density of almost two orders of magnitude. In a series of measurements of heating and spin depolarization an incoherent background of resonant photons in the evanescent-wave diode laser light was found to be the limiting factor at this stage.

  9. Quantized atomic motion in 1D cesium molasses with magnetic field

    International Nuclear Information System (INIS)

    We report the observation of quantized energy levels for the motion of cesium atoms in optical molasses consisting two counterpropagating σ+ beams and a small transverse magnetic field. The observation of overtones proves the existence of at least four bound states in each optical potential well. The absorption spectrum is dramatically modified when an additional longitudinal magnetic field is applied. In particular, a population inversion between quantized levels is observed. (orig.)

  10. Strategic Design and Optimization of Inorganic Sorbents For Cesium, Strontium and Actinides

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, D.; Nyman, M.; Clearfield, A.; Maginn, E.

    2006-06-01

    The basic science goal in this project identifies structure/affinity relationships for selected radionuclides and existing sorbents. The task will apply this knowledge to the design and synthesis of new sorbents that will exhibit increased affinity for cesium, strontium and actinide separations. The target problem focuses on the treatment of high-level nuclear wastes. The general approach can likewise be applied to nonradioactive separations.

  11. Development of an Advanced Polymeric Composite (ALIX) for separation of cesium from nuclear waste

    International Nuclear Information System (INIS)

    137Cs is one of the major isotopes present in high level radioactive waste (HLW). Its presence makes nuclear waste handling difficult. A new composite (ALIX) containing Ammonium molybdophosphate and a derivative of Bisphenol was developed for column operations to selectively remove cesium from acidic high level nuclear waste. The composite is stable in nitric acid, radiation field and exhibits fast kinetics for uptake. The properties of the composite are attributed to molecular structure of the polymer and morphology of the composite. (author)

  12. Prussian blue as an antidote for radioactive thallium and cesium poisoning

    Directory of Open Access Journals (Sweden)

    Altagracia-Martinez M

    2012-06-01

    Full Text Available Marina Altagracia-Martínez, Jaime Kravzov-Jinich, Juan Manuel Martínez-Núñez, Camilo Ríos-Castañeda, Francisco López-NaranjoDepartments of Biological Systems and Health Care, Biological and Health Sciences Division, Universidad Autónoma Metropolitana-Xochimilco, Mexico DF, MexicoBackground: Following the attacks on the US on September 11, 2001, potentially millions of people might experience contamination from radioactive metals. However, before the specter of such accidents arose, Prussian blue was known only as an investigational agent for accidental thallium and cesium poisoning. The purpose of this review is to update the state of the art concerning use of Prussian blue as an effective and safe drug against possible bioterrorism attacks and to disseminate medical information in order to contribute to the production of Prussian blue as a biodefense drug.Methods: We compiled articles from a systematic review conducted from January 1, 1960 to March 30, 2011. The electronic databases consulted were Medline, PubMed, the Cochrane Library, and Scopus.Results: Prussian blue is effective and safe for use against radioactive intoxications involving cesium-137 and thallium. The US Food and Drug Administration has approved Prussian blue as a drug, but there is only one manufacturer providing Prussian blue to the US. Based on the evidence, Prussian blue is effective for use against radioactive intoxications involving cesium-137 and thallium, but additional clinical research on and production of Prussian blue are needed.Keywords: Prussian blue, radioactive cesium, thallium, intoxication, biodefense drug

  13. Laser-pumped cesium magnetometers for high-resolution medical and fundamental research

    OpenAIRE

    Groeger, Stephan; Bison, Georg; Knowles, Paul E.; Wynands, Robert; Weis, Antoine

    2007-01-01

    Laser-pumped cesium magnetometers allow highly sensitive magnetometry at room temperature. We report on applications of that technique in biomagnetic diagnostics and in a neutron electric dipole moment (nEDM) experiment. In the biomagnetic application the magnetic field from the beating human heart is detected using a gradiometer, which reaches an intrinsic sensitivity of 80 fT/Hz1/2. The device can record time-resolved magnetic field maps above the human body surface with a spatial resolutio...

  14. Cesium under pressure: First-principles calculation of the bcc-to-fcc phase transition

    Science.gov (United States)

    Carlesi, S.; Franchini, A.; Bortolani, V.; Martinelli, S.

    1999-05-01

    In this paper we present the ab initio calculation of the structural properties of cesium under pressure. The calculation of the total energy is done in the local-density approximation of density-functional theory, using a nonlocal pseudopotential including the nonlinear core corrections proposed by Louie et al. The calculation of the pressure-volume diagram for both bcc and fcc structures allows us to prove that the transition from bcc to fcc structure is a first-order transition.

  15. Photoemission from Graphene on Copper and Cesium Antimonide: Theory and Experiment

    Science.gov (United States)

    Finkenstadt, Daniel; Jensen, Kevin L.; Lambrakos, Samuel G.; Shabaev, Andrew; Moody, Nathan A.

    The work function is calculated using DFT for a substrate of flat copper on which a single layer of graphene is deposited. These calculations show a reduced work function, compared to bare copper, when graphene is deposited on a cathode. Based on our DFT-calculated results, a simple model using the transfer matrix approach gives the transmission probability near and above the barrier maximum. An important element of our model is the DFT-calculated, macroscopically-averaged electrostatic potential. Using this potential, graphene behaves as a resonant well for electrons transmitted between the substrate and vacuum regions. Another system to be discussed is graphene atop cesium antimonide, which has very low work function making it technologically useful, in particular for the development of an x-ray free electron laser. On cesium antimonide, we examine whether graphene may allow for the retention of an underlying cesium layer that is often damaged in high-field applications. A discussion of these results in light of recent experimental characterization at LANL will be given. Funding and support provide by ONR and DOE.

  16. Strontium-90 and cesium-137 in soil from May to July 1983

    International Nuclear Information System (INIS)

    The measured values in soil of strontium-90 and cesium-137 at a total of 4 locations throughout Japan from May to July, 1983 are given in pCi/kg and mCi/km2 in the tables. The method of measurement is also described: collection and pretreatment of samples, preparation of the samples for analysis, separation of strontium-90 and cesium-137, determination of stable strontium, calcium and potassium, and counting. Soil was collected from the location in the spacious and flat area without any past disturbance. Soil was taken from two layers having different depths: 0--5 cm and 5--20 cm. The sample solution was neutralized with sodium hydroxide. After sodium carbonate was added, the precipitate of strontium and calcium carbonates was separated. The supernatant solution was retained for cesium-137 determination. After the radiochemical separation, the mounted precipitates were counted for activity using a low background beta counter normally for 60 min. The maximum values were 690 pCi/kg for Sr-90 and 1300 pCi/kg for Cs-137, which were obtained from the samples in the 5-to-20 cm depth, in June 1983, at Akita-ken,Japan. (Mori, K.)

  17. Enhanced capacity and stability for the separation of cesium in electrically switched ion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Tawfic, A.F.; Dickson, S.E.; Kim, Y. [McMaster University, Hamilton, ON (Canada); Mekky, W. [AMEC NSS, Power and Process America, Toronto (Canada)

    2015-03-15

    Electrically switched ion exchange (ESIX) can be used to separate ionic contaminants from industrial wastewater, including that generated by the nuclear industry. The ESIX method involves sequential application of reduction and oxidation potentials to an ion exchange film to induce the respective loading and unloading of cesium. This technology is superior to conventional methods (e.g electrodialysis reversal or reverse osmosis) as it requires very little energy for ionic separation. In previous studies, ESIX films have demonstrated relatively low ion exchange capacities and limited film stabilities over repeated potential applications. In this study, the methodology for the deposition of electro-active films (nickel hexacyanoferrate) on nickel electrodes was modified to improve the ion exchange capacity for cesium removal using ESIX. Cyclic voltammetry was used to investigate the ion exchange capacity and stability. Scanning electron microscopy (SEM) was used to characterize the modified film surfaces. Additionally, the films were examined for the separation of cesium ions. This modified film preparation technique enhanced the ion exchange capacity and improves the film stability compared to previous methods for the deposition of ESIX films. (authors)

  18. Kinetic and equilibrium studies of cesium adsorption on ceiling tiles from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Volchek, Konstantin, E-mail: Konstantin.Volchek@ec.gc.ca [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Kuang, Wenxing [SAIC Canada, 335 River Road, Ottawa, Ontario, K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, K1N 6N5 (Canada)

    2010-11-15

    A series of experiments were performed to quantify the adsorption of cesium on ceiling tiles as a representative of urban construction materials. Adsorption was carried out from solutions to mimic wet environmental conditions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. The experiments were performed in the range of initial cesium concentrations of 0.114-23.9 mg L{sup -1} at room temperature (21 deg. C) around three weeks. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectrometry (ICP-MS). The quantity of adsorbed Cs was calculated by mass balance as a function of time. Two kinetic and three equilibrium models were employed to interpret the test results. Determination of kinetic parameters for adsorption was carried out using the first-order reaction model and the intra-particle diffusion model. Adsorption equilibrium was studied using Langmuir, Freundlich and three-parameter Langmuir-Freundlich adsorption isotherm models. A satisfactory correlation between the experimental and the predicted values was observed.

  19. Derivation of cesium-137 residual radioactive material guidelines for the Peek Street site, Schenectady, New York

    Energy Technology Data Exchange (ETDEWEB)

    Jones, L.; Nimmagadda, M.; Yu, C.

    1992-01-01

    Residual radioactive material guidelines for cesium-137 were derived for the Peek rk. The derivation was based on the requirement that the Street site in Schenectady, New York. The derivation was based on the requirement that the 50-year committed effective dose equivalent to a hypothetical individual who lives or works in the immediate vicinity of the Peek Street site should not exceed a dose of 100 mrem/yr following remedial action. The US Department of Energy (DOE) residual radioactive material guideline computer code, RESRAD was used in this evaluation. Three potential scenarios were considered for the site on the assumption that for a period of 1,000 years following remedial action, the site wig be utilized without radiological restrictions. The scenarios vary with regard to use of the site, time spent at the site, and sources of food consumed. Results indicate that the basic dose limit of 100 mrem/yr will not be exceeded for cesium-137 within 1,000 years, provided that the soil concentration of cesium-137 at the Peek Street site does not exceed the following levels: 98 pCi/g for Scenario A (industrial worker: the expected scenario), 240 pCi/g for Scenario B (recreationist: a plausible scenario), and 34 pCi/g for Scenario C (resident farmer ingesting food produced in the decontaminated area: a plausible scenario).

  20. Cesium and strontium tolerant Arthrobacter sp. strain KMSZP6 isolated from a pristine uranium ore deposit.

    Science.gov (United States)

    Swer, Pynskhem Bok; Joshi, Santa Ram; Acharya, Celin

    2016-12-01

    Arthrobacter sp. KMSZP6 isolated from a pristine uranium ore deposit at Domiasiat located in North-East India exhibited noteworthy tolerance for cesium (Cs) and strontium (Sr). The strain displayed a high minimum inhibitory concentration (MIC) of 400 mM for CsCl and for SrCl2. Flow cytometric analysis employing membrane integrity indicators like propidium iodide (PI) and thiazole orange (TO) indicated a greater sensitivity of Arthrobacter cells to cesium than to strontium. On being challenged with 75 mM of Cs, the cells sequestered 9612 mg Cs g(-1) dry weight of cells in 12 h. On being challenged with 75 mM of Sr, the cells sequestered 9989 mg Sr g(-1) dry weight of cells in 18 h. Heat killed cells exhibited limited Cs and Sr binding as compared to live cells highlighting the importance of cell viability for optimal binding. The association of the metals with Arthrobacter sp. KMSZP6 was further substantiated by Field Emission-Scanning Electron Microscopy (FE-SEM) coupled with Energy dispersive X-ray (EDX) spectroscopy. This organism tolerated up to 1 kGy (60)Co-gamma rays without loss of survival. The present report highlights the superior tolerance and binding capacity of the KMSZP6 strain for cesium and strontium over other earlier reported strains and reveals its potential for bioremediation of nuclear waste. PMID:27620733

  1. Study on magnetic separation for decontamination of cesium contaminated soil by using superconducting magnet

    International Nuclear Information System (INIS)

    Highlights: • The method for the soil decontamination by the superconducting magnet is proposed. • Magnetic separation of clay minerals was performed by HGMS. • Soil separation ratio was evaluated by quantitative analysis using XRD. • It is expected that HGMS can be applied to the actual soil decontamination. - Abstract: The accident of Fukushima Daiichi nuclear power plant caused the diffusion of radioactive cesium over the wide area. We examined the possibility of applying magnetic separation method using the superconducting magnet, which can process a large amount of the soil in high speed, to the soil decontamination and volume reduction of the radioactive cesium contaminated soil. Clay minerals are classified as 2:1 and 1:1 types by the difference of their layer structures, and these types of minerals are respectively paramagnetic and diamagnetic including some exception. It is known that most of the radioactive cesium is strongly adsorbed on the clay, especially on 2:1 type clay minerals. It is expected that the method which can separate only 2:1 type clay minerals selectively from the mixture clay minerals can enormously contribute to the volume reduction of the contaminated soil. In this study, the components in the clay before and after separation were evaluated to estimate the magnetic separation efficiency by using X-ray diffraction. From the results, the decontamination efficiency and the volume reduction ratio were estimated in order to examine the appropriate separation conditions for the practical decontamination of the soil

  2. ION EXCHANGE MODELING FOR REMOVAL OF CESIUM FROM HANFORD WASTE USING SUPERLIG 644 RESIN

    Energy Technology Data Exchange (ETDEWEB)

    Hamm, L

    2004-05-01

    The expected performance of a proposed ion exchange column using SuperLig{reg_sign} 644 resin for the removal of cesium from Hanford high level radioactive alkaline waste is discussed. This report represents a final report on the ability and knowledge with regard to modeling the Cesium-SuperLig{reg_sign} 644 resin ion exchange system. Only the loading phase of the cycle process is addressed within this report. Pertinent bench-scale column tests and batch equilibrium experiments are addressed. The methodology employed and sensitivity analyses are also included (i.e., existing methodology employed is referenced to prior developmental efforts while updated methodology is discussed). Pilot-scale testing is not assessed since no pilot-scale testing was available at the time of this report. Column performance predictions are made considering three selected feed compositions under nominal operating conditions. The sensitivity analyses provided help to identify key parameters that aid in resin procurement acceptance criteria. The methodology and application presented within this report reflect the expected behavior of SuperLig{reg_sign} 644 resin manufactured at the production-scale (i.e, 250 gallon batch size level). The primary objective of this work was, through modeling and verification based on experimental assessments, to predict the cesium removal performance of SuperLig{reg_sign} 644 resin for application in the RPP pretreatment facility.

  3. Derivation of cesium-137 residual radioactive material guidelines for the Peek Street site, Schenectady, New York

    International Nuclear Information System (INIS)

    Residual radioactive material guidelines for cesium-137 were derived for the Peek rk. The derivation was based on the requirement that the Street site in Schenectady, New York. The derivation was based on the requirement that the 50-year committed effective dose equivalent to a hypothetical individual who lives or works in the immediate vicinity of the Peek Street site should not exceed a dose of 100 mrem/yr following remedial action. The US Department of Energy (DOE) residual radioactive material guideline computer code, RESRAD was used in this evaluation. Three potential scenarios were considered for the site on the assumption that for a period of 1,000 years following remedial action, the site wig be utilized without radiological restrictions. The scenarios vary with regard to use of the site, time spent at the site, and sources of food consumed. Results indicate that the basic dose limit of 100 mrem/yr will not be exceeded for cesium-137 within 1,000 years, provided that the soil concentration of cesium-137 at the Peek Street site does not exceed the following levels: 98 pCi/g for Scenario A (industrial worker: the expected scenario), 240 pCi/g for Scenario B (recreationist: a plausible scenario), and 34 pCi/g for Scenario C (resident farmer ingesting food produced in the decontaminated area: a plausible scenario)

  4. Study on magnetic separation for decontamination of cesium contaminated soil by using superconducting magnet

    Energy Technology Data Exchange (ETDEWEB)

    Igarashi, Susumu, E-mail: igarashi@qb.see.eng.osaka-u.ac.jp; Nomura, Naoki; Mishima, Fumihito; Akiyama, Yoko, E-mail: yoko-ak@see.eng.osaka-u.ac.jp

    2014-09-15

    Highlights: • The method for the soil decontamination by the superconducting magnet is proposed. • Magnetic separation of clay minerals was performed by HGMS. • Soil separation ratio was evaluated by quantitative analysis using XRD. • It is expected that HGMS can be applied to the actual soil decontamination. - Abstract: The accident of Fukushima Daiichi nuclear power plant caused the diffusion of radioactive cesium over the wide area. We examined the possibility of applying magnetic separation method using the superconducting magnet, which can process a large amount of the soil in high speed, to the soil decontamination and volume reduction of the radioactive cesium contaminated soil. Clay minerals are classified as 2:1 and 1:1 types by the difference of their layer structures, and these types of minerals are respectively paramagnetic and diamagnetic including some exception. It is known that most of the radioactive cesium is strongly adsorbed on the clay, especially on 2:1 type clay minerals. It is expected that the method which can separate only 2:1 type clay minerals selectively from the mixture clay minerals can enormously contribute to the volume reduction of the contaminated soil. In this study, the components in the clay before and after separation were evaluated to estimate the magnetic separation efficiency by using X-ray diffraction. From the results, the decontamination efficiency and the volume reduction ratio were estimated in order to examine the appropriate separation conditions for the practical decontamination of the soil.

  5. DFB-ridge laser diodes at 894 nm for Cesium atomic clocks

    Science.gov (United States)

    von Bandel, N.; Garcia, M.; Lecomte, M.; Larrue, A.; Robert, Y.; Vinet, E.; Driss, O.; Parrilaud, O.; Krakowski, M.; Gruet, F.; Matthey, R.; Mileti, G.

    2016-02-01

    Time and frequency applications are in need of high accuracy and high stability clocks. Optically pumped compact industrial Cesium atomic clocks are a promising approach that could satisfy these demands. However, the stability of these clocks relies, among others, on the performances of the laser diodes that are used. This issue has led the III-V Lab to commit to the European Euripides-LAMA project that aims to provide competitive compact optical Cesium clocks for ground applications. This work will provide key experience for further space technology qualification. III-V Lab is in charge of the design, fabrication and reliability of Distributed-Feedback diodes (DFB) at 894 nm (D1 line of Cesium) and 852 nm (D2 line). LTF-Unine is in charge of their spectral characterisation. The use of D1 line for pumping will provide simplified clock architecture compared to the D2 line pumping thanks to simpler atomic transitions and a larger spectral separation between lines in the 894 nm case. Also, D1 line pumping overcomes the issue of unpumped "idle states" that occur with D2 line. The modules should provide narrow linewidth (= 10 Hz and 109 Hz2/Hz @ f >= 10 Hz.

  6. ION EXCHANGE MODELING FOR REMOVAL OF CESIUM FROM HANFORD WASTE USING SUPERLIG 644 RESIN

    International Nuclear Information System (INIS)

    The expected performance of a proposed ion exchange column using SuperLig(regsign) 644 resin for the removal of cesium from Hanford high level radioactive alkaline waste is discussed. This report represents a final report on the ability and knowledge with regard to modeling the Cesium-SuperLig(regsign) 644 resin ion exchange system. Only the loading phase of the cycle process is addressed within this report. Pertinent bench-scale column tests and batch equilibrium experiments are addressed. The methodology employed and sensitivity analyses are also included (i.e., existing methodology employed is referenced to prior developmental efforts while updated methodology is discussed). Pilot-scale testing is not assessed since no pilot-scale testing was available at the time of this report. Column performance predictions are made considering three selected feed compositions under nominal operating conditions. The sensitivity analyses provided help to identify key parameters that aid in resin procurement acceptance criteria. The methodology and application presented within this report reflect the expected behavior of SuperLig(regsign) 644 resin manufactured at the production-scale (i.e, 250 gallon batch size level). The primary objective of this work was, through modeling and verification based on experimental assessments, to predict the cesium removal performance of SuperLig(regsign) 644 resin for application in the RPP pretreatment facility

  7. Stationary point of the radiometric control of cesium contamination of agricultural animals

    International Nuclear Information System (INIS)

    Stationary point of the radiometric control of cesium contamination of an agricultural animals. Is intended for vital measurements of the contents of radiocesium in muscular tissue of a cattle. Can be used on cattle-breeding farms, providing points, in meat factories and personal facilities. As a base means for accommodation of the control point the motor-car is used. Design of the car allows to automate operations on deployment of the control point on a place and translation of one to a transport mode. Limits of measured specific activity of cesium contamination of a cattle is up 5*10-9 to 5*10-6 Ci/kg. The basic error on the bottom limit of measurement at confidence coefficient 0,95 is no more than 30%. Measurement time for the bottom limit of determined specific activity is no more than 30 s. There is automatic measurement mode. Type of a power is 220 V, 50 Hz. Range of working temperatures is up -15 to +35 centigrade. Relative humidity is no more than 98% at 25 centigrade. External gamma background is till 0.035 mR/h. Time of installation and dismantle of stationary control point is no more than 1,5 hours. The direct radiometric control in divo allows to fulfil and to use biotechnological process of removing of cesium isotopes from body of animals for decrease of levels of radioactive contamination

  8. Crown bridged thiacalix[4]arenes as cesium-selective ionophores in solvent polymeric membrane electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Bereczki, Robert [Technical Analytical Research Group of the Hungarian Academy of Sciences, Department of General and Analytical Chemistry, Budapest University of Technology and Economics, Szt. Gellert ter 4, H-1111 Budapest (Hungary); Csokai, Viktor [Department of Organic Chemical Technology, Budapest University of Technology and Economics, Muegyetem rkp.3, H-1111 Budapest (Hungary); Gruen, Alajos [Department of Organic Chemical Technology, Budapest University of Technology and Economics, Muegyetem rkp.3, H-1111 Budapest (Hungary); Bitter, Istvan [Department of Organic Chemical Technology, Budapest University of Technology and Economics, Muegyetem rkp.3, H-1111 Budapest (Hungary); Toth, Klara [Technical Analytical Research Group of the Hungarian Academy of Sciences, Department of General and Analytical Chemistry, Budapest University of Technology and Economics, Szt. Gellert ter 4, H-1111 Budapest (Hungary)]. E-mail: ktoth@mail.bme.hu

    2006-05-31

    Novel 1,3-alternate thiacalix[4]mono- and biscrown-6 ethers were studied as ionophores in poly(vinyl chloride) membrane electrodes. Their selectivity behavior was characterized with respect to large number of cations, including potential interferents in environmental samples, and the membrane composition was optimized for cesium ion response. Among the ionophores, 1,3-alternate thiacalix[4]mono(crown-6) ether showed, especially high selectivity for cesium over other alkali-metal ions. Transition and heavy metal ions did not interfere seriously with the electrode response, which indicates that the bridging sulfur atoms do not take part in the ion recognition process. The potentiometric cesium responses of all electrodes involved in this study were found close to Nernstian and the detection limits were lower than 10{sup -7} M. The Cs{sup +}/Na{sup +} selectivity of the different ionophore-based sensors and the solvent extraction ability of the ligands were interpreted based on the respective constants of complex formation.

  9. Temperature and number evolution of cold cesium atoms inside a wall-coated glass cell

    Institute of Scientific and Technical Information of China (English)

    黄家强; 张建伟; 王时光; 王力军

    2015-01-01

    We report an experimental study on the temperature and number evolution of cold cesium atoms diffusively cooled inside a wall-coated glass cell by measuring the absorption profile of the 62S1/2 (F=4)→62P3/2(F0=5) transition line with a weak probe laser in the evolution process. We found that the temperature of the cold atoms first gradually decreases from 16 mK to 9 mK, and then rapidly increases. The number of cold atoms first declines slowly from 2.1 × 109 to 3.7 × 108 and then falls drastically. A theoretical model for the number evolution is built and includes the instantaneous temperature of the cold atoms and a fraction p, which represents the part of cold cesium atoms elastically reflected by the coated cell wall. The theory is overall in good agreement with the experimental result, and a nonzero value is obtained for the fraction p, which indicates that the cold cesium atoms are not all heated to the ambient temperature by a single collision with the coated cell wall. These results can provide helpful insight for precision measurements based on diffuse laser cooling.

  10. Small-Scale Ion Exchange Removal of Cesium and Technetium from Hanford Tank 241-AN-103

    Energy Technology Data Exchange (ETDEWEB)

    Hassan, N.M.

    2000-07-27

    The pretreatment process for BNFL, Inc.'s Hanford River Protection Project is to provide decontaminated low activity waste and concentrated eluate streams for vitrification into low activity and high level waste glass, respectively. The pretreatment includes sludge washing, filtration, precipitation, and ion exchange processes to remove entrained solids, cesium, transuranics, technetium, and strontium. The ion exchange removal of cesium (Cs) and technetium (Tc) ions is accomplished by using SuperLig 644, and 639 resins from IBC Advanced Technologies, American Fork, Utah. The resins were shown to selectively remove cesium and technetium (as pertechnetate), from alkaline salt solutions. The efficiency of ion exchange column loading and elution is a complex function involving feed compositions, equilibrium and kinetic behavior of ion exchange resins, diffusion, and the ionic strength and pH of the aqueous solution. A previous experimental program completed at the Savannah River Technology Center demonstrated the conceptualized flow sheet parameters with a similar Hanford tank sample (241-AW-101). Those experiments included determination of Cs and Tc batch distribution coefficients by SuperLig 644 and 639 resins and demonstration of small-scale column breakthrough and elution. The experimental findings were used in support of preliminary design bases and pretreatment flow sheet development by BNFL, Inc.

  11. Determination of collisional ionization rate and ionization yield from excited levels of cesium in a flame

    International Nuclear Information System (INIS)

    A method is proposed for determining the rate constants of collisional ionization and the ionization yield from excited levels of cesium atoms in a flame, using experimental curves of optical saturation and laser-stimulated ionization of excited atoms. It is shown that deviations of the shape of the saturation curves from ideal shape are due to the time dependence of the trailing edge of the exciting laser pulse. The ionization yield of cesium in an acetylene--air flame during its one-step excitation to the 6p2p1/2 level was 0.95%, rising to 50% for two-step excitation to the 8d2D3/2 level. The corresponding values of the rate constants of collisional ionization were 3.2x105 and 3.3x107 sec-1. From the known value of the ionization yield in the two-step excitation scheme, estimates of the atomization coefficient of cesium in the flame were made. The proposed method can be used for other elements in different flames

  12. Temperature and number evolution of cold cesium atoms inside a glass cell

    CERN Document Server

    Huang, J Q; Wang, S G; Wang, Z B; Wang, L J

    2015-01-01

    We report an experimental study on the temperature and number evolution of the cold cesium atoms diffusively cooled inside a wall-coated glass cell by measuring the absorption profile of the 62S1/2 (F=4)-62P3/2 (F'=5) transition line with a weak probe laser in the evolution process. We found that the temperature of the cold atoms first gradually decreases from 16 mK to 9 mK, and then rapidly increases. A theoretical model of the number evolution is built, which includes the temperature of the cold atoms and the fraction p of the cold cesium atoms elastically reflected by the cell wall. The theoretical model is consistent with the experimental result very well, and the fraction p is obtained to be (0.58 +/- 0.03), which reveals that the cold cesium atoms are not all heated to the ambient temperature by a single collision with the cell wall.

  13. Fire Safety Tests for Cesium-Loaded Spherical Resorcinol Formaldehyde Resin: Data Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong-Sang; Schweiger, Michael J.; Peterson, Reid A.

    2012-09-01

    A draft safety evaluation of the scenario for spherical resorcinol formaldehyde (SRF) resin fire inside the ion exchange column was performed by the Hanford Tank Waste Treatment and Immobilization Plant (WTP) Fire Safety organization. The result of this draft evaluation suggested a potential change of the fire safety classification for the Cesium Ion Exchange Process System (CXP) emergency elution vessels, equipment, and piping. To resolve this question, the fire properties of the SRF resin were measured by Southwest Research Institute (SwRI) through a subcontract managed by Pacific Northwest National Laboratory (PNNL). The results of initial fire safety tests on the SRF resin were documented in a previous report (WTP-RPT-218). The present report summarizes the results of additional tests performed by SwRI on the cesium-loaded SRF resin. The efforts by PNNL were limited to summarizing the test results provided by SwRI into one consolidated data report. The as-received SwRI report is attached to this report in the Appendix A. Where applicable, the precision and bias of each test method, as given by each American Society for Testing and Materials (ASTM) standard procedure, are included and compared with the SwRI test results of the cesium-loaded SRF resin.

  14. Optically pumped semiconductor lasers: Conception and characterization of a single mode source for Cesium atoms manipulation

    International Nuclear Information System (INIS)

    Lasers currently used in atomic clocks or inertial sensors are suffering from a lack of power, narrow linewidth or compactness for future spatial missions. Optically pumped semiconductor lasers, which combine the approach of classical solid state lasers and the engineering of semiconductor laser, are considered here as a candidate to a metrological laser source dedicated to the manipulation of Cesium atoms in these instruments. These lasers have demonstrated high power laser emission in a circular single transverse mode, as well as single longitudinal mode emission, favoured by the semiconductor structure and the external cavity design. We study the definition and the characterization of a proper semiconductor structure for the cooling and the detection of Cesium atoms at 852 nm. A compact and robust prototype tunable on the Cesium D2 hyperfine structure is built. The laser frequency is locked to an atomic transition thanks to a saturated absorption setup. The emission spectral properties are investigated, with a particular attention to the laser frequency noise and the laser linewidth. Finally, we describe and model the thermal properties of the semiconductor structure, which enables the simulation of the laser power characteristic. The experimental parameters are optimised to obtain the maximum output power with our structure. Thanks to our analysis, we propose several ways to overcome these limitations, by reducing the structure heating. (authors)

  15. Cesium removal demonstration utilizing crystalline silicotitanate sorbent for processing Melton Valley Storage Tank supernate: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Walker, J.F. Jr.; Taylor, P.A.; Cummins, R.L. [and others

    1998-03-01

    This report provides details of the Cesium Removal Demonstration (CsRD), which was conducted at Oak Ridge National Laboratory (ORNL) on radioactive waste from the Melton Valley Storage Tanks. The CsRD was the first large-scale use of state-of-the-art sorbents being developed by private industry for the selective removal of cesium and other radionuclides from liquid wastes stored across the DOE complex. The crystalline silicotitanate sorbent used in the demonstration was chosen because of its effectiveness in laboratory tests using bench-scale columns. The demonstration showed that the cesium could be removed from the supernate and concentrated on a small-volume, solid waste form that would meet the waste acceptance criteria for the Nevada Test Site. During this project, the CsRD system processed > 115,000 L (30,000 gal) of radioactive supernate with minimal operational problems. Sluicing, drying, and remote transportation of the sorbent, which could not be done on a bench scale, were successfully demonstrated. The system was then decontaminated to the extent that it could be contact maintained with the use of localized shielding only. By utilizing a modular, transportable design and placement within existing facilities, the system can be transferred to different sites for reuse. The initial unit has now been removed from the process building and is presently being reinstalled for use in baseline operations at ORNL.

  16. Fabrication of stimuli-sensitive hydrogel for the removal of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hee-Man; Bong, Sang Bum; Park, Chan Woo; Lee, Kune Woo; Seo, Bum-Kyoung; Moon, Jei Kwon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    The nuclear accident at the Fukushima Daiichi nuclear power station in 2011 released a huge quantity of radioactive contaminants into the environment.1 Among these, cesium Cs-137 is the most problematic contaminant due to its long half-life (30.2 years), and high-energy gamma ray (γ-ray) emissions. 2 Various surface including road, roof, house, building were contaminated with Cs-137. These coating materials have some problems and limitation such as toxic component, and lack of reusability of materials related to the cost. Thus, a more cost-effective and environmental friendly coating materials is still desired. 3 In the present study, the stimuli-sensitive hydrogel were fabricated for the removal of radioactive Cs from solid surface. We describe the morphology, structure, and physical property of these stimuli sensitive hydrogel. In addition, their ability to eliminate cesium was also evaluated. The smart hydrogel coating materials showed an excellent morphology change from the liquid to film by addition of Ca ion. Therefore, the stimuli-sensitive hydrogel demonstrated good potential for the treatment of contaminated surface for the removal of radioactive cesium.

  17. The effect of organic amendment on mobility of cesium in tropical soils - The effect of organic amendment on sorption mechanisms for cesium and cobalt in tropical soils

    Energy Technology Data Exchange (ETDEWEB)

    Wasserman, M.A.V.; Santos-Oliveira, R. [Instituto de Engenharia nuclear/CNEN. Rua Helio de Almeida, 75. Cidade Universitaria - Ilha do Fundao, Rio de Janeiro, RJ. CEP 21941-906 (Brazil); Garcia, R.J.L.; Ferreira, A.C.M.; Rochedo, E.R.R.; Sobrinho, G.A.N. [Instituto de Radioprotecao e Dosimetria/CNEN. Av. Salvador Allende s /no. Rio de Janeiro, RJ. CEP: 22780-160 (Brazil); Perez, D.V. [Centro Nacional de Pesquisa de Solos/EMBRAPA. R. Jardim Botanico, 1024.Rio de Janeiro, RJ, CEP: 22460-000 (Brazil); Wasserman, J.C. [dUFF Network of Environment and Sustainable Development (REMADS-UFF), University Federal Fluminense, Niteroi, RJ (Brazil)

    2014-07-01

    This work aimed to investigate the mechanisms involved in the sorption of {sup 137}Cs and {sup 60}Co as a function of the physico-chemical properties of some types of Brazilian soils and the changes on the behavior of these radionuclides due to changes in soil properties promoted by organic amendment. The experimental study was conducted in a controlled area, where pots containing different types of soils (Ferralsol, Nitisol and Histosol) and different doses of organic amendment (no amendment; 2 kg.m{sup -2} and 4 kg.m{sup -2}) were spiked with {sup 137}Cs and {sup 60}Co. The organic amendment used in this experiment was obtained in the Unit of Compost of the Organic Material of Pinheiral (RJ, Brazil), where the compost is made up from the leaves swept from the streets of the Pinheiral city. The mobility of these radionuclides in the soil was assessed through sequential chemical extraction and desorption studies as a function of pH. The bioavailability was evaluated through the effective absorption of radionuclide by root crops (Raphanus sativus, L). This study evidenced that the organic amendment plays an important role in the desorption processes of cobalt and cesium, reducing desorption of both nuclides beneath higher organic amendment dose. This behavior was observed in acid conditions as well in alkaline. However extreme acid conditions may mobilize both radionuclides, although cobalt mobility was shown to be more sensitive to low pH than cesium. (authors)

  18. The effect of organic amendment on mobility of cesium in tropical soils - The effect of organic amendment on sorption mechanisms for cesium and cobalt in tropical soils

    International Nuclear Information System (INIS)

    This work aimed to investigate the mechanisms involved in the sorption of 137Cs and 60Co as a function of the physico-chemical properties of some types of Brazilian soils and the changes on the behavior of these radionuclides due to changes in soil properties promoted by organic amendment. The experimental study was conducted in a controlled area, where pots containing different types of soils (Ferralsol, Nitisol and Histosol) and different doses of organic amendment (no amendment; 2 kg.m-2 and 4 kg.m-2) were spiked with 137Cs and 60Co. The organic amendment used in this experiment was obtained in the Unit of Compost of the Organic Material of Pinheiral (RJ, Brazil), where the compost is made up from the leaves swept from the streets of the Pinheiral city. The mobility of these radionuclides in the soil was assessed through sequential chemical extraction and desorption studies as a function of pH. The bioavailability was evaluated through the effective absorption of radionuclide by root crops (Raphanus sativus, L). This study evidenced that the organic amendment plays an important role in the desorption processes of cobalt and cesium, reducing desorption of both nuclides beneath higher organic amendment dose. This behavior was observed in acid conditions as well in alkaline. However extreme acid conditions may mobilize both radionuclides, although cobalt mobility was shown to be more sensitive to low pH than cesium. (authors)

  19. The Effect of Pressure and Organic Constituents on the Cesium Ion Exchange Performance of IONSIV IE-911

    International Nuclear Information System (INIS)

    This study examined cesium (137Cs) ion exchange of crystalline silicotitanate (CST) in simulated waste solution. In particular, the study focused on the effect of CST pretreatment on the kinetics and extent of cesium adsorption. The test used IONSIV IE-911 (UOP LLC, Molecular Sieves Division, Des Plaines, IL), the engineered form of CST. Pretreatment steps examined include: soaking CST in 2M NaOH solution for three days, exposing CST to 50% relative humidity for one week, flowing organic-containing (saturated) salt solution through a CST packed bed (at 5 cm/min. superficial velocity), or drying CST in air at 100 C for three days. Some tests occurred under 50 and 25 psig of argon. The following conclusions summarize the results. Pretreatment of IE-911 in organic-containing (e.g., tri-n-butyl phosphate, dibutylphosphate, butanol, paraffin and Dow Corning H-10 defoamer) simulated waste or simulated waste yielded a 83% slower rate of cesium adsorption and 56% lower cesium capacity after one week. Pretreatment of IE-911 in 2M caustic solution for 48 hours yielded a slower approach to equilibrium cesium distribution in batch contact tests--7.7 mL/(g*h) during the first 48 hours and 2.4 ml/(g*h) thereafter. Carboxylates and adsorbed carbonates inside the pores likely affect the cesium transport by either increasing the path-length or reducing mass transfer rate. Heating IE-911 as received from the vendor at 100 C for 24 hours significantly degraded its cesium removal performance by a 40.7% reduction in capacity and 43% reduction in sorption rate over one week of testing. Testing determined nearly identical distribution coefficients Kd between lot numbersign 9990-9681-0004 and 9990-9881-0005 (i.e., difference of only 5.6%). Tests measuring water insertion rates into IE-911 show that hydration of the IE-911 does not appear to limit the rate of cesium sorption. Increasing the atmospheric pressure from 0 to 50 psig had no effect on cesium sorption. Note that lower apparent

  20. Synthesis of 1,3,4-Thiadiazole, 1,3,4-Thiadiazine, 1,3,6-Thiadiazepane and Quinoxaline Derivatives from Symmetrical Dithiobiureas and Thioureidoethylthiourea Derivatives

    Directory of Open Access Journals (Sweden)

    A. Abou-Zied

    2005-08-01

    Full Text Available Reactions of N,N`-disubstituted hydrazinecarbothioamides 8a-c and substituted thioureidoethylthioureas 9a-c with 2,3,5,6-tetrachloro-1,4-benzoquinone (chloranil, 10a and 2,3,5,6-tetrabromo-1,4-benzoquinone (bromanil, 10b to form N,N`-disubstituted [1,3,4]thiadiazole-2,5-diamines 11a-c, 6,7-dichloro-3-substituted amino-1H-benzo[1,3,4]- thiadiazine-5,8-diones 12a-c, 2,3,7,8-tetrahalothianthrene-1,4,6,9-tetraones 13a,b, 5,6,8- trihalo-7-oxo-3,7-dihydro-2H-quinoxaline-1-carbothioic acid substituted amides 14a-c, 15a-c and 7-substituted imino-[1,3,6]thiadiazepane-3-thiones 16a-c are reported. Rationales for the observed conversions are presented.

  1. Synthesis of 1,3,4-Thiadiazole, 1,3,4-Thiadiazine, 1,3,6-Thiadiazepane and Quinoxaline Derivatives from Symmetrical Dithiobiureas and Thioureidoethylthiourea Derivatives

    OpenAIRE

    Abou-Zied, A.; K. El-Shaieb; A. Mourad; Hassan, A

    2005-01-01

    Reactions of N,N`-disubstituted hydrazinecarbothioamides 8a-c and substituted thioureidoethylthioureas 9a-c with 2,3,5,6-tetrachloro-1,4-benzoquinone (chloranil, 10a) and 2,3,5,6-tetrabromo-1,4-benzoquinone (bromanil, 10b) to form N,N`-disubstituted [1,3,4]thiadiazole-2,5-diamines 11a-c, 6,7-dichloro-3-substituted amino-1H-benzo[1,3,4]- thiadiazine-5,8-diones 12a-c, 2,3,7,8-tetrahalothianthrene-1,4,6,9-tetraones 13a,b, 5,6,8- trihalo-7-oxo-3,7-dihydro-2H-quinoxaline-1-carbothioic acid substit...

  2. Experimental studies on the biokinetics of Cs-134 and Cd-109 in the blood cockle (Anadara granosa)

    International Nuclear Information System (INIS)

    Bioaccumulation and depuration study under controlled laboratory conditions of Cs and Cd in Anadara granosa collected at coastal Kapar, Selangor was carried out using respective radiotracer, Cs-134 and Cd-109. The radioactivity of Cs-134 and Cd-109 were determined using high resolution hyper germanium detector. Our results demonstrate that Cd-109 was accumulated efficiently by this species, except Cs-134. The steady state concentration factor (CF) for accumulation of Cs-134 and Cd-109 from seawater was estimated to be about 5.86 and 51.31, respectively. For the depuration stage, loss kinetics of Cs-134 and Cd-109 was best described by 2-compartment exponential model. Results shown that A. granosa exposed to Cs-134 have a total loss of 69% in compared to 19 % of Cd-109. Results gained in this experiment are a baseline data to evaluate future released of radioactive material from nuclear power programme facilities within this region. (author)

  3. Intercomparison of radionuclides measurements in marine cockle flesh sample IAEA-134

    International Nuclear Information System (INIS)

    The results of an intercomparison exercise on a cockle flesh sample from Irish Sea, IAEA-134, designed for the determination of artificial and natural radionuclide levels, are reported. The data from 134 laboratories representing 49 countries have been evaluated. The following are the recommended values, with confidence intervals, for 40K, 60Co, 137Cs, and 239+240Pu (Reference date: 1 January 1992). Information values for 90Sr, 106Ru, 125Sb, 134Cs, 154Eu, 155Eu, 210Pb, 210Po, 226Ra, 228Ra, 228Th, 230Th, 232Th, 234U, 235U, 238U, 238Pu and 241Am are also reported. All the following values are expressed in Bq kg-1 (dry weight). (author)

  4. Synthesis and evaluation of antimicrobial activity of novel 1,3,4-oxadiazole derivatives

    Directory of Open Access Journals (Sweden)

    Popat B. Mohite

    2011-09-01

    Full Text Available In attempt to find new pharmacologically active molecules, we report here the synthesis and in vitro antimicrobial activities of various novel 1,3,4-oxadiazole containing 5-phenyltetrazole. The Schiff bases were obtained by condensation 2-(5-phenyl-1H-tetrazol-1-ylacetohydrazide with various aromatic aldehydes. Cyclocondensation of Schiff’s bases with acetic anhydride results in 1,3,4-oxadiazole derivatives. The structures of the newly synthesized 1,3,4-oxadiazole were confirmed by FT-IR, 1H NMR and mass spectral data. The antimicrobial activity was determined by MIC method. All the compounds exhibited weak to potent antimicrobial activity. Some derivatives bearing a methoxy group exhibited very good antimicrobial activity at conc. of 62.5 µg/mL.

  5. Combined therapy with interleukin 2 and indomethacin in mice inoculated with MH134 hepatoma.

    Directory of Open Access Journals (Sweden)

    Tanaka,Noriaki

    1995-10-01

    Full Text Available The antitumor effects of indomethacin and interleukin 2 (IL-2 were studied in C3H/HeJ mice inoculated with MH134 hepatoma cells. Combined treatment with indomethacin and IL-2 augmented natural killer (NK cells in mice with MH134-induced peritoneal carcinomatosis, and the survival of the treated mice was significantly longer than the non-treated mice. In animals with subcutaneous MH134 tumors, the combined therapy with indomethacin and IL-2 significantly suppressed tumor growth and induced complete regression of the tumor in three out of five mice. These results suggest that indomethacin and IL-2 therapy could be effective on human gastrointestinal cancer cells as well.

  6. Cavitation erosion resistance of 13/4 and 21-4-N steels

    Indian Academy of Sciences (India)

    Akhilesh K Chauhan

    2013-02-01

    Nitrogen strengthened austenitic stainless steel (termed as 21-4-N steel) in as cast and hot rolled conditions has been investigated as an alternative to 13/4 steel (termed as CA6NM) to overcome the problems of cavitation erosion in hydro turbine underwater parts. The cavitation erosion of 21-4-N and 13/4 steels was investigated by means of an ultrasonic vibration processor. The cavitation erosion is highly dependent on microstructure and mechanical properties. The results show that hot rolled 21-4-N steel is more cavitation erosion resistant than the 13/4 and 21-4-N steels in as cast condition. The eroded surfaces were analysed through optical microscope and scanning electron microscope for study of erosion mechanisms.

  7. Heat transfer performance during condensation of R-134a inside helicoidal tubes

    International Nuclear Information System (INIS)

    This paper reports an experimental investigation of condensation heat transfer and pressure drop of an ozone friendly refrigerant, R-134a, inside a helical tube for climatic conditioning of hot regions. This study concerns the condensation of R-134a flowing through annular helical tubes with different operating refrigerant saturated temperatures. The average pressure drop is measured and compared with data from relevant literature. The measurements of R-134a were performed on mass flow flux ranges from 50 to 680 kg/m2 s. The study provides experimental data that could be used for the design and development of more efficient condensers for refrigeration and air conditioning (A/C) systems working with the same refrigerant

  8. Nucleation efficiency of R134a as a sensitive liquid for superheated drop emulsion detector

    Indian Academy of Sciences (India)

    Mala Das; R Sarkar; P K Mondal; S Saha; B K Chatterjee; S C Roy

    2010-10-01

    Superheated emulsion detector is known to detect neutrons, γ-rays and other charged particles. The present work includes the study of nucleation efficiency of super-heated drops of one of the CFC-free liquids, R134a (C2H2F4), to fast neutrons, its response to -rays from 241Am and 137Cs and compare its nucleation efficiency with that of R12. The observation indicates that because of the presence of hydrogen, the nucleation efficiency is less in R134a than in R12 in the present neutron energy range of considera-tion. R134a is one of the most environment-friendly, commercially available liquid that is suitable for superheated drop detector, specially in neutron dosimetry and one needs to investigate it in detail.

  9. Comparison of dilution effects of R134a and nitrogen on flammable hydrofluorocarbons

    Institute of Scientific and Technical Information of China (English)

    Zhenming Li; Maoqiong Gong; Jianfeng Wu; Yuan Zhou

    2009-01-01

    An experimental apparatus has been built to measure the flammability limits of combustible gases based on Chi-nese national standard GB/T 12474-90. The flammability limits of four binary mixtures of R161/R134a, Ri52a/R134a, RI61/N2 and RI52a/N2 were measured with this apparatus at atmospheric pressure and ambient temperature. The fuel inertization points (FIP) of these mixtures can be found from the envelopes. Comparisons were made with the literature data; good agreement for most measurements was obtained. R134a was found to have a better dilution effect than nitrogen in reducing the flammability of hydrofluorocarbons.

  10. Sustained mutagenic effect in bone marrow cells induced bhy signal nuclide 134Cs retention in skeleton

    Institute of Scientific and Technical Information of China (English)

    ZhuShou-Peng; XiaFen; 等

    1997-01-01

    The skeleton transference and the retention dynamics of i.v.134 cs are investigated.Results indicate that the retention percentage of 134Cs in skeleton could be characterized by R(t)=0.0029exp(-0.121t) with T1/2=5.73d;the chromosome aberration percentage of somatic bone marrow cells increases obviously,the relationship between injected dose(X in kBq/g) and the chromosome aberration percentage can be expressed as Y=0.561X0.427,It should be noted that sustained elevation of chromosomal aberration rates induced by 134Cs can be upto the 47th d.

  11. The effect of PTH(1-34) on fracture healing during different loading conditions

    DEFF Research Database (Denmark)

    Ellegaard Larsen, Maria; Kringelbach, Tina; Syberg, Susanne;

    2013-01-01

    . Five days before fracture, half of the animals received Botulinum Toxin A injections in the muscles of the fractured leg to induce muscle paralysis (unloaded group), whereas the other half received saline injections (control group). For the following 8 weeks, half of the animals in each group received...... injections of hPTH(1-34) (20 µg/kg/day) and the other half received vehicle treatment. Fracture healing was assessed by radiology, dual-energy X-ray absorptiometry (DXA), histology, and bone strength analysis. We found that unloading reduced callus area significantly, whereas no effects of PTH(1...... and control animals. PTH(1-34) treatment increased ultimate force of the fracture by 63% in both control and unloaded animals and no interaction of the two interventions could be detected. PTH(1-34) was able to stimulate bone formation in normally loaded as well as unloaded intact bone. In conclusion...

  12. Sintered bentonite ceramics for the immobilization of cesium- and strontium-bearing radioactive waste

    Science.gov (United States)

    Ortega, Luis Humberto

    The Advanced Fuel Cycle Initiative (AFCI) is a Department of Energy (DOE) program, that has been investigating technologies to improve fuel cycle sustainability and proliferation resistance. One of the program's goals is to reduce the amount of radioactive waste requiring repository disposal. Cesium and strontium are two primary heat sources during the first 300 years of spent nuclear fuel's decay, specifically isotopes Cs-137 and Sr-90. Removal of these isotopes from spent nuclear fuel will reduce the activity of the bulk spent fuel, reducing the heat given off by the waste. Once the cesium and strontium are separated from the bulk of the spent nuclear fuel, the isotopes must be immobilized. This study is focused on a method to immobilize a cesium- and strontium-bearing radioactive liquid waste stream. While there are various schemes to remove these isotopes from spent fuel, this study has focused on a nitric acid based liquid waste. The waste liquid was mixed with the bentonite, dried then sintered. To be effective sintering temperatures from 1100 to 1200°C were required, and waste concentrations must be at least 25 wt%. The product is a leach resistant ceramic solid with the waste elements embedded within alumino-silicates and a silicon rich phase. The cesium is primarily incorporated into pollucite and the strontium into a monoclinic feldspar. The simulated waste was prepared from nitrate salts of stable ions. These ions were limited to cesium, strontium, barium and rubidium. Barium and rubidium will be co-extracted during separation due to similar chemical properties to cesium and strontium. The waste liquid was added to the bentonite clay incrementally with drying steps between each addition. The dry powder was pressed and then sintered at various temperatures. The maximum loading tested is 32 wt. percent waste, which refers to 13.9 wt. percent cesium, 12.2 wt. percent barium, 4.1 wt. percent strontium, and 2.0 wt. percent rubidium. Lower loadings of waste

  13. Interception and transfer of wet-deposited (134)Cs to potato foliage and tubers.

    Science.gov (United States)

    Rosén, K; Vinichuk, M

    2016-01-01

    Contamination levels on potato foliage and tubers were investigated by repeated sampling after multiple foliar contaminations of wet-deposited (134)Cs at five different growth stages in a micro-plot field experiment in three successive years. Application of the radionuclide early in the growing season (deposition date 19-27 June, growth stage II = plant establishment) resulted in low (134)Cs activity concentration in potato tubers across sampling occasions (mean 60, 25 and 115 Bq kg(-1) dry weight (D.W.) for years 1, 2 and 3, respectively). Following radionuclide deposition in the middle of the growing season (15-24 July, growth stage III = tuber initiation), (134)Cs activity concentration in tubers across sampling occasions was found to be highest (mean 150, 850 and 660 Bq kg(-1) D.W. for years 1, 2 and 3, respectively). When the radionuclide was sprayed on at later stages (5-7 August, growth stage IV = tuber bulking), (134)Cs activity concentrations in tubers across sampling dates decreased (mean 75, 310 and 395 Bq kg(-1) D.W. for years 1, 2 and 3, respectively). Deposition in the second half of August (15-28 August, late growth stage IV and beginning of growth stage V = tuber maturation) resulted in yet lower (134)Cs activity concentration in tubers. Potato tubers may concentrate as much as up to 2 times more (134)Cs than foliage depending on deposition date of radionuclide. PMID:26519923

  14. Time dependent caesium-134 transfer factors for crops grown on different Greek soil types

    International Nuclear Information System (INIS)

    Corn and cabbage plants were grown in a greenhouse pot experiment in two volcanic and two 'representative' Greek soils artificially contaminated with 134Cs for a three year period. Results for the 3rd year of experimentation as well as the main findings for the whole period are presented in this paper. In the third year of the project, two sweet corn (Elite and Vilmorin) and two cabbage varieties, (Kozanitiko and Brunswick) were tested. These varieties, except Vilmorin, were also grown on the same soils the previous years. 134Cs transfer factors (TFs) were significantly higher in the two volcanic soils than in the other soils, in agreement with previous years' data. Irrespective of crop species or variety, the clay-calcareous soil continued to show the lowest TF values. Comparing 134Cs uptake by the two corn varieties, it was found that Vilmorin plants absorbed approximately two times more 134Cs than Elite plants. No such difference was observed for the cabbage varieties. 134Cs TFs for both seeds and vegetative part of Elite variety significantly decreased compared to the respective values of the previous year. A similar trend, rarely significant, was observed for the two cabbage varieties. The ratio TF cabbage/TF corn (seeds) in the four soils increased this year and ranged from 6-16 with a mean value of 9. This increase is due to the higher reduction of corn 134Cs TFs than that of cabbage TFs. For all studied varieties and in all possible combinations the mean value of the ratio TF cabbage/TF corn was 8, coinciding with the respective values of the previous two years (7 and 6 respectively). During the three years of experimentation, three different corn varieties were tested and mean reference TFs for corn seeds in the studied soils were calculated. (author)

  15. Compressor Performance Comparison When Using R134 and R1234YF as Working Fluids

    OpenAIRE

    Ooi, Kim Tiow

    2012-01-01

    This paper examines the detailed effects on the compressor performance when using R1234yf as comparedto R134a. Firstly, the effects on the compressor performance of the existing compressors which was designed for R134a when using the new refrigerant R1234yf will be presented and discussed. Secondly, the design aspects of a new compressor to be designed for R1234yf will also be presented and discussed. In the paper the rolling piston compressor was used to carry out the simulation tests. The d...

  16. Aspects Regarding the Use of R-134a in Marine Refrigeration

    Directory of Open Access Journals (Sweden)

    Feiza Memet

    2009-10-01

    Full Text Available In marine refrigeration and air conditioning, refrigerants like R-12, R-22 and R-502 are most commonly used. Due to environmetal challenges, marine refrigeration plants on board of the old vessels have to be updated and designed in new terms. Recently, the global warming problem has put new pressure on possible alternatives, as R-134a for R-12, and drawn attention to energy efficiency. Results and theoretical considerations concerning a retrofit project are discussed with respect to R-134a compared with R-12, a traditional refrigerant on board of old ships.

  17. Synthesis and biological evaluation of β -aroylpropionic acid based 1,3,4-oxadiazoles

    Directory of Open Access Journals (Sweden)

    Husain A

    2009-01-01

    Full Text Available In the present investigation, two new series, 1-(4-benzylphenyl-3-(5-substituted-1,3,4-oxadiazol-2-yl-1-propanone and 1-(4-ethylphenyl-3-(5-substituted-1,3,4-oxadiazol-2-yl-1-propanone from β-(4-benzylbenzoylpropionic acid and β-(4-ethylbenzoylpropionic acid, respectively, were synthesized and tested for antiinflammatory, analgesic, lipid peroxidation, ulcerogenic and antibacterial actions. A fair number of compounds were found to have good antiinflammatory activity in carrageenan-induced rat paw edema test, while a few compounds showed significant antibacterial activity. The newly synthesized compounds showed very low ulcerogenic action.

  18. 怎样维修"HFC-134a"制冷剂冰箱

    Institute of Scientific and Technical Information of China (English)

    徐进华

    2003-01-01

    @@ 美国杜邦(DuPont)公司推出了HFC-I34a,即四氯乙烷,它仍属于卤代烃类,但不含氟和溴,所以ODP(Ozone Deplete Potentia即臭氧消耗潜值)为零.家用电冰箱发展到现在,主要采用的制冷剂有:R12(CFC-12)、R134a(HFC-134a)、HC-600a等.

  19. Monitoring of intermittent PTH(1-34) treatment by serum PINP in adult ovariectomized osteopenic rats

    DEFF Research Database (Denmark)

    Halleen, Jussi; Peng, ZhiQi; Fagerlund, Katja;

    showed strong anabolic effects in tibial metaphysis, tibial diaphysis and vertebra based on bone parameters determined by pQCT measurements and static and dynamic histomorphometry. Serum PINP values showed a strong dose-dependent increase by PTH(1-34) treatment both at 2 weeks after start of treatment...... and at the end of the study. We conclude that serum PINP is a reliable marker for monitoring the effects of anabolic treatment with PTH(1-34) in the rat OVX model, and short-term changes in serum PINP values predict long-term changes in bone parameters obtained by pQCT measurements and histomorphometry....

  20. miR-134 inhibits non-small cell lung cancer growth by targeting the epidermal growth factor receptor.

    Science.gov (United States)

    Qin, Qin; Wei, Furong; Zhang, Jianbo; Wang, Xingwu; Li, Baosheng

    2016-10-01

    The epidermal growth factor receptor (EGFR) is frequently activated in a wide range of solid tumours and represents an important therapeutic target. MicroRNAs (miRNAs) have recently been recognized as a rational and potential modality for anti-EGFR therapies. However, more EGFR-targeting miRNAs need to be explored. In this study, we identified a novel EGFR-targeting miRNA, miRNA-134 (miR-134), in non-small-cell lung cancer (NSCLC) cell lines. Luciferase assays confirmed that EGFR is a direct target of miR-134. In addition, the overexpression of miR-134 inhibited EGFR-related signaling and suppressed NSCLC cells proliferation by inducing cell cycle arrest and/or apoptosis, suggesting that miR-134 functions as a tumour suppressor in NSCLC. Further mechanistic investigation including RNAi and rescue experiments suggested that the down-regulation of EGFR by miR-134 partially contributes to the antiproliferative role of miR-134. Last, in vivo experiments demonstrated that miR-134 suppressed tumour growth of A549 xenograft in nude mice. Taken together, our findings suggest that miR-134 inhibits non-small cell lung cancer growth by targeting the EGFR.

  1. Solid-Phase Synthesis of 1,3,4-Thiadiazole Derivatives via Desulfurative Cyclization of Thiosemicarbazide Intermediate Resin.

    Science.gov (United States)

    Yang, Seung-Ju; Choe, Ji-Hye; Gong, Young-Dae

    2016-08-01

    A 1,3,4-thiadiazole library was constructed by solid-phase organic synthesis. The key step of this solid-phase synthesis involves the preparation of polymer-bound 2-amido-5-amino-1,3,4-thiadiazole resin by the cyclization of thiosemicarbazide resin using p-TsCl as the desulfurative agent, followed by the functionalization of the resin by alkylation, acylation, alkylation/acylation, and Suzuki coupling reactions. Both the alkylation and acylation reactions chemoselectively occurred at the 2-amide position of 2-amido-5-amino-1,3,4-thiadiazole resin and the 5-amine position of 2-amido-5-amino-1,3,4-thiadiazole resin, respectively. Finally, these functionalized 1,3,4-thiadiazole resins were treated with trifluoroacetic acid in dichloromethane, affording diverse 1,3,4-thiadiazole analogs in high yields and purities. The 1,3,4-thiadiazole analogs show a different distribution of physicochemical and biological properties compared with our previously constructed 1,3,4-oxadiazole and 1,3,4-thiadiazole libraries in a range of orally available drug properties. PMID:27362292

  2. A study of mechanisms responsible for incorporation of cesium and radiocesium into fruitbodies of king oyster mushroom (Pleurotus eryngii)

    Energy Technology Data Exchange (ETDEWEB)

    Bystrzejewska-Piotrowska, Grazyna [Isotope Laboratory, Faculty of Biology, Warsaw University, 02-096 Warsaw, Miecznikowa 1 (Poland)], E-mail: byst@biol.uw.edu.pl; Bazala, Michal A. [Isotope Laboratory, Faculty of Biology, Warsaw University, 02-096 Warsaw, Miecznikowa 1 (Poland)

    2008-07-15

    Ex vitro cultures of Pleurotus eryngii were carried out under controlled conditions using sterile medium composed of barley seeds. The influence of alkali and alkaline earth element salts (CsCl, KCl, NaCl, RbCl, and CaCl{sub 2}) and tetraethylammonium chloride on incorporation of cesium, potassium, sodium, rubidium and calcium, and their distribution within fruitbodies, was examined. The results show that incorporation of cesium into fruitbodies was not suppressed by Na{sup +} and Rb{sup +} or tetraethylammonium chloride. However, it was inhibited by Ca{sup 2+} and stimulated by high concentrations of K{sup +}. The inhibition of cesium incorporation by Ca{sup 2+}, lack of influence of tetraethylammonium chloride and stimulation by high K{sup +} concentrations suggest that there may exist two pathways of passive transport of cesium in mycelium: (i) uptake mediated by a non-specific potassium channel localised in plasmalemma (similar to voltage-insensitive cation channel, VICC) followed by diffusive transport inside hyphae and (ii) extracellular transport from the medium through inter-hyphal cavities into fruitbodies. The results highlight distinctiveness of mechanisms responsible for the uptake and incorporation of cesium in mushrooms and plants.

  3. A tentative assessment of cesium 137 direct and indirect transfer rates in a simplified fresh water food chain

    International Nuclear Information System (INIS)

    A comparison was made of the direct transfer of cesium from water to carps and the indirect transfer via the food. In a first experiment on chronic contamination of carps by water, the kinetics and distribution of cesium in the organs of the carps were studied. Equilibrium was not reached on the 56th day, 4% of the initial water activity had been retained by the carps and the concentration factor was below 10. The highest specific activities were found in the transit organs. In a second experiment, the water activity varied by alternating contamination and decontamination. A fluctuating equilibrium was reached on the 22nd day. The concentration factor was of the same order of magnitude than in the previous experiment. Indirect contamination of fish by ingestion of contaminated daphnids was studied in a third experiment. Cesium levels in carps increased with the cumulated activities in meals, and the uptake rate in fish was 4%. Both decorporation and biological half-lives (30-40 days) were independent of the contamination routes. The respective significance of the transfer pathways is discussed taking into account the biomass pyramids to be found in the nature. It is estimated that in a cesium environment, 70% of the carp activity should come from the diet and 30% from the water. The concentration factor would then be 75 instead of 22 when only direct transfer of cesium from water to fish is considered

  4. Kinetics of iodine and cesium reactions in the CANDU reactor primary heat transport system under accident conditions

    International Nuclear Information System (INIS)

    Gas-phase reaction kinetics have been modelled for the release of cesium and iodine into steam and steam/hydrogen atmospheres. The conditions are those anticipated in a CANDU reactor fuel channel following some postulated loss-of-coolant accidents. A total of seventeen chemical species were used in the model, including all important cesium and iodine species. Reaction rate constants were taken from the literature, or calculated where possible, or estimated. The composition evolution of the system was calculated, following a burst release of cesium and iodine, as a function of total iodine and cesium concentrations, cesium/iodine release ratio, iodine release form (atomic I or CsI), fuel channel atmosphere, and radiolysis effects. In general, the calculation demonstrates that CsI and CsOH rapidly (-2 s) become the most important species in the system for virtually all conditions. Atomic I is found to be significant only for very low release concentrations, or for Cs:I ratios less than unity. The main body of the modelling was performed at 1000 K. Some calculations were also performed for a three-node temperature system - 1500 K, 1000 K and 750 K - with the fission products being transported from high to low temperature. Thus, a qualitative picture is provided of the evolution of the chemistry in the fuel channel as the fission products are swept out by the residual steam flow

  5. Removal of radioactive cesium, strontium, and iodine from natural waters using bentonite, zeolite, and activated carbon

    International Nuclear Information System (INIS)

    Cs-134, Sr-85, and I-131 were produced by neutron irradiation of CsCl, SrCl2, and K2TeO3, respectively, using the Kyoto University Reactor. These radioactive nuclides were added to river water and seawater to prepare artificially contaminated samples, and the removal of these nuclides using bentonite, zeolite, and activated carbon was then investigated. In the river water samples, Cs-134 and Sr-85 were successfully removed using bentonite and zeolite, and I-131 was removed using activated carbon. In the seawater samples, Cs-134 was removed using bentonite and zeolite, whereas Sr-85 and I-131 were hardly removed at all by these adsorbents. (author)

  6. 19 CFR 134.24 - Containers or holders not designed for or capable of reuse.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Containers or holders not designed for or capable... HOMELAND SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Marking of Containers or Holders § 134.24 Containers or holders not designed for or capable of reuse. (a) Containers ordinarily...

  7. 19 CFR 134.23 - Containers or holders designed for or capable of reuse.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Containers or holders designed for or capable of... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Marking of Containers or Holders § 134.23 Containers or holders designed for or capable of reuse. (a) Usual and ordinary reusable containers or...

  8. 19 CFR 134.22 - General rules for marking of containers or holders.

    Science.gov (United States)

    2010-04-01

    ... SECURITY; DEPARTMENT OF THE TREASURY COUNTRY OF ORIGIN MARKING Marking of Containers or Holders § 134.22... origin of the article whether or not the article is marked to indicate its country of origin. (b....S.C. 1202), shall be marked to indicate clearly the country of their own origin in addition to...

  9. Observed Eastward Progression of the Fukushima 134Cs Signal Across the North Pacific

    Science.gov (United States)

    Yoshida, S.; Macdonald, A. M.; Jayne, S. R.; Rypina, I.; Buesseler, K.

    2015-12-01

    Radionuclide samples taken as part of hydrographic surveys at 30°N in the North Pacific reveal that the easternmost edge of Fukushima-derived 134Cs observed at 174.3°W in 2012 had progressed eastward across the basin to 160.6°W by 2013. The 2013 30°N observations indicate surface 134Cs concentrations of 3-5 Bq/m3 between 160°E and 160°W, slightly lower concentrations west of 160°E and no detectable signal east of 160.6°W. Profile samples show 134Cs penetration to 500 m west of 180° with shoaling penetration depth toward to the east. The near-uniform vertical distribution of 137Cs between 152°W and 121.3°W in the top 500 m is indicative of trace amounts of radionuclides remaining from weapons testing. The physical processes responsible for the deep 134Cs penetration in the western Pacific appear to be related to distinct water mass subduction pathways, however the timing and rapidity of deep penetration over the broad scales observed has yet to be clarified.

  10. 7 CFR 1955.134 - Loss, damage, or existing defects in inventory real property.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Loss, damage, or existing defects in inventory real... Disposal of Inventory Property General § 1955.134 Loss, damage, or existing defects in inventory real... a result of fire, vandalism, or an act of God between the time of acceptance of the bid or offer...

  11. 16 CFR 1500.134 - Policy on first aid labeling for saline emesis.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Policy on first aid labeling for saline... REGULATIONS § 1500.134 Policy on first aid labeling for saline emesis. (a) This section states the Consumer... induce vomiting (saline emesis) in the event of ingestion of hazardous substances. (b) In many...

  12. The International Criminal Court on Presence at Trial : the (in)validity of Rule 134quater’

    NARCIS (Netherlands)

    Knottnerus, Abel

    2014-01-01

    In November 2013, the ICC’s Assembly of States Parties adopted Rule 134quater as an amendment to the Rules of Procedure and Evidence of the Court. With the trials of Uhuru Kenyatta and William Ruto in mind, the States Parties agreed that the Trial Chamber should be able to excuse the accused from co

  13. 17 CFR 1.34 - Monthly record, “point balance”.

    Science.gov (United States)

    2010-04-01

    ... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Recordkeeping § 1.34 Monthly record, “point balance”. (a) Each... statement commonly known as a “point balance,” which accrues or brings to the official closing price, or... contracts long and short in the customers' accounts are in balance with those in the carrying...

  14. 25 CFR 39.134 - How does a school identify a Limited English Proficient student?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How does a school identify a Limited English Proficient....134 How does a school identify a Limited English Proficient student? A student is identified as limited English proficient (LEP) by using a nationally recognized scientifically research-based test....

  15. 19 CFR 122.134 - When airline does not have in-bond liquor storeroom.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false When airline does not have in-bond liquor... SECURITY; DEPARTMENT OF THE TREASURY AIR COMMERCE REGULATIONS Aircraft Liquor Kits § 122.134 When airline... where the airline involved does not have an authorized in-bond liquor storeroom. When this occurs,...

  16. Computer Programs for Calculating the Isentropic Flow Properties for Mixtures of R-134a and Air

    Science.gov (United States)

    Kvaternik, Raymond G.

    2000-01-01

    Three computer programs for calculating the isentropic flow properties of R-134a/air mixtures which were developed in support of the heavy gas conversion of the Langley Transonic Dynamics Tunnel (TDT) from dichlorodifluoromethane (R-12) to 1,1,1,2 tetrafluoroethane (R-134a) are described. The first program calculates the Mach number and the corresponding flow properties when the total temperature, total pressure, static pressure, and mole fraction of R-134a in the mixture are given. The second program calculates tables of isentropic flow properties for a specified set of free-stream Mach numbers given the total pressure, total temperature, and mole fraction of R-134a. Real-gas effects are accounted for in these programs by treating the gases comprising the mixture as both thermally and calorically imperfect. The third program is a specialized version of the first program in which the gases are thermally perfect. It was written to provide a simpler computational alternative to the first program in those cases where real-gas effects are not important. The theory and computational procedures underlying the programs are summarized, the equations used to compute the flow quantities of interest are given, and sample calculated results that encompass the operating conditions of the TDT are shown.

  17. 40 CFR 49.134 - Rule for forestry and silvicultural burning permits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Rule for forestry and silvicultural... Provisions General Rules for Application to Indian Reservations in Epa Region 10 § 49.134 Rule for forestry... permitting program for forestry and silvicultural burning within the Indian reservation to control...

  18. 抗辐射球菌对结球甘蓝吸收134Cs的影响%EFFECT OF Deinococcus radiodurans ON UPTAKE OF 134Cs BY Brassica oleracea

    Institute of Scientific and Technical Information of China (English)

    朱聪; 郭江峰

    2008-01-01

    在土壤中引入134Cs后接种抗辐射球菌(Deinococcus radiodttrarts),研究其对放射性铯在土壤中化学形态的影响.在抗辐射球菌存在的情况下,利用结球甘蓝(Brassica oleracea)吸收134Cs,初步研究了134Cs化学形态与结球甘蓝对其吸收能力的关系.结果表明:134Cs在土壤中主要以残留态形式存在,且接种抗辐射球菌的土壤残留态134Cs比在无菌土壤中的比例高28.64%~38.17%.结球甘蓝对134Cs的吸收量约为12100Bq/g,但在接种抗辐射球菌后,结球甘蓝对134Cs的吸收量约为8500Bq/g,比未接种细菌时的吸收量下降了约29%.抗辐射球茵可以改变134Cs在土壤中的化学形态,从而降低植物对134Cs的吸收.

  19. Cesium accumulation by bacterium Thermus sp.TibetanG7: hints for biomineralization of cesiumbearing geyserite in hot springs in Tibet, China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The bacterium Thermus sp. TibetanG7, isolated from hot springs in Tibet, China, was examined for the ability to accumulate cesium from solutions. Environmental conditions were simulated and the effects of pH, K+, Na+ and K+-regimes were then studied to determine the possible role of the bacterium in the formation of cesium-bearing geyserite around these hot springs. In despite of the inhibition of K+ and Na+, the bacterium Thermus sp. TibetanG7 revealed noticeable accumulation of cesium from solutions, with maximum accumulations of 53.49 and 40.41 μmol Cesium/g cell dry weight in Na+ and K+ inhibition experiments, respectively. The accumulation of cesium by this microorganism is rapid, with 40%―50% accumulated within the first 5 min. K+-deficient cells showed a much higher capacity of cesium accumulation compared with K+-sufficient cells. It is evident that the bacteria within the genus thermus play a significant role in the cesium assembly. The formation of cesium-bearing geyserite is also considered.

  20. A new alternative for the decontamination of PWR primary circuits for radioactive cesium and silver by insoluble ferrocyanides

    International Nuclear Information System (INIS)

    The optimal recovery conditions of radioactive cesium and silver from PWR primary circuits were determined on two types of nickel and zinc ferrocyanides. The studied products have been prepared by a slow growth on solid alkaline ferrocyanide particles placed in a concentrated nickel or zinc salt solution. Columns of these products do not react with water or lithium borate solutions as well as with organic solvents. The decontamination factor for cesium or silver is over 1000 for synthetic solutions. The presence of other alkaline ions does not modify these results. In the case of nuclear liquid wastes, the decontamination remains high for cesium. Silver is retained with a good efficiency if it is not under a complex form. This complex is destroyed by acidification. The setting of concrete is not significantly modified by the presence of ferrocyanides. The drawback of this method is a slight elution of some cations composing the ferrocyanides

  1. Ion exchange removal of cesium from simulated and actual supernate from Hanford tanks 241-SY-101 and 241-SY-103

    International Nuclear Information System (INIS)

    Pacific Northwest Laboratory (PNL), in conjunction with the Process Chemistry and Statistics Section of Westinghouse Hanford Company (WHC), conducted this study as part of the Supernatant Treatment Development Task for the Initial Pretreatment Module (IPM) Applied Engineering Project. The study assesses the performance of the CS-100 ion exchange material for removing cesium from simulated and actual alkaline supernate from Hanford tanks 241-SY-101 and 241-SY-103. The objective of these experiments is to compare the cesium ion exchange loading and elution profiles of actual and simulated wastes. Specific experimental objectives include (1) demonstration of decontamination factors (DF) for cesium removal, 92) verification of simulant performance, (3) investigation of waste/exchanger chemistry, and (4) determination of the radionuclide content of the regenerated CS-100 resin prior to disposal

  2. Effects of potassium and nitrogen groundwater pollution on the migration of cesium-137 through the geological environment

    International Nuclear Information System (INIS)

    Effects of potassium and nitrogen groundwater pollution on the migration of cesium-137 through the geological environment were studied for the territories of Russia, Ukraine, Belarus. Migration rate of cesium-137 deposited as a result of the Chernobyl accident increases in geologic media (soils, rocks, and groundwater) polluted by potassium and ammonium originating from long-term fertilizers use. This effect manifests itself in the fact that radiocesium penetrates deeper into soils of arable lands than it does into virgin soils. Laboratory experiments show the sorption capacity of sandy soils with respect to cesium-137 is 2.5-9.2 times lower in the presence of solutions of chlorides and nitrates of potassium and ammonium and is 1.3-2.0 times lower in the presence of sodium nitrate solution. 26 refs.; 2 figs

  3. Simulation of cesium nitrate extraction by a calixarene. Application to supported liquid membranes transport

    International Nuclear Information System (INIS)

    This work fits into the general pattern of the CEA studies on the decontamination of liquid effluents containing long-lived radioactive isotopes. Some calixarenes have proved to be very effective to selectively extract the cesium of aqueous solutions whose composition simulates those of the effluents to be reprocessed. On account of the difficulty of the studied extraction mechanisms, a physical and chemical simulation has been necessary. The system takes into account: 1)a concentrated nitric acid aqueous phase and/or sodium nitrate 2)an organic phase constituted by the diluent 1,2-nitro-phenyl-octyl-ether and 1,3-diisopropoxy-calix(4)arene-couronne-6. The use of concentrated aqueous solutions requires to take into account variations to ideality by the mean of activity coefficients reckoning. The different theories on the reckoning of variations to ideality in aqueous or organic phases are described in the first part. The determination of cesium and sodium nitrates activity coefficients in very concentrated matrices has required an important theoretical and experimental study which is given in the second part. The aim of this study was indeed to complete the thermodynamic data of cesium and sodium nitrates aqueous solutions. The computerized tools required for the modeling are reviewed. The stoichiometry of the extracted species in the organic phase has been determined in the third part. The supported membrane technique is an original method of separation by liquid-liquid extraction. A membrane transport model has been developed and is given in the last part of this work. (O.M.)

  4. Al-free active region laser diodes at 894 nm for compact Cesium atomic clocks

    Science.gov (United States)

    Von Bandel, N.; Bébé Manga Lobé, J.; Garcia, M.; Larrue, A.; Robert, Y.; Vinet, E.; Lecomte, M.; Drisse, O.; Parillaud, O.; Krakowski, M.

    2015-03-01

    Time-frequency applications are in need of high accuracy and high stability clocks. Compact industrial Cesium atomic clocks optically pumped is a promising area that could satisfy these demands. However, the stability of these clocks relies, among others, on the performances of laser diodes that are used for atomic pumping. This issue has led the III-V Lab to commit to the European Euripides-LAMA project that aims to provide competitive compact optical Cesium clocks for earth applications. This work will provide key experience for further space technology qualification. We are in charge of the design, fabrication and reliability of Distributed-Feedback diodes (DFB) at 894nm (D1 line of Cesium) and 852nm (D2 line). The use of D1 line for pumping will provide simplified clock architecture compared to D2 line pumping thanks to simpler atomic transitions and larger spectral separation between lines in the 894nm case. Also, D1 line pumping overcomes the issue of unpumped "dark states" that occur with D2 line. The modules should provide narrow linewidth (<1MHz), very good reliability in time and, crucially, be insensitive to optical feedback. The development of the 894nm wavelength is grounded on our previous results for 852nm DFB. Thus, we show our first results from Al-free active region with InGaAsP quantum well broad-area lasers (100μm width, with lengths ranging from 2mm to 4mm), for further DFB operation at 894nm. We obtained low internal losses below 2cm-1, the external differential efficiency is 0.49W/A with uncoated facets and a low threshold current density of 190A/cm², for 2mm lasers at 20°C.

  5. Use of cesium-137 methodology in the evaluation of superficial erosive processes

    Directory of Open Access Journals (Sweden)

    Avacir Casanova Andrello

    2003-06-01

    Full Text Available Superficial erosion is one of the main soil degradation agents and erosion rates estimations for different edaphicclimate conditions for the conventional models, as USLE and RUSLE, are expensive and time-consuming. The use of cesium-137 antrophogenic radionuclide is a new methodology that has been much studied and its application in the erosion soil evaluation has grown in countries as USA, UK, Australia and others. A brief narration of this methodology is being presented, as the development of the equations utilized for the erosion rates quantification through the cesium-137 measurements. Two watersheds studied in Brazil have shown that the cesium-137 methodology was practicable and coherent with the survey in field for applications in erosion studies.A erosão superficial é um dos principais agentes de degradação dos solos e estimativas das taxas de erosão para diferentes condições edafoclimáticas pelos modelos tradicionais como USLE, RUSLE, são onerosos e demorados. Uma metodologia que tem sido muito estudada e sua aplicação no estudo da erosão vem crescendo em países como EUA, Reino Unido, Austrália, e outros, é a do uso do radionuclídeo antropogênico césio-137. Um resumo da história desta metodologia é apresentado, assim como a evolução das equações utilizadas para quantificar as taxas de erosão através da medida do césio-137. Duas bacias estudadas no Brasil mostraram que a metodologia do césio-137 é viável e coerente com as observações em campo para aplicação no estudo da erosão.

  6. Distribution of global fallouts cesium-137 in taiga and tundra catenae at the Ob River basin

    Science.gov (United States)

    Semenkov, I. N.; Usacheva, A. A.; Miroshnikov, A. Yu.

    2015-03-01

    The classification of soil catenae at the Ob River basin is developed and applied. This classification reflects the diverse geochemical conditions that led to the formation of certain soil bodies, their combinations and the migration fields of chemical elements. The soil and geochemical diversity of the Ob River basin catenae was analyzed. The vertical and lateral distribution of global fallouts cesium-137 was studied using the example of the four most common catenae types in Western Siberia tundra and taiga. In landscapes of dwarf birches and dark coniferous forests on gleysols, cryosols, podzols, and cryic-stagnosols, the highest 137Cs activity density and specific activity are characteristic of the upper soil layer of over 30% ash, while the moss-grass-shrub cover is characterized by low 137Cs activity density and specific activity. In landscapes of dwarf birches and pine woods on podzols, the maximum specific activity of cesium-137 is typical for moss-grass-shrub cover, while the maximum reserves are concentrated in the upper soil layer of over 30% ash. Bog landscapes and moss-grass-shrub cover are characterized by a minimum activity of 137Cs, and its reserves in soil generally decrease exponentially with depth. The cesium-137 penetration depth increases in oligotrophic histosols from northern to middle taiga landscapes from 10-15 to 40 cm. 137Cs is accumulated in oligotrophic histosols for increases in pH from 3.3 to 4.0 and in concretionary interlayers of pisoplinthic-cryic-histic-stagnosols. Cryogenic movement, on the one hand, leads to burying organic layers enriched in 137Cs and, on the other hand, to deducing specific activity when mixed with low-active material from lower soil layers.

  7. Change of MicroRNA-134, CREB and p-CREB expression in epileptic rat

    Institute of Scientific and Technical Information of China (English)

    Yan Zhu; Cheng-Shan Li; Yuan-Ye Wang; Sheng-Nian Zhou

    2015-01-01

    Objective: To To investigate the changes of MicroRNA-134, CREB and p-CREB expression in epileptic rat brains in order to elucidate the molecular mechanisms of epilepsy, providing new ideas for clinical treatment. Methods: Sixty-four Spraque-Dawley (SD) rats were divided into groups randomly, including control group, six hours after seizure group, 24-hour group, three-day group, one-week group, two-week group, four-week group, and eight-week group. All groups were placed under a pilocarpine-induced epilepsy model except the control group, and all rats were decapitated in different points of time. Brain specimens were taken for quantitative PCR experiments, immunohistochemistry and Western blot experiments. The results of the epilepsy model groups and the control group were compared. Results: There were no significant differences between the six hours after seizure group, the 24-hour group and the control group about the MicroRNA-134 levels. MicroRNA-134 in the hippocampus tissue of the three-day group significantly reduced compared with the control group; same result was observed with the one-week, two-week, four-week and eight-week groups. The CREB and p-CREB levels in the three-day group’s rat hippocampus significantly increased compared with the control group; and the high levels of CREB and p-CREB were constantly maintained in the one-week, two-week, four-week and eight-week groups. Conclusions: The MicroRNA-134 level of the epileptic rat hippocampus is significantly lower than normal after three days, and continues to maintain a low level; while CREB and p-CREB levels are rsignificantly increased after three days, and continue to remain at a high level. MicroRNA-134 plays a role in inhibiting synaptic plasticity by inhibiting CREB and p-CREB expressions.

  8. The Design and Performance Analysis of Refrigeration System Using R12 & R134a Refrigerants

    Directory of Open Access Journals (Sweden)

    K. Nagalakshmi

    2014-02-01

    Full Text Available The design and performance analysis of refrigeration system using R12 & R134a refrigerants are presented in this report. The design calculations of the suitable and necessary refrigerator equipment and their results are also reported here. CFC-12 is the most widely used refrigerant. It serves both in residential and commercial applications, from small window units to large water chillers, and everything in between. Its particular combination of efficiency, capacity and pressure has made it a popular choice for equipment designers. Nevertheless, it does have some ODP, so international law set forth in the Montreal Protocol has put CFC-12 on a phase out schedule.HFC-134a has been established as a drop-in alternative for CFC-12 in the industry due to their zero Ozone Depletion Potential (ODP and similarities in thermodynamic properties and performance. However, when a system is charged with a HFC-134a compressor oil has to be changed.Not enough research has been done to cover all aspects of alternative refrigerants applications in the systems. This project intended to explore behavior of this alternative refrigerants compare to CFC-12 and challenges the industry is facing in design, operation services and maintenance of these equipments.The purpose of this project is to investigate behavior of R134a refrigerant. This includes performance and efficiency variations when it replaces R12 in an existing system as well as changes involved in maintaining the system charged with R134a. This project is intended to address challenges faced in the real world and some practical issues. Theoretical and experimental approaches used as a methodology in this work.

  9. A major technological accident: the dispersion of a radioactive cesium - 137 pellet in Goiania, Brazil (1987)

    International Nuclear Information System (INIS)

    This study concerns the accidental dispersion of cesium 137 chloride via an abandoned radiotherapy device in Brazil, in september 1987. Since the accident occurred recently in a confined area and concerned a single radiochemical agent, it was possible to delimit the study parameters in each discipline: post-accident management, physics, medicine, environment, law, psychology, socio-economics and communication. Costs are difficult to evaluate but obviously very important. It is difficult to analyze all consequences. No official has been accused, there were no sentence. The results demonstrate the critical importance of the human factor in technological accidents. (A.L.B.)

  10. High-Pressure Low-Symmetry Phases of Cesium Halides from First Principle Techniques

    OpenAIRE

    Nardelli, M. Buongiorno; Baroni, S.; Giannozzi, P.

    1994-01-01

    The relative stability of different high-pressure phases of various Cesium Halides is studied from first principles and analyzed using the Landau theory of phase transitions. We present results for CsI, CsBr, and CsCl up to pressures of about 100 GPa. A cubic-to-orthorhombic transition, driven by the softening of an acoustic phonon at the M point of the Brillouin zone, is competing with the cubic-to-tetragonal martensitic transition typical of these compounds. The phonon softening takes place...

  11. Dynamic modeling of the cesium, strontium, and ruthenium transfer to grass and vegetables

    Energy Technology Data Exchange (ETDEWEB)

    Renaud, P.; Real, J.; Maubert, H.; Roussel-Debet, S. (CE de Cadarache, Saint-Paul lez Durance (France). Inst. de Protection et de Surete Nucleaire)

    1999-05-01

    From 1988 to 1993, the Nuclear Safety and Protection Institute (Institut de Protection et de Surete Nucleaire -- IPSN) conducted experimental programs focused on transfers to vegetation following accidental localized deposits of radioactive aerosols. In relation to vegetable crops (fruit, leaves, and root vegetables) and meadow grass these experiments have enabled a determination of the factors involved in the transfer of cesium, strontium, and ruthenium at successive harvests, or cuttings, in respect of various time lags after contamination. The dynamic modeling given by these results allows an evaluation of changes in the mass activity of vegetables and grass during the months following deposit. It constitutes part of the ASTRAL post-accident radioecology model.

  12. Cesium Enhances Long-Term Stability of Lead Bromide Perovskite-Based Solar Cells

    OpenAIRE

    Kulbak, Michael; Gupta, Satyajit; Kedem, Nir; Levine, Igal; Bendikov, Tatyana; Hodes, Gary; Cahen, David

    2015-01-01

    Direct comparison between perovskite-structured hybrid organic-inorganic - methyl ammonium lead bromide (MAPbBr3) and all-inorganic cesium lead bromide (CsPbBr3), allows identifying possible fundamental differences in their structural, thermal and electronic characteristics. Both materials possess a similar direct optical band-gap, but CsPbBr3 demonstrates a higher thermal stability than MAPbBr3. In order to compare device properties we fabricated solar cells, with similarly synthesized MAPbB...

  13. Optical and evaporative cooling of cesium atoms in the gravito-optical surface trap

    CERN Document Server

    Hammes, M; Druzhinina, V; Moslener, U; Manek-Hönninger, I; Grimm, R

    2000-01-01

    We report on cooling of an atomic cesium gas closely above an evanescent-wave atom mirror. At high densitities, optical cooling based on inelastic reflections is found to be limited by a density-dependent excess temperature and trap loss due to ultracold collisions involving repulsive molecular states. Nevertheless, very good starting conditions for subsequent evaporative cooling are obtained. Our first evaporation experiments show a temperature reduction from 10muK down to 300nK along with a gain in phase-space density of almost two orders of magnitude.

  14. Accumulation of uranium, cesium, and radium by microbial cells: bench-scale studies

    International Nuclear Information System (INIS)

    This report describes bench-scale studies on the utilization of microbial cells for the concentration and removal of uranium, radium, and cesium from nuclear processing waste streams. Included are studies aimed at elucidating the basic mechanism of uranium uptake, process development efforts for the use of a combined denitrification-uranium removal process to treat a specific nuclear processing waste stream, and a preliminary investigation of the applicability of microorganisms for the removal of 137Cs and 226Ra from existing waste solutions

  15. Systematically investigating the polarization gradient cooling in an optical molasses of ultracold cesium atoms

    Science.gov (United States)

    Ji, Zhong-Hua; Yuan, Jin-Peng; Zhao, Yan-Ting; Chang, Xue-Fang; Xiao, Lian-Tuan; Jia, Suo-Tang

    2014-11-01

    We systematically investigate the polarization gradient cooling (PGC) process in an optical molasses of ultracold cesium atoms. The SR mode for changing the cooling laser, which means that the cooling laser frequency is stepped to the setting value while its intensity is ramped, is found to be the best for the PGC, compared with other modes studied. We verify that the heating effect of the cold atoms, which appears when the cooling laser intensity is lower than the saturation intensity, arises from insufficient polarization gradient cooling. Finally, an exponential decay function with a statistical explanation is introduced to explain the dependence of the cold atom temperature on the PGC interaction time.

  16. Digital Square-Wave Frequency Modulated Microwave Sources for a Miniature Optically Pumped Cesium Beam Clock

    Institute of Scientific and Technical Information of China (English)

    CHEN Jingbiao; ZHU Chengjin; LIU Ge; WANG Fengzhi; WANG Yiqiu; YANG Donghai

    2001-01-01

    Three different digital frequencymodulated microwave sources have been designed andapplied to our miniature optically pumped cesiumbeam clock.The main features and their influenceon clock accuracy have been experimentally tested.Itis proved that a digital square-wave frequency modu-lated microwave source using a microprocessor con-trolled direct-digital frequency synthesizer (DDFS)for our miniature optically pumped cesium beamclock works well,the frequency short term stability2 × 10 11/x r and the long term stability 3.5 x 10-13 forone day sample time have been obtained.

  17. Viscosity of aqueous-glyceric solutions of potassium, rubidium and cesium chlorides

    International Nuclear Information System (INIS)

    Results of viscometric investigation of the solutions of rubidium and cesium chlorides (also potassium chloride for comparison) in mixtures water-glycerine at 15, 25, 35 and 45 deg C are presented. Glycerine content constituted 0.01; 0.03; 0.05; 0.07; 0.11 molar fractions. It is shown that the range of viscosity values lower as compared to the ones for pure solvent are the wider the lower the temperature and glycerine content are (in the range of 0.01-0.11 molar fractions). The composition-viscosity, temperature-viscosity diagrams are presented

  18. Study of ferroelectric properties of spray pyrolysis deposited cesium nitrate films

    Energy Technology Data Exchange (ETDEWEB)

    Nautiyal, Arvind, E-mail: nautyphysics@gmail.co [Ferroelectric Materials and Devices Research Laboratory, Department of Physics, Indian Institute of Technology Roorkee, Roorkee 247667 (Uttrakhand) (India); Sekhar, K.C. [Ferroelectric Materials and Devices Research Laboratory, Department of Physics, Indian Institute of Technology Roorkee, Roorkee 247667 (Uttrakhand) (India); Pathak, N.P. [Radio Frequency Integrated Circuits Research Laboratory, Department of Electronics and Computer Engineering, Indian Institute of Technology Roorkee, Roorkee 247667 (Uttrakhand) (India); Nath, R., E-mail: rnathfph@iitr.ernet.i [Ferroelectric Materials and Devices Research Laboratory, Department of Physics, Indian Institute of Technology Roorkee, Roorkee 247667 (Uttrakhand) (India)

    2010-10-01

    Cesium nitrate (CsNO{sub 3}) films were prepared by ultrasonic spray pyrolysis technique at different substrate temperatures (T{sub s}) and their ferroelectric and switching properties were examined. The morphology of the deposited films was studied using FESEM. The ferroelectric properties were optimized based on remanent polarization as a function of substrate temperature. The switching response was studied using pulse width technique. The switching parameters such as effective dimensionality, switching time, and nucleation rate were extracted using finite grain model (FGM). The width of reading pulse shows significant effect on switching transients.

  19. Electron electric dipole moment experiment using electric-field quantized slow cesium atoms

    OpenAIRE

    Amini, Jason M.; Munger Jr., Charles T.; Gould, Harvey

    2007-01-01

    A proof-of-principle electron electric dipole moment (e-EDM) experiment using slow cesium atoms, nulled magnetic fields, and electric field quantization has been performed. With the ambient magnetic fields seen by the atoms reduced to less than 200 pT, an electric field of 6 MV/m lifts the degeneracy between states of unequal lbar mF rbar and, along with the low (approximately 3 m/s) velocity, suppresses the systematic effect from the motional magnetic field. The low velocity and small r...

  20. Observation of X-ray-induced phase transition phenomenon of cesium manganese hexacyanoferrate

    Energy Technology Data Exchange (ETDEWEB)

    Ishiji, K [Kyushu Synchrotron Light Research Center, 8-7 Yayoigaoka, Tosu, Saga 841-0005 (Japan); Deguchi, M; Nakajima, N [Graduate School of Science, Hiroshima University, 1-3-1 Kagamiyama, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Matsuda, T; Tokoro, H; Ohkoshi, S [Department of Chemistry, School of Science, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Iwazumi, T, E-mail: ishiji@saga-ls.j [Department of Mathematical Sciences, Graduate School of Engineering, Osaka Prefecture University, 1-1 Gakuen-cho, Sakai, Osaka 599-8531 (Japan)

    2009-02-01

    Cesium manganese hexacyanoferrate is an interesting material which exhibits the phase transition with the magnetic susceptibility variation under the effect of external stimuli; such as temperature and visible light irradiation. This phase transition attributes the charge transfer between ions in the Fe-CN-Mn bond. Recently, we observed the phase transition by X-ray irradiation below 80 K. The X-ray absorption spectrum of the low-temperature (LT) phase approached toward that of the high-temperature (HT) phase. The spectrum variation by X-ray irradiation attributes the charge transfer from Fe{sup II} to Mn{sup III}.

  1. Open-path atmospheric transmission for a diode-pumped cesium laser.

    Science.gov (United States)

    Rice, Christopher A; Lott, Gordon E; Perram, Glen P

    2012-12-01

    A tunable diode laser absorption spectroscopy device was developed to study atmospheric propagation for emerging high-energy laser weapons. The cesium diode-pumped alkali laser operates near 895 nm in the vicinity of several water-vapor absorption lines. Temperature, pressure, and water vapor concentration were determined for 150 m and 1 km open paths with statistical errors of ∼0.2%. Comparison with meteorological instruments yields agreement for the 1 km path to within 0.6% for temperature, 3.7% for pressure, and 2.4% for concentration. PMID:23207380

  2. The transfer of fallout cesium-137 from browse to moose. Part 1

    International Nuclear Information System (INIS)

    We are investigating the transfer of fallout cesium-137 from soil to browse to moose (Alces alces) to wolf (Canis lupis) to promote our understanding of the movement of radionuclides through natural food chains. The first part of this study is concerned with moose food habits. Early winter food habits of moose from Hecla Island and Manitoba Game Hunting Area 26 in south central and south eastern Manitoba were studied. In 86 rumen samples, 25 food types were identified. Three methods of food habit determination were used: (1) percentage occurrence of food types, (2) subjective abundance scores and (3) percentage dry weight. All three methods yielded very similar results

  3. Research on the treatment of liquid waste containing cesium by an adsorption-microfiltration process with potassium zinc hexacyanoferrate

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Changping, E-mail: melindazhang@yahoo.com.cn [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Gu Ping, E-mail: guping@tju.edu.cn [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Zhao Jun; Zhang Dong; Deng Yue [Institute of Nuclear Physics and Chemistry, Chinese Academy of Engineering Physics, Mianyang 621900 (China)

    2009-08-15

    The removal of cesium from an aqueous solution by an adsorption-microfiltration (AMF) process was investigated in jar tests and lab-scale tests. The adsorbent was K{sub 2}Zn{sub 3}[Fe(CN){sub 6}]{sub 2}. The obtained cesium data in the jar test fit a Freundlich-type isotherm well. In the lab-scale test, the mean cesium concentration of the raw water and the effluent were 106.87 {mu}g/L and 0.59 {mu}g/L, respectively, the mean removal of cesium was 99.44%, and the mean decontamination factors (DF) and concentration factors (CF) were 208 and 539, respectively. The removal of cesium in the lab-scale test was better than that in the jar test because the old adsorbents remaining in the reactor still had adsorption capacity with the premise of no significant desorption being observed, and the continuous renewal of the adsorbent surface improved the adsorption capacity of the adsorbent. Some of the suspended solids were deposited on the bottom of the reactor, which would affect the mixing of adsorbents with the raw water and the renewing of the adsorbent surface. Membrane fouling was the main physical fouling mechanism, and the cake layer was the main filtration resistance. Specific flux (SF) decreased step by step during the whole period of operation due to membrane fouling and concentration polarization. The quality of the effluent was good and the turbidity remained lower than 0.1 NTU, and the toxic anion, CN{sup -}, could not be detected because of its low concentration, this indicated that the effluent was safe. The AMF process was feasible for practical application in the treatment of liquid waste containing cesium.

  4. Role of excited CF3CFHO radicals in the atmospheric chemistry of HFC-134a

    DEFF Research Database (Denmark)

    Wallington, T.J.; Hurley, M.D.; Fracheboud, J.M.;

    1996-01-01

    CFHO* radicals limits the formation of CF3C(O)F and hence CF3COOH in the atmospheric degradation of HFC-134a. We estimate that the CF3COOH yield from atmospheric oxidation of HFC-134a is 7-20%. Vibrationally excited alkoxy radicals may play an important role in the atmospheric chemistry of other...

  5. 19 CFR 134.25 - Containers or holders for repacked J-list articles and articles incapable of being marked.

    Science.gov (United States)

    2010-04-01

    ... requirements of 19 U.S.C. 1304 and 19 CFR part 134. I further certify that if the article(s) is (are) intended... given for its production in accordance with § 141.66, Customs Regulations (19 CFR 141.66). In case of..., Customs Regulations (19 CFR 134.51). (d) Notice to subsequent purchaser or repacker. If the article...

  6. Synthesis and Biological Activity of 2,5-Bisubstituted Derivatives of 1,3,4-Thiadiazol-2,5-dithiol

    OpenAIRE

    Zhivotova, T. S.; Bakirova, R. E.; Fazylov, S. D.; S. K. Kabieva; Kryazheva, T. V.

    2013-01-01

    By reaction of 1,3,4-thiadiazol-2,5-dithiol with different organohalogens, chlorides of carboxylic acids, acrylic acid derivatives, alkaloids, and secondary amines, various derivatives of 2,5-bi-substituted 1,3,4-thiadiazole were synthesized, and biological properties of some of them were studied.

  7. Synthesis and Biological Activity of 2,5-Bisubstituted Derivatives of 1,3,4-Thiadiazol-2,5-dithiol

    Directory of Open Access Journals (Sweden)

    T. S. Zhivotova

    2013-01-01

    Full Text Available By reaction of 1,3,4-thiadiazol-2,5-dithiol with different organohalogens, chlorides of carboxylic acids, acrylic acid derivatives, alkaloids, and secondary amines, various derivatives of 2,5-bi-substituted 1,3,4-thiadiazole were synthesized, and biological properties of some of them were studied.

  8. 13 CFR 134.614 - What deadlines apply to my application for an award and where do I send it?

    Science.gov (United States)

    2010-01-01

    ... application for an award and where do I send it? 134.614 Section 134.614 Business Credit and Assistance SMALL... and where do I send it? After you have prevailed in an administrative proceeding or in a discrete... award for fees and expenses may still be filed, but it will not be considered by the ALJ until a...

  9. 10 CFR 431.134 - Uniform test methods for the measurement of energy consumption and water consumption of automatic...

    Science.gov (United States)

    2010-01-01

    ... consumption and water consumption of automatic commercial ice makers. 431.134 Section 431.134 Energy... of energy consumption and water consumption of automatic commercial ice makers. (a) Scope. This... consumption, but instead calculate the energy use rate (kWh/100 lbs Ice) by dividing the energy...

  10. Performance and energy saving analysis of a refrigerator using hydrocarbon mixture (HC-R134a) as working fluid

    Science.gov (United States)

    Mohtar, M. N.; Nasution, H.; Aziz, A. A.

    2015-12-01

    The use of hydrocarbon mixture as a working fluid in a refrigerator system is rarely explored. Almost all domestic refrigerators use hydroflourocarbon R134a (HFC-R134a) as refrigerants. In this study, hydrocarbon gas (HC-R134a) is used as the alternative refrigerant to replace HFC-R134a. It has a composition of R290 (56%), R600a (54.39%) and additive (0.1%wt) blended for the trials. The experiments were conducted with 105 g and 52.5 g refrigerant mass charge, subjected to internal heat load of 0, 1, 2, 3 and 4 kg respectively. The study investigates the coefficient of performance of the refrigerator (COPR) and energy consumption. The results show that the use of HC-R134a as the replaceable refrigerant can save energy ranging from 2.04% to 7.09%, as compared to the conventional HFC-R134a refrigerant. Naturally, the COPR improvement and temperature distribution using HC-R134a are much better than HFC-R134a

  11. The Effect of Carbonate, Oxalate and Peroxide on the Cesium Loading of Ionsiv IE-910 and IE-911

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.F.

    2000-12-19

    The Savannah River Site (SRS) continues to examine three processes for the removal of radiocesium from high-level waste. One option involves the use of crystalline silicotitanate (CST) as a non-elutable ion exchange medium. The process uses CST in its engineered form - IONSIV IE-911 made by UOP, LLC. - in a column to contact the liquid waste. Cesium exchanges with sodium ions residing inside the CST particles. The design disposes of the cesium-loaded CST by vitrification within the Defense Waste Processing Facility.

  12. Volume reduction of lake sediment and decrease of its cesium content in decontamination process by wet oxidation method

    International Nuclear Information System (INIS)

    Wet oxidation method was applied aiming to decrease cesium contents in lake sediment. In this research, “reactive oxygen water”, that is prepared from hypochlorous acid by contact with metal ceramics, was reacted with three kinds of samples, that is, lake sediment, mixture of lake sediment and fallen leaves, and incineration ash of fallen leaves. Experimental results revealed that sample volume was reduced by means of wet oxidation of organic components in samples and that a large amount of cesium contents were transferred from sample to water phase. (author)

  13. Functionalized magnetic nanoparticles for the decontamination of water polluted with cesium

    Directory of Open Access Journals (Sweden)

    Ahmed S. Helal

    2016-05-01

    Full Text Available Magnetic nanoparticles are attracting considerable interest because of their potential applications in practically all fields of science and technology, including the removal of heavy metals from contaminated waters. It is, therefore, of great importance to adapt the surfaces of these nanoparticles according to the application. In this work advanced nanoparticles (NPs with well-tailored surface functionalities were synthesized using the polyol method. The efficiency of a chelating agent, succinyl-β-cyclodextrin (SBCD, was first investigated spectrophotometrically and by Isothermal Titration Calorimetry (ITC. SBCD was then grafted onto nanoparticles previously functionalized with 3-aminopropyl triethoxsilane (NP-APTES. The resulting NP-SBCD system was then incubated with a solution of cesium. After magnetic separation, the solid residue was removed from the supernatant and characterized by X-Ray Photoelectron spectrometry (XPS, X-Ray Fluorescence spectrometry (XRF and Superconducting QUantum Interference Device (SQUID magnetometry. These characterizations show the presence of cesium in the solid residue, which indicates Cs uptake by the NP-SBCD system. This nanohybrid system constitutes a promising model for heavy metal decontamination.

  14. Production of negative D- ions by double charge exchange using cesium

    International Nuclear Information System (INIS)

    The first experimental results on the source of D- negative ions developed at SIG confirm a certain number of essential points: (1) the use of a positive ion source obtained by a resonance electronic cyclotron permits the production of D+ ion beams with a very small gas output, therefore it has a very good gas efficiency; (2) the supersonic cesium target obtained after the release of a high temperature cesium vapor functions perfectly with the desired characteristics; (3) the conversion efficiency measured in D- ions is close to those which were deduced from experimental cross sections; and (4) the mean density of D- ion currents is on the order of 10 mA/cm2 at 1 keV. They could be 15 at 25 mA/cm2 at 300 eV. This presupposes that we modify the extraction optic for the D+ ions to extract 60 at 70 mA/cm2 of D+ at 300 eV with a maximum electric field of 30 DV/cm and a greater perveance of the optic

  15. Critical literature study on the cesium transfer feed/meat of domestic animals

    International Nuclear Information System (INIS)

    A literature study concerning the transfer of cesium from feed to meat of domestic and wild animals has been carried out regarding approx. 3200 publications of the period 1950-1979. General criteria for the influence of experimental conditions on the transfer factor have been found. The transfer factor of radioisotopes of cesium is always smaller by one order of magnitude after single ingestion than after continuous administration until an equilibrium of incorporation to excretion is attained. The transfer factor of growing animals is greater than that of adult animals where transfer factor is not a function of age. The sex of the animals has no influence on the transfer factor. This value decreases with increasing weight of the animals. From these findings average transfer factors have been derived as follows: cattle 0.03 +- 0.02; calf 0.43 +- 0.06; goat 0.20; sheep 0.11 +- 0.02; pig 0.26 +- 0.01; hen 4.5; reindeer/caribou 0.31 +- 0.07; deer 0.18 +- 0.03. These values have been extracted from the original literature and relate mainly to animals undergoing metabolic experiments at equilibrium. Only the transfer factors of deer and caribou have been evaluated from data of the radiocesium concentration in feed and in meat. (orig.)

  16. Strontium-90 and cesium-137 in soil (from May 1985 to Jul. 1985)

    International Nuclear Information System (INIS)

    This report is aimed at listing measurements of strontium-90 and cesium-137 in soil made at eight places across Japan during the period from May to July in 1985. Collection and pretreatment methods are described for samples of rain and dry fallout, airborne dust, service water and freshwater, soil, sea water, sea sediments, total diet, rice, milk, vegetables, tea, as well as fish, shellfish and seaweeds. The methods for the preparation of these samples for analysis are also outlined. Sample solutions were neutralized with sodium hydroxide, and the precipitate of strontium and calcium carbonates was separated after sodium carbonate was added. The supernatant solution was retained for cesium-137 determination. After being precipitated as oxalates, strontium and calcium were separated by successive fuming nitric acid separations. For the determination of stable strontium, calcium and potassium, soil and sediment were treated with sodium hydroxide and hydrochloric acid for extraction while other samples were ashed and digested. Calcium, separated as oxalate, was determined by titration while stable strontium and potassium were determined by atomic absorption and flame emission spectroscopy, respectively. Couting for activity was carried out using low background beta counters normally for 60 min. (Nogami, K.)

  17. Research on ultracold cesium molecule long-range states by high-resolution photoassociative spectroscopy

    Institute of Scientific and Technical Information of China (English)

    WANG LiRong; MA Jie; JI WeiBang; WANG GuiPing; XIAO LianTuan; JIA SuoTang

    2008-01-01

    In this paper, an ultra-high resolution photoassociation spectroscopy study on photoassociation of cesium atoms is reported. The cold cesium gas in the mag-neto-optical trap is illuminated by a photoassociation laser with red-tuning as large as 40 cm-1 below the 6S1/2 + 6P3/2 dissociation limit, and the photoassoclation to the excited state ultracold molecule is detected. High signal-to-noise ratio is obtained by using the lock-in detection of the fluorescence from the modulated cold Cs at-oms. The O-g, and O+u, long-range states which correspond to 6S1/2 + 6P3/2 diSsocia-tion limit are present in the photoassociation spectrum. The effective coefficients of leading long-range interactions and the corresponding vibrational quantum num-ber are obtained using LeRoy-Bernstein Law. It is found that photoassociation process creates rotating molecules and the high J value is a hint that higher partial waves participate in the PA process in the presence of trapping laser.

  18. The behavior of cesium iodide radioaerosols during CsI sublimation from metal surface

    International Nuclear Information System (INIS)

    One of the biologically most dangerous volatile fission products getting into the environment during hypothetical severe accidents at NPPs are CsI radioaerosols. This is the reason why great attention is now being devoted to a study of the behavior of CsI radioaerosols in the steam-gas phase. We studied the behavior of CsI aerosols using a setup made of a steam generator, a reaction chamber with a Pt heater, a condenser, bubblers with a Na2S2O3 solution, and a Petryanov filter. The method of radionuclide diagnostic was used for study of the CsI behavior during sublimation from the metal surface. The theoretical mass ratio between cesium and iodine in the CsI molecule is equal to 1.04. So, an upward deviation from this theoretical value will show an increase in the amount of cesium, and, respectively, a downward deviation will indicate an increase in the amount of iodine. Thus, change in the Cs/I ratio was a parameter with the help of which we considered estimating the extent of the oxidation hydrolysis of CsI aerosols. (orig.)

  19. Uncertainty of cesium-beam time standards due to beam asymmetry

    Science.gov (United States)

    Becker, G.

    1980-12-01

    As a consequence of the spatial phase distribution in the resonators of cesium-beam time and frequency standards, the generated frequency depends on the specific path of the atomic beam. A change of the position of the atomic beam source may result in a beam displacement normal to the beam direction. For a deflection system consisting of a combination of quadrupole and hexapole magnets for two-dimensional beam deflection, the displacement of the center of mass of the beam resulting from a misalignment of the beam source is computed. To this end, the distribution of the beam intensity on the collector is first determined. It is shown that for the cesium-beam time and frequency standard CS1 of the Physikalisch-Technische Bundesanstalt (PTB), the uncertainty of the position of the center of mass of the beam entails a contribution to the uncertainty of the standard of less than 1 x 10 to the -15th. The amount of the displacement of the center of mass of the beam can be determined from the decrease of the beam flux on the collector caused by an adjustment of the beam source.

  20. Strontium-90 and cesium-137 in service water from December, 1981, to July, 1982

    International Nuclear Information System (INIS)

    Service water, 100 liters each, was collected at an intake of a water-treatment plant and at a tap after water was left running for five minutes. Water, to which the carriers of strontium and cesium were added immediately after sampling, was vigorously stirred and filtered. The sample was then passed through a cation exchange column. After radiochemical separation, the precipitates were counted for the activity using a low-background beta counter, normally for 60 min. The measuring techniques are first described; i.e. the collection and pretreatment of samples, the preparation of samples for analysis, the separation of strontium-90 and cesium-137, and the counting. The measured results are given in a table for the following locations: source water - Tokyo, Osaka, Hokkaido, Kyoto, Kanagawa, Aichi, Fukuoka; tap water - Hokkaido, Akita, Fukushima, Tokyo, Fukui, Shizuoka, Shimane, Okayama, Fukuoka, Saga, Nagasaki, Kyoto, Wakayama, Okinawa, Hiroshima, Aomori, Yamagata, Ibaraki, Kanagawa, Niigata, Ishikawa, Nagano, Aichi, Osaka, Hyogo, Tottori, Yamaguchi, Ehime, Kochi, Kagoshima. (Mori, K.)

  1. Functionalized magnetic nanoparticles for the decontamination of water polluted with cesium

    Science.gov (United States)

    Helal, Ahmed S.; Decorse, Philippe; Perruchot, Christian; Novak, Sophie; Lion, Claude; Ammar, Souad; El Hage Chahine, Jean-Michel; Hémadi, Miryana

    2016-05-01

    Magnetic nanoparticles are attracting considerable interest because of their potential applications in practically all fields of science and technology, including the removal of heavy metals from contaminated waters. It is, therefore, of great importance to adapt the surfaces of these nanoparticles according to the application. In this work advanced nanoparticles (NPs) with well-tailored surface functionalities were synthesized using the polyol method. The efficiency of a chelating agent, succinyl-β-cyclodextrin (SBCD), was first investigated spectrophotometrically and by Isothermal Titration Calorimetry (ITC). SBCD was then grafted onto nanoparticles previously functionalized with 3-aminopropyl triethoxsilane (NP-APTES). The resulting NP-SBCD system was then incubated with a solution of cesium. After magnetic separation, the solid residue was removed from the supernatant and characterized by X-Ray Photoelectron spectrometry (XPS), X-Ray Fluorescence spectrometry (XRF) and Superconducting QUantum Interference Device (SQUID) magnetometry. These characterizations show the presence of cesium in the solid residue, which indicates Cs uptake by the NP-SBCD system. This nanohybrid system constitutes a promising model for heavy metal decontamination.

  2. Nanophotonic hybridization of narrow atomic cesium resonances and photonic stop gaps of opaline nanostructures

    CERN Document Server

    Harding, Philip J; Mosk, Allard P; Vos, Willem L

    2014-01-01

    We study a hybrid system consisting of a narrowband atomic optical resonance and the long-range periodic order of an opaline photonic nanostructure. To this end, we have infiltrated atomic cesium vapor in a thin silica opal photonic crystal. With increasing temperature, the frequencies of the opal's reflectivity peaks shift down by >20% due to chemical reduction of the silica. Simultaneously, the photonic bands and gaps shift relative to the fixed near-infrared cesium D1 transitions. As a result the narrow atomic resonances with high finesse (f/df=8E5) dramatically change shape from a usual dispersive shape at the blue edge of a stop gap, to an inverted dispersion lineshape at the red edge of a stop gap. The lineshape, amplitude, and off-resonance reflectivity are well modeled with a transfer-matrix model that includes the dispersion and absorption of Cs hyperfine transitions and the chemically-reduced opal. An ensemble of atoms in a photonic crystal is an intriguing hybrid system that features narrow defect-...

  3. Transfer data for radio-cesium in the food chain feed/meat

    International Nuclear Information System (INIS)

    It is necessary to have some knowledge of the behaviour of radioactive material in the food chain to be able to assess the radiation exposure of humans via the ingestion path way. The transfer factor has to be defined precisely because there is a linear dependence of the radiation dose on the transfer factor in the mathematical models for calculating the annual radiation doses. Knowledge of the animal-specific cesium retention, of the biological half-life as well as of the distribution system is required for an accurate calculation of the transfer-data of the particularly important radionuclide cesium 137. After having studied the original literature thoroughly the following transfer factors have been found as an average: cattle 0.03 +- 0.02, calf 0.43 +- 0.06, goat 0.20, sheep 0.11 +- 0.02, swine 0.26 +- 0.01, chicken 3.23 +- 1.41, reindeer 0.31 +- 0.07. (MG)

  4. Nanophotonic hybridization of narrow atomic cesium resonances and photonic stop gaps of opaline nanostructures

    Science.gov (United States)

    Harding, Philip J.; Pinkse, Pepijn W. H.; Mosk, Allard P.; Vos, Willem L.

    2015-01-01

    We study a hybrid system consisting of a narrow-band atomic optical resonance and the long-range periodic order of an opaline photonic nanostructure. To this end, we have infiltrated atomic cesium vapor in a thin silica opal photonic crystal. With increasing temperature, the frequencies of the opal's reflectivity peaks shift down by >20 % due to chemical reduction of the silica. Simultaneously, the photonic bands and gaps shift relative to the fixed near-infrared cesium D1 transitions. As a result the narrow atomic resonances with high finesse (ω /Δ ω =8 ×105 ) dramatically change shape from a usual dispersive shape at the blue edge of a stop gap, to an inverted dispersion line shape at the red edge of a stop gap. The line shape, amplitude, and off-resonance reflectivity are well modeled with a transfer-matrix model that includes the dispersion and absorption of Cs hyperfine transitions and the chemically reduced opal. An ensemble of atoms in a photonic crystal is an intriguing hybrid system that features narrow defectlike resonances with a strong dispersion, with potential applications in slow light, sensing, and optical memory.

  5. Effect of electrode materials on a negative ion production in a cesium seeded negative ion source

    Energy Technology Data Exchange (ETDEWEB)

    Shimizu, Takashi; Morishita, Takutoshi; Kashiwagi, Mieko; Hanada, Masaya; Iga, Takashi; Inoue, Takashi; Watanabe, Kazuhiro; Imai, Tsuyoshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment; Wada, Motoi [Doshisha Univ., Kyoto (Japan)

    2003-03-01

    Effects of plasma grid materials on the negative ion production efficiency in a cesium seeded ion source have been experimentally studied. Grid materials of Au, Ag, Cu, Ni, and Mo were examined. A 2.45 GHz microwave ion source was utilized in the experiment to avoid contamination of tungsten from filament cathode. Relations between the negative ion currents and work functions of the grid were measured for these materials. Influence of the contamination by tungsten on the grid was also investigated. If was clarified that the negative ion production efficiency was determined only by the work function of the grid. The efficiency did not depend on the material itself. The lowest work function of 1.42 eV was obtained for Au grid with Cs, and a high H{sup -} production efficiency of 20.7 mA/kW was measured. This efficiency is about 1.3 times larger than that of Cs/Mo and Cs/Cu. Further improvement of the production efficiency was observed by covering the plasma grid with tungsten and cesium simultaneously. Such co-deposition of W and Cs on the plasma grid produced the negative ion production efficiency of 1.7 times higher than that from the tungsten grid simply covered with Cs. (author)

  6. Physical properties of a new flat panel detector with cesium-iodide technology

    Science.gov (United States)

    Hahn, Andreas; Penchev, Petar; Fiebich, Martin

    2016-03-01

    Flat panel detectors have become the standard technology in projection radiography. Further progress in detector technology will result in an improvement of MTF and DQE. The new detector (DX-D45C; Agfa; Mortsel/Belgium) is based on cesium-iodine crystals and has a change in the detector material and the readout electronics. The detector has a size of 30 cm x 24 cm and a pixel matrix of 2560 x 2048 with a pixel pitch of 124 μm. The system includes an automatic exposure detector, which enables the use of the detector without a connection to the x-ray generator. The physical properties of the detector were determined following IEC 62220-1-1 in a laboratory setting. The MTF showed an improvement compared to the previous version of cesium-iodine based flat-panel detectors. Thereby the DQE is also improved especially for the higher frequencies. The new detector showed an improvement in the physical properties compared to the previous versions. This enables a potential for further dose reductions in clinical imaging.

  7. Executive strategy plan for beneficial uses program: cesium-137 sewage sludge irradiation

    International Nuclear Information System (INIS)

    Energy-efficient disinfection of sewage sludge, permitting its use as a fertilizer and soil conditioner in areas open to public access or on certain food chain crops, is possible using the process technology developed by Sandia National Laboratories under DOE and EPA joint support. This process accomplishes disinfection by gamma ray irradiation with cesium-137, a by-product isotope recovered from reprocessing of defense production waste. Disinfection with cesium-137 gamma irradiation provides an energy-efficient option for the Nation's cities to beneficially utilize sewage sludge, while at the same time conserving energy by utilizing a radioisotope, traditionally considered waste, in a beneficial manner. While the Sandia sludge irradiation technology has successfully completed its research and development phase, a major consideration remains: the introduction of a new technology into a marketplace which traditionally is skeptical of new products or process technologies until their performance is well proven. This document analyzes the factors important to market introduction of this new technology, develops options, and recommends a program strategy for transfer of the Sandia sludge irradiation technology to the marketplace by developing public awareness and acceptance, and by stimulating private sector commercialization interest

  8. The stability under irradiation of hollandite ceramics, specific radioactive cesium-host waste forms

    International Nuclear Information System (INIS)

    Investigations are currently performed on matrices for the specific immobilization of long-lived radionuclides such as fission products resulting from an enhanced reprocessing of spent fuel. Hollandite (nominally BaA2Ti6O16), one of the phases constituting SYNROC, receives renewed interest as specific Cs host wasteform. The radioactive cesium isotopes decay involves the emission of β particles, γ rays and the transmutation of Cs to stable Ba ions. This study deals with the synthesis of hollandite ceramics by oxide route and single crystals by a flux method having the BaxCsy(Al,Fe)2x+yTi8-2x-yO16 composition type (l≤x≤1.28; 0≤y≤0.28). The influence of the hollandite chemical composition on the hollandite structure and microstructure is studied. To estimate the hollandite radiation resistance, external electron irradiation experiments, simulating the β particles emitted by radioactive cesium, were carried on single phase materials. The radiation effects were characterized by electron paramagnetic resonance (EPR) and Moessbauer spectroscopy. (authors)

  9. Modeling Cesium Partitioning in the Rhizosphere: A Focus on the Role of Root Exudates

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, Melinda Ann; Siegel, L. S.; Alshawabkeh, A. N.; Carl D. Palmer

    2003-01-01

    A conceptual model is being developed for prediction of cesium (Cs) partitioning between bound (Csb), aqueous (Csa), and phytoextracted (Csp) phases in the rhizosphere. The model categorizes the processes that impact cesium partitioning into six sub-models: geochemistry, physical factors, root density, microorganisms, nutrients, and root exudates. A seventh sub-model (Cs fate) describes Cs movement between the three phases. Functional relationships and parametric values within and between the submodels are being developed based on literature, field characterization, and laboratory experiments. Sensitivity analyses were conducted to evaluate the effects of root density, microbial population, potassium requirement and concentration, and moisture content on the concentration of root exudates ([E]) and consequently on Cs partitioning. In summary, the model provides a framework for better understanding the fundamental processes that control Cs fate in the rhizosphere. The ability to better understand, predict, and control Cs solubilization could be applied to other metals in the future. Ultimately, the model will be used as a tool for enhancing field implementation of in situ solubilization of metals for a variety of remedial activities.

  10. Incorporation of cesium into phosphates of apatitic and rhabdophane lattices. Application to the conditioning of separated radionuclides; Incorporation du cesium dans des phosphates de structure apatitique et rhabdophane. Application au conditionnement des radionucleides separes

    Energy Technology Data Exchange (ETDEWEB)

    Campayo, L

    2003-04-01

    Two phosphate-based materials were investigated for cesium immobilization after its partitioning from spent nuclear fuel: apatites and rhabdophanes. The incorporation of cesium into the apatitic lattice creates steric stresses. These stresses induce the formation of secondary phases which are rapidly leached. The effectiveness of the cesium immobilization in this material is not therefore validated. A second phosphate CsCaNd(PO{sub 4}){sub 2} was consistently found at the end of the leach test and its properties were further characterized. The structure of CsCaNd(PO{sub 4}){sub 2}, which is rhabdophane-like, is made of large channels which enable the incorporation of the largest alkaline cations. The synthesis involves two intermediates: the monazite, NdPO{sub 4}, and a soluble phosphate, CsCaPO{sub 4}. The study of a rhabdophane with 10 wt.% of cesium reveals satisfactory intrinsic properties: a thermal stability up to 1100 C and a leach rate of 10{sup -2} g/(m{sup 2}.d). The next step will be to improve the reaction yield. (author)

  11. T134

    Directory of Open Access Journals (Sweden)

    A. Shikeeva

    2015-11-01

    We postulate that FC size in NSCLC is at least 5 cm from tumor and includes only epigenetic but not structural (LOH/MSI alterations. The evaluation of epigenetic changes in adjacent tissue (e.g., surgical margins can potentially be used for postsurgical prognosis.

  12. R134a单级制冷循环性能指标诺模图研制%Development on Single-stage Refrigeration Cycle Performance Index Nomogram for R134a

    Institute of Scientific and Technical Information of China (English)

    王鹏英; 褚觉熙

    2004-01-01

    根据威尔逊(Wilson)等人拟合的Martin-Hou状态方程及辅助方程式导出了R134a的其他热力性质计算方程,用Visual Basic 6.0语言编制了采用R134a的单级制冷循环热力计算程序和绘图程序,并给出了绘图程序绘制的R134a单级制冷循环性能指标变化曲线图和诺模图.

  13. Synthesis, Crystal Structure, and Herbicidal Activities of 2-Cyanoacrylates Containing 1,3,4-Thiadiazole Moieties

    Institute of Scientific and Technical Information of China (English)

    Wang Tingting; Miao Wenke; Wu Shanshan; Bing Guifang; Zhang Xin; Qin Zhenfang; Yu Haibo; Qin Xue; Fang Jianxin

    2011-01-01

    Three series of novel 2-cyanoacrylates 7a-7f, 9a-9f, 10a-10f containing 1,3,4-thiadiazole ring moieties were synthesized as herbicidal inhibitors of photosystem Ⅱ (PS Ⅱ) electron transportation. Their structures were clearly verified by 1H NMR, 13C NMR, elemental analysis (or HRMS analysis) and single-crystal X-ray diffraction analysis. Bioassay showed that a suitable group at the 3-position of acrylates was essential for high herbicidal activ-ity. In particular, compound 7e showed the best herbicidal activities and gave 100% inhibitory activity against rape and amaranth pigweed at a dose of 1.5 kg/ha. Introduction of substituent with higher polarity such as sulfinyl or sulfonyl to the 5-position of 1,3,4-thiadiazole decreased herbicidal activities.

  14. Pseudomonas fluorescens 134 as a biological control agent (BCA) model in cell immobilization technology.

    Science.gov (United States)

    Russo, Anna; Basaglia, Marina; Casella, Sergio; Nuti, Marco Paolo

    2005-01-01

    Antifungal activity against Rhizoctonia solani was achieved in vivo through the application of Pseudomonas fluorescens strain 134 encapsulated in sodium alginate beads of different sizes (0.5, 1, and 2 mm). The activity was compared to that obtainable with chemical treatments and bead-derived liquid formulations. The latter was obtained by dissolving alginate beads of 1 and 0.5 mm in 1% Na-citrate solution before application, without any significant (P chemical treatment. Pseudomonas fluorescens strain 134 delivered as both dry and liquid formulations was able to colonize cotton root at a population density of about 10(8) CFU/g fresh root, 15 days after sowing. PMID:15903270

  15. Synthesis and Antibacterial Activities of Novel Imidazo[2,1-b]-1,3,4-thiadiazoles

    Directory of Open Access Journals (Sweden)

    Kamal F. M. Atta

    2011-06-01

    Full Text Available 2-Amino-5-(2-aryl-2H-1,2,3-triazol-4-yl-1,3,4-thiadiazoles 2-4 have been synthesized by the reaction of 2-aryl-2H-1,2,3-triazole-4-carboxylic acids 1 with thiosemicarbazide. Their reaction with phenacyl (p-substituted phenacyl bromides led to formation of the respective 6-aryl-2-(2-aryl-2H-1,2,3-triazol-4-ylimidazo[2,1-b]-1,3,4-thiadiazoles 5. Reactivity of the latter fused ring towards reaction with different electrophilic reagents afforded the corresponding 5-substituted derivatives 6-8. The structure of the above compounds was confirmed from their spectral characteristics. Some of these compounds were found to possess slight to moderate activity against the microorganisms Staphylococcus aureus, Candida albicans, Pseudomonas aeruginosa, and Escherichia coli.

  16. Crystal structure of 2-(1,3-dioxoindan-2-ylisoquinoline-1,3,4-trione

    Directory of Open Access Journals (Sweden)

    Raza Murad Ghalib

    2015-01-01

    Full Text Available In the title isoquinoline-1,3,4-trione derivative, C18H9NO5, the five-membered ring of the indane fragment adopts an envelope conformation with the nitrogen-substituted C atom being the flap. The planes of the indane benzene ring and the isoquinoline-1,3,4-trione ring make a dihedral angle of 82.06 (6°. In the crystal, molecules are linked into chains extending along the bc plane via C—H...O hydrogen-bonding interactions, enclosing R22(8 and R22(10 loops. The chains are further connected by π–π stacking interations, with centroid-to-centroid distances of 3.9050 (7 Å, forming layers parallel to the b axis.

  17. R-134a spray dynamics and impingement cooling in the non-boiling regime

    Energy Technology Data Exchange (ETDEWEB)

    Hsieh, Shou-Shing; Tien, Chi-Hsun [National Sun Yat-Sen University, Kaohsiung (Taiwan). Department of Mechanical and Electro-Mechanical Engineering

    2007-02-15

    R-134a spray as it impinges on the flat endplate of a circle is studied experimentally. In order to optimize R-134a spray cooling efficiency, a detailed characterization and understanding of liquid spray formation is essentially needed. An optical image system was used to quantify the spray flow structure. LDV measurements were used to characterize the local velocity /and velocity fluctuation distribution from a commercial available nozzle in both axial and radial directions. The radial velocity are found to be the largest at the outer edges of the spray, and they continuously decrease across the spray toward the center axis; while the corresponding axial velocity is the maximum there. Moreover, spray heat transfer in non-boiling regime was shown to be dependent on the velocity of the impinging spray in terms of Weber number and other related parameters which are in good agreement with those of previous studies. (author)

  18. Characterization of R-134A superheated droplet detector for neutron detection

    CERN Document Server

    Mondal, Prasanna Kumar; Chatterjee, Barun Kumar

    2013-01-01

    R-134A (C2H2F4) is a low cost, easily available and chlorine free refrigerant, which in its superheated state can be used as an efficient neutron detector. Due to its high solubility in water the R-134A based superheated droplet detectors (SDD) are usually very unstable unless the detector is fabricated using a suitable additive, which stabilizes the detector. The SDD is known to have superheated droplets distributed in a short-lived and in a relatively longer-lived metastable state. We have studied the detector response to neutrons using a 241AmBe neutron source and obtained the temperature variation of the nucleation parameters and the interstate kinetics of these droplets using a two-state model.

  19. MicroRNA-134 as a potential plasma biomarker for the diagnosis of acute pulmonary embolism

    Directory of Open Access Journals (Sweden)

    Liu Yi

    2011-09-01

    Full Text Available Abstract Background Acute pulmonary embolism (APE remains a diagnostic challenge due to a variable clinical presentation and the lack of a reliable screening tool. MicroRNAs (miRNAs regulate gene expression in a wide range of pathophysiologic processes. Circulating miRNAs are emerging biomarkers in heart failure, type 2 diabetes and other disease states; however, using plasma miRNAs as biomarkers for the diagnosis of APE is still unknown. Methods Thirty-two APE patients, 32 healthy controls, and 22 non-APE patients (reported dyspnea, chest pain, or cough were enrolled in this study. The TaqMan miRNA microarray was used to identify dysregulated miRNAs in the plasma of APE patients. The TaqMan-based miRNA quantitative real-time reverse transcription polymerase chain reactions were used to validate the dysregulated miRNAs. The receiver-operator characteristic (ROC curve analysis was conducted to evaluate the diagnostic accuracy of the miRNA identified as the candidate biomarker. Results Plasma miRNA-134 (miR-134 level was significantly higher in the APE patients than in the healthy controls or non-APE patients. The ROC curve showed that plasma miR-134 was a specific diagnostic predictor of APE with an area under the curve of 0.833 (95% confidence interval, 0.737 to 0.929; P Conclusions Our findings indicated that plasma miR-134 could be an important biomarker for the diagnosis of APE. Because of this finding, large-scale investigations are urgently needed to pave the way from basic research to clinical utilization.

  20. Experimental evaluation of a R134a/CO2 cascade refrigeration plant

    OpenAIRE

    Sanz Kock, Carlos; Llopis Doménech, Rodrigo; Sánchez García-Vacas, Daniel; Cabello López, Ramón; Torrella Alcaraz, Enrique

    2014-01-01

    We present the experimental evaluation of a R134a/CO2 cascade refrigeration plant designed for low evaporation temperature in commercial refrigeration applications. The test bench incorporates two single- stage vapour compression cycles driven by semi hermetic compressors coupled thermally through two brazed plate cascade heat exchangers working in parallel and controlled by electronic expansion valves. The experimental evaluation (45 steady-states) covers evaporating temperatures from -40 to...