
Sample records for cesium 117

  1. Cesium-137

    International Nuclear Information System (INIS)

    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  2. Cesium chemistry in irradiated fuel; cesium uranates

    International Nuclear Information System (INIS)

    The physico-chemical behaviour of fission products in nuclear fuel during and after irradiation has been studied extensively during the past decades. In spite of the large amount of chemical, crystallographic and thermodynamic data available, the knowledge on the very complicated UO2-fission product system is still far from complete. The paper discusses the multi variant character of uranium in cesium uranates, which has been assessed by a systematic X-ray Photoelectron Spectroscopy (XPS) study of a series of cesium uranates

  3. Decorporation of cesium-137

    International Nuclear Information System (INIS)

    Cesium radio-isotopes, especially cesium-137 (137Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  4. Analysis of radioactive cesium

    International Nuclear Information System (INIS)

    The procedure of analysis of cesium-137 in environmental samples is described. The standard measurement of cesium-137 is made by using a standard solution and a low background G-M counter system. Precipitation and dust are collected on a stainless steel pan. The collected samples are treated by evaporation and extraction or ion exchange and adsorption method. The sample is then quantitatively analyzed. The measurement of cesium-137 is made according to the standard of measurement. Samples collected from inland water and sea water are also treated by evaporation or ion exchange method. The measurements of cesium-137 are also made. This manual describes how to collect soil samples. The collected soil is dried and treated to make samples for activity measurement. Activity measurement is made according to the standard of measurement, then the data are analyzed. Samples are also collected from sediment of sea bottom or river bottom, agricultural products, milk, marine organisms, and daily foods. This manual describes on the methods to collect samples and the treatment to make samples for measurement. (Kato, T.)

  5. Cesium reservoir and interconnective components

    International Nuclear Information System (INIS)

    The program objective is to demonstrate the technology readiness of a TFE (thermionic fuel element) suitable for use as the basic element in a thermionic reactor with electric power output in the 0.5 to 5.0 MW range. A thermionic converter must be supplied with cesium vapor for two reasons. Cesium atoms adsorbed on the surface of the emitter cause a reduction of the emitter work function to permit high current densities without excessive heating of the emitter. The second purpose of the cesium vapor is to provide space-charge neutralization in the emitter-collector gap so that the high current densities may flow across the gap unattenuated. The function of the cesium reservoir is to provide a source of cesium atoms, and to provide a reserve in the event that cesium is lost from the plasma by any mechanism. This can be done with a liquid cesium metal reservoir in which case it is heated to the desired temperature with auxiliary heaters. In a TFE, however, it is desirable to have the reservoir passively heated by the nuclear fuel. In this case, the reservoir must operate at a temperature intermediate between the emitter and the collector, ruling out the use of liquid reservoirs. Integral reservoirs contained within the TFE will produce cesium vapor pressures in the desired range at typical electrode temperatures. The reservoir material that appears to be the best able to meet requirements is graphite. Cesium intercalates easily into graphite, and the cesium pressure is insensitive to loading for a given intercalation stage. The goals of the cesium reservoir test program were to verify the performance of Cs-graphite reservoirs in the temperature-pressure range of interest to TFE operation, and to test the operation of these reservoirs after exposure to a fast neutron fluence corresponding to seven year mission lifetime. In addition, other materials were evaluated for possible use in the integral reservoir

  6. Cesium-137 in biosphere

    International Nuclear Information System (INIS)

    The behaviour of cesium-137 in environment is reviewed. Problems on 137Cs migration in environment, on metabolism andbiological effects are considered. Data on nuclide accumulation in various plants, ways of their entering the man's organism are presented. It is marked that the rate of 137Cs metabolism in the man's organism depends considerably on age, sex, temperature of environment, conditions for activity, water and mineral metabolism and some other factors. It is shown that the annual effective equivalent dose per capita will increase to 2000 yr. up to 1 μSv, that constitutes 0.05% of the average value of irradiation by a natural source

  7. Cesium Concentration in MCU Solvent

    International Nuclear Information System (INIS)

    During Modular Caustic-Side Solvent Extraction (CSSX) Unit (MCU) operations, Cs-137 concentrations in product streams will vary depending on the location in the process and on the recent process conditions. Calculations of cesium concentrations under a variety of operating conditions reveal the following: (1) Under nominal operations with salt solution feed containing 1.1 Ci Cs-137 per gallon, the maximum Cs-137 concentration in the process will occur in the strip effluent (SE) and equal 15-16.5 Ci/gal. (2) Under these conditions, the majority of the solvent will contain 0.005 to 0.01 Ci/gal, with a limited portion of the solvent in the contactor stages containing ∼4 Ci/gal. (3) When operating conditions yield product near 0.1 Ci Cs-137/gal in the decontaminated salt solution (DSS), the SE cesium concentration will be the same or lower than in nominal operations, but majority of the stripped solvent will increase to ∼2-3 Ci/gal. (4) Deviations in strip and waste stream flow rates cause the largest variations in cesium content: (a) If strip flow rates deviate by -30% of nominal, the SE will contain ∼23 Ci/gal, although the cesium content of the solvent will increase to only 0.03 Ci/gal; (b) If strip flow rate deviates by -77% (i.e., 23% of nominal), the SE will contain 54 Ci/gal and solvent will contain 1.65 Ci/gal. At this point, the product DSS will just reach the limit of 0.1 Ci/gal, causing the DSS gamma monitors to alarm; and (c) Moderate (+10 to +30%) deviations in waste flow rate cause approximately proportional increases in the SE and solvent cesium concentrations. Recovery from a process failure due to poor cesium stripping can achieve any low cesium concentration required. Passing the solvent back through the contactors while recycling DSS product will produce a ∼70% reduction during one pass through the contactors (assuming the stripping D value is no worse than 0.36). If the solvent is returned to the solvent hold tank (containing additional

  8. Cesium in the nutrient cycle

    International Nuclear Information System (INIS)

    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland

  9. Cesium contamination of heather honey

    International Nuclear Information System (INIS)

    In heather honey from Lueneburger Heide, FRG, relatively high values of cesium activity were found (up to about 650 Bq/kg). Activity values for heather honey, Calluna vulgaris plants and soil were measured. It is assumed that the origin of this activity is the direct Chernobyl fallout. There may also be a high transfer of cesium from the soil to the Calluna vulgaris plant, but in order to determine the transfer factor, fresh plants are needed, which have grown later than in spring 1986. (author) 21 refs.; 2 figs.; 2 tabs

  10. Cesium transport data for HTGR systems

    International Nuclear Information System (INIS)

    Cesium transport data on the release of cesium from HTGR fuel elements are reviewed and discussed. The data available through 1976 are treated. Equations, parameters, and associated variances describing the data are presented. The equations and parameters are in forms suitable for use in computer codes used to calculate the release of metallic fission products from HTGR fuel elements into the primary circuit. The data cover the following processes: (1) diffusion of cesium in fuel kernels and pyrocarbon, (2) sorption of cesium on fuel rod matrix material and on graphite, and (3) migration of cesium in graphite. The data are being confirmed and extended through work in progress

  11. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)


    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  12. Therapeutic tin-117m compositions (United States)

    Srivastava, Suresh C.; Meinken, George E.; Mausner, Leonard F.; Atkins, Harold L.


    The invention provides a method for the palliation of bone pain due to cancer by the administration of a unique dosage of a tin-117m (Sn-117m) stannic chelate complex in a pharmaceutically acceptable composition. In addition, the invention provides a method for simultaneous palliation of bone pain and radiotherapy in cancer patients using compositions containing Sn-117m chelates. The invention also provides a method for palliating bone pain in cancer patients using Sn-117m-containing compositions and monitoring patient status by imaging the distribution of the Sn-117m in the patients. Also provided are pharmaceutically acceptable compositions containing Sn-117m chelate complexes for the palliation of bone pain in cancer patients.

  13. Extraction of radioactive cesium from tea leaves

    International Nuclear Information System (INIS)

    Radioactive contamination of foodstuffs attributed to the Fukushima Daiichi nuclear disaster has become a social problem. This study investigated the extraction of radioactive cesium from the contaminated leaves to the tea. The green tea was brewed twice reusing the same leaves to study the difference in extraction of cesium between the first and second brew. Moreover, the extraction of cesium was studied in correlation to brewing time. The concentration of radioactive cesium was determined with gamma spectrometry, and the concentration of caffeine was determined with absorption spectrometry. About 40% of cesium was extracted from leaves in the first brew, and about 80% was extracted in the second brew. The extraction of cesium increased over time, and it reached about 80% after 10 minutes brew. The ratio of radioactive cesium to caffeine decreased linearly over time. This study revealed that the extraction of cesium was higher for the second brew, and a rapid increase in extraction was seen as the tea was brewed for 6 minutes and more. Therefore, the first brew of green tea, which was brewed within 5 minutes, contained the least extraction of radioactive cesium from the contaminated leaves. (author)

  14. Activity of cesium-134 and cesium-137 in game and mushrooms in Poland

    International Nuclear Information System (INIS)

    The activity of cesium-134 and cesium-137 was measured in mushrooms and game in 1986-1991. The samples were collected all over Poland and most of the measurements were carried out for export purposes. The results indicate that the activity ratio of cesium-137 to cesium-134 in some samples is not comparable to that with fallout after the Chernobyl accident. The analysis of some samples of mushrooms from 1985 showed that the activity of cesium-137 was higher compared to any other foodstuff. The level of contamination varied greatly throughout Poland

  15. PIXE analyses of cesium in rice grains (United States)

    Sugai, Hiroyuki; Ishii, Keizo; Matsuyama, Shigeo; Terakawa, Atsuki; Kikuchi, Yohei; Takahashi, Hiroaki; Ishizaki, Azusa; Fujishiro, Fumito; Arai, Hirotsugu; Osada, Naoyuki; Karahashi, Masahiro; Nozawa, Yuichiro; Yamauchi, Shosei; Kikuchi, Kosuke; Koshio, Shigeki; Watanabe, Koji


    The Fukushima nuclear power plant accident released vast amounts of radioactive material into the environment. For instance, 134Cs and 137Cs have half-lives of about 2 and 30 years, respectively, and emit many harmful gamma rays. In 2012, rice with radioactivity >100 Bq/kg was occasionally reported in Fukushima prefecture. To determine where and how cesium accumulates in rice, we grew rice in soil containing stable cesium and investigated the distribution of cesium in rice using particle-induced X-ray emission (PIXE). This study found that cesium is accumulated in bran and germ at high concentrations, and white rice contains 40% of the cesium found in brown rice.

  16. Multiphoton ionization of atomic cesium

    International Nuclear Information System (INIS)

    We describe experimental studies of resonantly enhanced multiphoton ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photoelectron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photoionization signal. For both ns and np states the field induced MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength. Finally, we note that the classical two-photon field-ionization threshold is lower for the case in which the laser polarization and the electric field are parallel than it is when they are perpendicular. 22 references, 11 figures

  17. Surface tension of liquid dilute solutions of lead-cesium and bismuth-cesium systems

    International Nuclear Information System (INIS)

    Method of the maximal pressure in a drop was used to measure the surface tension of 15 liquid dilute solutions of lead-cesium system in 0-0.214 at% concentration range and of 12 diluted solutions of bismuth-cesium system in 0-0.160 at.% cesium range from solidification temperature up to 500 dec C. It was found that cesium was characterized as surfactant in lead and bismuth melts. It was established that the temperature coefficient of surface tension changes sufficiently in maximally diluted solutions of alkali metals in bismuth and lead melts. Effect of sodium, potassium, rubidum and cesium on the value of surface tension of lead and bismuth was systematized. Growth of activity in sodium, potassium, rubidium and cesium series was noted

  18. Application of Cesium isotopes in daily life

    International Nuclear Information System (INIS)

    In the world of science, the desire of the scientific community to discover new chemical elements is crucial for the development of new technologies in various fields of knowledge. And the main chemical element addressed by this article is Cesium, but specifically 133Cesium isotope and radioisotope 137Cesium, exemplifying their physical and chemical characteristics, and their applications. This article will also show how these isotopes have provided researchers a breakthrough in the field of radiological medicine and in time and frequency metrology. (author)

  19. Decontamination of radioactive cesium in soil

    International Nuclear Information System (INIS)

    Agricultural soil containing radioactive cesium was decontaminated using an extraction method involving aqueous potassium solutions. Results demonstrated that the potassium solution could extract radioactive cesium from soil artificially contaminated with 137Cs, although extraction rate decreased as time after contamination increased. However, visual examination of radioactivity distribution in soil samples significantly contaminated by the accident at the Fukushima Daiichi nuclear power plant showed that radioactive cesium also existed as insoluble particles. Therefore, reducing the volume of radioactive wastes generated from soil decontamination requires a physical decontamination method combined with chemical treatment. (author)

  20. Studies on cesium uptake by phenolic resins

    International Nuclear Information System (INIS)

    The selective removal of cesium by phenolic ion-exchange resins from highly salted alkaline radioactive solutions was studied. The resins were synthesized by alkaline polycondensation of phenol, resorcinol, catechol, and resorcinol-catechol mixture with formaldehyde and characterized for their moisture regain, ion-exchange (H+ → Na+) capacity, and distribution coefficient (KD) for cesium. The effects of open and sealed curing of the polymers on their properties were studied. The effect of Na+, NaOH, and Cs+ concentration on the uptake of cesium by resorcinol-formaldehyde resin was investigated, in particular. The chemical, thermal, and radiation stabilities of the polymers were also studied

  1. Sorption of cesium on Latvian clays

    International Nuclear Information System (INIS)

    Cesium is like potassium - good solubility and mobile in a ground, easily assimilate in organism expressly brawn woof. It is a problem if pollutant is a radioactive 137Cs. We made experiments to sorption a 2M CsF solution on some Latvian clays which mainly contain hydro micas (cesium content after good elute of clays are in table). We establish, that clay treated with 25 % sulfuric acid adsorb cesium two times more that waste clay. Hereto unstuck elute Cs from clays. (author)

  2. 33 CFR 117.403 - Wabash River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.403 Section 117.403 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Indiana § 117.403 Wabash River. See § 117.397, Wabash...

  3. Method for monitoring radioactive cesium concentration in water using cesium adsorption disk and GM survey meter

    International Nuclear Information System (INIS)

    A method for monitoring radioactive cesium concentration in water using a cesium adsorption disk and a GM survey meter has been developed to ascertain whether the water quality meets standards on radiological contaminants in water. In this method, both dissolved and suspended forms of radioactive cesium are collected on the cesium adsorption disk by means of filtration of a water sample. Beta count rate of the disk is converted into radioactivity using a conservative calibration factor obtained here. The present method was applied to monitoring of decontaminated water of an outdoor school swimming pool in Date City after Fukushima Daiichi Nuclear Power Plant accident. (author)

  4. Trapping characteristics for gaseous cesium generated from different cesium compounds by fly ash filter

    International Nuclear Information System (INIS)

    The purpose of this study is to evaluate the applicability of the fly ash ceramic foam filter to trap gaseous cesium generated during the OREOX and sintering processes of DUPIC green pellets. The trapping experiments of gaseous cesium generated from different cesium compounds using fly ash filters were carried out in a two-zone furnace under air and hydrogen (Ar/4% H2) conditions. XRD and SEM analyses were used to analyze reaction products of different cesium compounds with fly ash filters. To manufacture ceramic foam filters, fly ash with a Si/Al mole ratio of 2.1 and polyvinyl alcohol as binder were used. Reaction products formed by the trapping reaction of different cesium compounds with fly ash filters were investigated. The major reaction products of gaseous cesium generated from cesium silicate and CsI by fly ash filters indicated that pollucite (CsAlSi2O6) phase was formed under air and hydrogen conditions when the carrier gas velocity was 2 cm/sec. The minimum reaction temperature of fly ash filter with gaseous cesium was determined as about 600 deg. C. Finally, off-gas treatment system of sintering process in a hot cell of lMEF was explained as an application example of fly ash filter for trapping gaseous cesium. (author)

  5. Sintered wire cesium dispenser photocathode

    Energy Technology Data Exchange (ETDEWEB)

    Montgomery, Eric J; Ives, R. Lawrence; Falce, Louis R


    A photoelectric cathode has a work function lowering material such as cesium placed into an enclosure which couples a thermal energy from a heater to the work function lowering material. The enclosure directs the work function lowering material in vapor form through a low diffusion layer, through a free space layer, and through a uniform porosity layer, one side of which also forms a photoelectric cathode surface. The low diffusion layer may be formed from sintered powdered metal, such as tungsten, and the uniform porosity layer may be formed from wires which are sintered together to form pores between the wires which are continuous from the a back surface to a front surface which is also the photoelectric surface.

  6. Cesium and strontium ion specific exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Yates, S.


    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with AlliedSignal, Inc. (Des Plaines, Illinois) to develop inorganic ion exchangers that are selective for strontium and cesium from alkaline high-level waste and groundwater streams.

  7. Sorption of Cesium on Latvia clays

    International Nuclear Information System (INIS)

    Cesium is like potassium - good solubility and mobile in a ground, easy assimilates in organism expressly brawn woof. It is a problem if pollutant is radioactive 137Cs. We made experiments to sorption a 2M CsF solution on some Latvian clays which mainly contain hydro micas. We establish that clay treated with 25% sulfuric acid absorb cesium two times more that waste clay. Hereto unstuck elute Cs from clays

  8. Removal of cesium from wastewater: A cesium-specific ion exchange resin

    International Nuclear Information System (INIS)

    Researchers at the Savannah River Laboratory (SRL) have applied for a patent for an ion exchange resin that will remove cesium from water. Radioactive cesium-137 is a fission product of nuclear reactor operations. Cesium may enter the water of spent fuel holding basins through defects in fuel cladding. Control of cesium in these basins is desirable to keep personnel exposure to a minimum. Cesium is also present in the waste from reprocessing of defense nuclear reactor fuel. Research has been underway at SRL for over a decade to improve management of high-level reprocessing waste. The current technology separates the waste into soluble and insoluble components. Radioactive constituents are removed from the soluble component stream and combined with the insoluble components, which are then converted to a glass for long-term storage. Cesium is the most radioactive constituent of the soluble components stream. The SRL resin is a resorcinol-formaldehyde condensation polymer highly specific for cesium and is about 10 times more effective in removal of cesium than other ion exchange resins evaluated for use in processing defense nuclear waste. Tests have been run at SRL using both simulated and actual waste streams

  9. Radioactive cesium in Finnish mushrooms

    International Nuclear Information System (INIS)

    Surveillance of radioactive cesium in Finnish mushrooms was started in 1986 at STUK. Results of the surveillance programs carried out in Lapland and other parts of Finland are given in this report. More than 2000 samples of edible mushrooms have been analysed during 1986-2008. The 137Cs detected in the mushrooms mainly originates from the 137Cs deposition due to the accident at the Chernobyl nuclear power plant in 1986. The 137Cs concentrations of mushrooms in the end of 1970s and in the beginning of 1980s varied from some ten to two hundred becquerels per kilogram originating from the nuclear weapon test period. The uneven division of the Chernobyl fallout is seen in the areal variation of 137Cs concentrations of mushrooms, the 137Cs concentrations being about tenfold in the areas with the highest deposition compared to those where the deposition was lowest. After the Chernobyl accident the maximum values in the 137Cs concentrations were reached during 1987-88 among most species of mushrooms. The 137Cs concentrations have decreased slowly, being in 2008 about 40 per cent of the maximum values. The 137Cs concentrations may be tenfold in the mushroom species with high uptake of cesium (Rozites caperatus, Hygrophorus camarophyllus, Lactarius trivialis) compared to the species with low uptake (Albatrellus ovinus, Leccinum sp.) picked in the same area. The 137Cs contents in certain species of commercial mushrooms in Finland still exceed the maximum permitted level, 600 Bq/kg, recommended to be respected when placing wild game, wild berries, wild mushrooms and lake fish on the market (Commission recommendation 2003/274/Euratom). Therefore, the 137Cs concentrations of mushrooms should be measured before placing them on the market in the areas of the highest 137Cs deposition, except for Albatrellus ovinus, Boletus sp. and Cantharellus cibarius. The 137Cs concentrations of common commercial mushroom species, Cantharellus tubaeformis and Craterellus cornucopioides often

  10. 33 CFR 117.979 - Sabine Lake. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sabine Lake. 117.979 Section 117.979 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.979 Sabine Lake. The draw of the S82 bridge, mile...

  11. 33 CFR 117.434 - Caddo Lake. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Caddo Lake. 117.434 Section 117.434 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.434 Caddo Lake. The draw of the Kansas...

  12. 33 CFR 117.755 - Shrewsbury River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Shrewsbury River. 117.755 Section 117.755 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.755 Shrewsbury River. (a) The...

  13. 33 CFR 117.309 - Nassau Sound. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nassau Sound. 117.309 Section 117.309 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.309 Nassau Sound. The draw of the Fernandina...

  14. 32 CFR 724.117 - Discharge review. (United States)


    ... 32 National Defense 5 2010-07-01 2010-07-01 false Discharge review. 724.117 Section 724.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.117 Discharge review. A nonadversary administrative reappraisal at the level...

  15. 33 CFR 117.959 - Chocolate Bayou. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chocolate Bayou. 117.959 Section 117.959 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.959 Chocolate Bayou. The draw of the...

  16. 33 CFR 117.1095 - Root River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Root River. 117.1095 Section 117.1095 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1095 Root River. (a) The draw of the Main...

  17. 33 CFR 117.955 - Buffalo Bayou. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Bayou. 117.955 Section 117.955 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.955 Buffalo Bayou. (a) The draw of...

  18. 33 CFR 117.917 - Battery Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Battery Creek. 117.917 Section 117.917 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.917 Battery Creek. The draw...

  19. 33 CFR 117.600 - Lagoon Pond. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lagoon Pond. 117.600 Section 117.600 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.600 Lagoon Pond. The draw of the Lagoon...

  20. 25 CFR 117.11 - Insurance. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Insurance. 117.11 Section 117.11 Indians BUREAU OF INDIAN... MEMBERS OF THE OSAGE TRIBE OF INDIANS WHO DO NOT HAVE CERTIFICATES OF COMPETENCY § 117.11 Insurance. The superintendent may obtain policies of insurance covering the restricted property, real or personal, of...

  1. 42 CFR 435.117 - Newborn children. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Newborn children. 435.117 Section 435.117 Public..., Children Under 8, and Newborn Children § 435.117 Newborn children. (a) The agency must provide Medicaid eligibility to a child born to a woman who has applied for, has been determined eligible and is...

  2. 33 CFR 117.438 - Company Canal. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Company Canal. 117.438 Section 117.438 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.438 Company Canal. (a) The draw of...

  3. 33 CFR 117.177 - Mud Slough. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mud Slough. 117.177 Section 117.177 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.177 Mud Slough. The draw of the Union...

  4. 33 CFR 117.543 - Bear Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bear Creek. 117.543 Section 117.543 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.543 Bear Creek. (a) The draws of the...

  5. 33 CFR 117.263 - Banana River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers...

  6. 14 CFR 415.117 - Ground safety. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 415.117 Section 415.117... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.117 Ground safety. (a) General. An applicant's safety...

  7. 33 CFR 117.703 - Bass River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bass River. 117.703 Section 117.703 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.703 Bass River. The draw of the U.S. 9...

  8. 33 CFR 117.107 - Chattahoochee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chattahoochee River. 117.107 Section 117.107 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.107 Chattahoochee River. The draws...

  9. 33 CFR 117.486 - Pearl River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pearl River. 117.486 Section 117.486 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.486 Pearl River. (a) The draw of the...

  10. 33 CFR 117.135 - Red River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Red River. 117.135 Section 117.135 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.135 Red River. The draws of the bridges...

  11. 33 CFR 117.547 - Bush River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bush River. 117.547 Section 117... OPERATION REGULATIONS Specific Requirements Maryland § 117.547 Bush River. The draw of the Amtrak bridge... Superintendent at 301-291-4278 by an authorized representative of the Bush River Yacht Club by noon on the...

  12. 33 CFR 117.359 - Chattahoochee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chattahoochee River. 117.359... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.359 Chattahoochee River. See § 117.107, Chattahoochee River, listed under Alabama....

  13. 33 CFR 117.337 - Trout River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Trout River. 117.337 Section 117... OPERATION REGULATIONS Specific Requirements Florida § 117.337 Trout River. The draw of the CSX Railroad Bridge across the Trout River, mile 0.9 at Jacksonville, operates as follows: (a) The bridge is...

  14. 33 CFR 117.131 - Little River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little River. 117.131 Section 117.131 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.131 Little River. The draws of the...

  15. 33 CFR 117.523 - Back River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Back River. 117.523 Section 117.523 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.523 Back River. The draw of the Maine Department...

  16. 33 CFR 117.109 - Coosa River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Coosa River. 117.109 Section 117.109 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.109 Coosa River. The draw of the...

  17. 33 CFR 117.491 - Red River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Red River. 117.491 Section 117.491 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.491 Red River. (a) The draw of the Union...

  18. 33 CFR 117.121 - Arkansas River (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Arkansas River 117.121 Section 117.121 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.121 Arkansas River The draw of...

  19. 33 CFR 117.567 - Patuxent River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Patuxent River. 117.567 Section 117.567 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.567 Patuxent River. The draw of...

  20. 33 CFR 117.139 - White River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false White River. 117.139 Section 117.139 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.139 White River. (a) The draws of the St....

  1. 33 CFR 117.187 - Petaluma River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Petaluma River. 117.187 Section 117.187 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.187 Petaluma River. (a) The draws...

  2. 33 CFR 117.365 - Oconee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oconee River. 117.365 Section 117.365 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.365 Oconee River. The draw of the SR46...

  3. 33 CFR 117.319 - Oklawaha River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oklawaha River. 117.319 Section 117.319 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.319 Oklawaha River. (a) The draw of...

  4. 33 CFR 117.575 - Susquehanna River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Susquehanna River. 117.575 Section 117.575 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.575 Susquehanna River. The draw of...

  5. 33 CFR 117.480 - Mermentau River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mermentau River. 117.480 Section 117.480 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.480 Mermentau River. The draw of...

  6. 33 CFR 117.389 - Calumet River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Calumet River. 117.389 Section 117.389 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Illinois § 117.389 Calumet River. The draws of...

  7. 33 CFR 117.423 - Atchafalaya River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Atchafalaya River. 117.423 Section 117.423 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.423 Atchafalaya River. The draw of...

  8. 33 CFR 117.381 - Clearwater River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Clearwater River. 117.381 Section 117.381 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.381 Clearwater River. The draws of...

  9. 33 CFR 117.127 - Current River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Current River. 117.127 Section 117.127 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.127 Current River. The draws of...

  10. 33 CFR 117.219 - Pequonnock River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pequonnock River. 117.219 Section 117.219 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.219 Pequonnock River. (a)...

  11. 33 CFR 117.588 - Bass River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bass River. 117.588 Section 117.588 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.588 Bass River. The Hall Whitaker...

  12. 33 CFR 117.551 - Chester River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chester River. 117.551 Section 117.551 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.551 Chester River. The draw of the...

  13. 33 CFR 117.361 - Flint River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Flint River. 117.361 Section 117.361 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.361 Flint River. The draws of the...

  14. 33 CFR 117.205 - Connecticut River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Connecticut River. 117.205 Section 117.205 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.205 Connecticut River. (a)...

  15. 33 CFR 117.533 - Sheepscot River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sheepscot River. 117.533 Section 117.533 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.533 Sheepscot River. The draw of the...

  16. 33 CFR 117.503 - Tensas River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tensas River. 117.503 Section 117.503 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.503 Tensas River. The draws of the S15...

  17. 33 CFR 117.553 - Choptank River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Choptank River. 117.553 Section 117.553 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.553 Choptank River. (a) The draw of...

  18. 33 CFR 117.211 - Mystic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mystic River. 117.211 Section 117.211 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.211 Mystic River. (a) The draw of the...

  19. 33 CFR 117.305 - Miami River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Miami River. 117.305 Section 117.305 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.305 Miami River. (a) General. Public vessels...

  20. 33 CFR 117.457 - Houston River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of...

  1. 33 CFR 117.367 - Ogeechee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ogeechee River. 117.367 Section 117.367 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.367 Ogeechee River. (a) The draw of...

  2. 33 CFR 117.363 - Ocmulgee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ocmulgee River. 117.363 Section 117.363 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.363 Ocmulgee River. The draws of...

  3. 33 CFR 117.587 - Apponagansett River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apponagansett River. 117.587 Section 117.587 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.587 Apponagansett River. (a)...

  4. 33 CFR 117.525 - Kennebec River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kennebec River. 117.525 Section 117.525 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.525 Kennebec River. (a) The draw of...

  5. 33 CFR 117.473 - Little River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little River. 117.473 Section 117.473 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.473 Little River. The draw of the Louisiana...

  6. 33 CFR 117.500 - Tchefuncta River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tchefuncta River. 117.500 Section 117.500 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.500 Tchefuncta River. The draw of...

  7. 33 CFR 117.295 - Kissimmee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kissimmee River. 117.295 Section 117.295 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.295 Kissimmee River. The draw of the...

  8. 33 CFR 117.215 - Niantic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niantic River. 117.215 Section 117.215 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.215 Niantic River. (a) The draw...

  9. 33 CFR 117.125 - Black River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black River. 117.125 Section 117.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.125 Black River. The following draws need not...

  10. 33 CFR 117.417 - Ohio River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ohio River. 117.417 Section 117.417 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kentucky § 117.417 Ohio River. The draw of the Southern...

  11. 33 CFR 117.385 - Snake River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.385 Section 117.385 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.385 Snake River. The drawspan of the U.S. 12...

  12. 33 CFR 117.407 - Missouri River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Missouri River. 117.407 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Iowa § 117.407 Missouri River. See § 117.691, Missouri River listed under Nebraska. Kansas...

  13. 33 CFR 117.101 - Alabama River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Alabama River. 117.101 Section 117.101 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.101 Alabama River. (a) The...

  14. 33 CFR 117.207 - Housatonic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Housatonic River. 117.207 Section 117.207 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.207 Housatonic River. (a) The...

  15. 33 CFR 117.397 - Wabash River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.397 Section 117... OPERATION REGULATIONS Specific Requirements Illinois § 117.397 Wabash River. The draws of the bridges across the Wabash River need not be opened for the passage of vessels. Indiana...

  16. 33 CFR 117.585 - Acushnet River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Acushnet River. 117.585 Section 117.585 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.585 Acushnet River. (a)...

  17. 33 CFR 117.271 - Blackwater River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blackwater River. 117.271 Section 117.271 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.271 Blackwater River. The draw of...

  18. 33 CFR 117.415 - Green River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Green River. 117.415 Section 117.415 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kentucky § 117.415 Green River. (a) The draw of the...

  19. 33 CFR 117.483 - Ouachita River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ouachita River. 117.483 Section 117.483 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.483 Ouachita River. The draw of the...

  20. 33 CFR 117.529 - Narraguagus River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Narraguagus River. 117.529 Section 117.529 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.529 Narraguagus River. The draw of...

  1. 33 CFR 117.183 - Old River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Old River. 117.183 Section 117... OPERATION REGULATIONS Specific Requirements California § 117.183 Old River. The draw of the California... notice is given to the drawtender at the Rio Vista bridge across the Sacramento River, mile 12.8....

  2. 33 CFR 117.241 - Mispillion River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mispillion River. 117.241 Section 117.241 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.241 Mispillion River. The draw of...

  3. 33 CFR 117.369 - Satilla River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Satilla River. 117.369 Section 117.369 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.369 Satilla River. The draw of...

  4. 33 CFR 117.371 - Savannah River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Savannah River. 117.371 Section 117.371 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.371 Savannah River. (a) The draw of...

  5. 33 CFR 117.509 - Vermilion River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Vermilion River. 117.509 Section 117.509 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.509 Vermilion River. (a) The draw...

  6. 33 CFR 117.253 - Anacostia River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Anacostia River. 117.253 Section 117.253 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.253 Anacostia River....

  7. 33 CFR 117.113 - Tensaw River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tensaw River. 117.113 Section 117.113 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.113 Tensaw River. The draw of the...

  8. 33 CFR 117.245 - Smyrna River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smyrna River. 117.245 Section 117.245 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.245 Smyrna River. The draw of the...

  9. 33 CFR 117.422 - Amite River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Amite River. 117.422 Section 117.422 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.422 Amite River. (a) The draw of the S22...

  10. 33 CFR 117.569 - Pocomoke River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pocomoke River. 117.569 Section 117.569 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.569 Pocomoke River. (a) The...

  11. 33 CFR 117.351 - Altamaha River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Altamaha River. 117.351 Section 117.351 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.351 Altamaha River. (a) The draws of...

  12. 33 CFR 117.224 - Thames River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Thames River. 117.224 Section 117.224 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.224 Thames River. The draw of the...

  13. 33 CFR 117.141 - American River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false American River. 117.141 Section 117.141 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.141 American River. The draw of...

  14. 33 CFR 117.133 - Ouachita River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ouachita River. 117.133 Section 117.133 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.133 Ouachita River. The draw of the...

  15. 33 CFR 117.255 - Potomac River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Potomac River. 117.255 Section 117.255 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.255 Potomac River. (a)...

  16. 33 CFR 117.427 - Black River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black River. 117.427 Section 117.427 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.427 Black River. The draw of the US84...

  17. 33 CFR 117.209 - Mianus River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mianus River. 117.209 Section 117.209 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.209 Mianus River. The draw of the...

  18. 33 CFR 117.171 - Middle River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Middle River. 117.171 Section 117... OPERATION REGULATIONS Specific Requirements California § 117.171 Middle River. (a) The draw of the San..., mile 9.8 near Middle River Station, shall open on signal if at least 12 hours notice is given to...

  19. 33 CFR 117.493 - Sabine River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sabine River. 117.493 Section 117.493 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.493 Sabine River. (a) The draw of the...

  20. 33 CFR 117.243 - Nanticoke River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nanticoke River. 117.243 Section 117.243 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.243 Nanticoke River. (a) The draw...

  1. 33 CFR 117.221 - Saugatuck River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Saugatuck River. 117.221 Section 117.221 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.221 Saugatuck River. (a)...

  2. 33 CFR 117.313 - New River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false New River. 117.313 Section 117.313 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.313 New River. (a) The draw of the SE....

  3. 33 CFR 117.565 - Miles River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Miles River. 117.565 Section 117.565 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.565 Miles River. The draw of the Route...

  4. 33 CFR 117.424 - Belle River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Belle River. 117.424 Section 117... OPERATION REGULATIONS Specific Requirements Louisiana § 117.424 Belle River. The draw of the S70 bridge, mile 23.8 (Landside Route) near Belle River, shall open on signal; except that, from 10 p.m. to 6...

  5. 7 CFR 15.117 - Evidence. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Evidence. 15.117 Section 15.117 Agriculture Office of... and Administrative Review Under the Civil Rights Act of 1964 Hearing Procedures § 15.117 Evidence. Irrelevant, immaterial, unreliable, and unduly repetitious evidence will be excluded, and technical rules...

  6. Plasma etching of cesium iodide

    International Nuclear Information System (INIS)

    Thick films of cesium iodide (CsI) are often used to convert x-ray images into visible light. Spreading of the visible light within CsI, however, reduces the resolution of the resulting image. Anisotropic etching of the CsI film into an array of micropixels can improve the image resolution by confining light within each pixel. The etching process uses a high-density inductively coupled plasma to pattern CsI samples held by a heated, rf-biased chuck. Fluorine-containing gases such as CF4 are found to enhance the etch rate by an order of magnitude compared to Ar+ sputtering alone. Without inert-gas ion bombardment, however, the CF4 etch becomes self-limited within a few microns of depth due to the blanket deposition of a passivation layer. Using CF4+Ar continuously removes this layer from the lateral surfaces, but the formation of a thick passivation layer on the unbombarded sidewalls of etched features is observed by scanning electron microscopy. At a substrate temperature of 220 deg. C, the minimum ion-bombardment energy for etching is Ei∼50 eV, and the rate depends on Ei1/2 above 65 eV. In dilute mixtures of CF4 and Ar, the etch rate is proportional to the gas-phase density of atomic fluorine. Above 50% CF4, however, the rate decreases, indicating the onset of net surface polymer deposition. These observations suggest that anisotropy is obtained through the ion-enhanced inhibitor etching mechanism. Etching exhibits an Arrhenius-type behavior in which the etch rate increases from ∼40 nm/min at 40 deg. C to 380 nm/min at 330 deg. C. The temperature dependence corresponds to an activation energy of 0.13±0.01 eV. This activation energy is consistent with the electronic sputtering mechanism for alkali halides

  7. Research on decontamination of cesium contaminated soil by electrokinetic process

    International Nuclear Information System (INIS)

    In this research, electrokinetic process was applied for the decontamination of cesium contaminated soil. As a result, about 4.0 times cesium removal was achieved by applying a DC electric field of 80 V/m to comparing zero electric field in treatment for 30 days. Therefore, the electrokinetic process has a possibility to decontamination of cesium contaminated soil. (author)

  8. Cesium ion uptake by moss (Hypnum cupressiforme)

    International Nuclear Information System (INIS)

    Lower land mosses uptake water and minerals from the atmosphere. They can collect metals polluting the air and radioactive fallout elements so they can be suitable for monitoring of these substances. Cesium ion uptake by Hypnum cupressiforme is studied by a radioactive tracer, 134Cs. The quantity of cesium ion in different celluar locations and the capacity of ion uptake is determined. The total capacity is found to be several times 10-3 mol g-1 and is therefore of the same order of magnitude as the cation exchange capacity of ion exchangers. The kinetics and reversibility of the process is studied as well. (orig.)

  9. Microbial accumulation of uranium, radium, and cesium

    International Nuclear Information System (INIS)

    Diverse microbial species varied considerably in their ability to accumulate uranium, cesium, and radium. Mechanistic differences in uranium uptake by Saccharomyces cerevisiae and Pseudomonas aeruginosa were indicated. S. serevisiae exhibited a slow (hours) surface accumulation of uranium which was subject to environmental factors, while P. aeruginosa accumulated uranium rapidly (minutes) as dense intracellular deposits and did not appear to be affected by environmental parameters. Metabolism was not required for uranium uptake by either organism. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several species tested

  10. Environmental transfer of radio-cesium

    International Nuclear Information System (INIS)

    A large amount of Cs 134 and 137 were emitted from the destroyed reactors of Fukushima Daiichi Nuclear Power Station and deposited on the soil surface of vast area including forests, fields, and residential areas. The present report explains mainly land transfer behaviors of cesium which deposited on the surface soils, absorbed into soil particles as time passed on and finally became difficult to move from the particles (aging effect). Depth-distribution of radio-cesium in rice paddy and grassland as well as the change over years is presented. Changes with the passage of time of Cs 137 concentrations in leaves of spinach, wormwood, and persimmon are also provided. (S. Ohno)

  11. Crystalline silicotitanates for cesium/strontium removal

    Energy Technology Data Exchange (ETDEWEB)

    Brown, N.; Miller, J.; Sherman, J.


    A new class of inorganic ion exchangers called crystalline silicotitanates (CST) has been developed that exhibits very high selectivity for cesium and strontium in the highly alkaline radioactive wastes at the Hanford Site and other DOE sites. Tests have also shown that CSTs have high selectivity for cesium in acidic and neutral solutions. The ESP is supporting an effort at Sandia National Laboratories and Texas A & M University to further develop and characterize the important chemical and physical properties that will determine the applicability of CST to radioactive waste treatment at Hanford and other DOE facilities.

  12. Cesium and Strontium Separation Technologies Literature Review

    Energy Technology Data Exchange (ETDEWEB)

    T. A. Todd; T. A. Todd; J. D. Law; R. S. Herbst


    Integral to the Advanced Fuel Cycle Initiative (AFCI) Program’s proposed closed nuclear fuel cycle, the fission products cesium and strontium in the dissolved spent nuclear fuel stream are to be separated and managed separately. A comprehensive literature survey is presented to identify cesium and strontium separation technologies that have the highest potential and to focus research and development efforts on these technologies. Removal of these high-heat-emitting fission products reduces the radiation fields in subsequent fuel cycle reprocessing streams and provides a significant short-term (100 yr) heat source reduction in the repository. This, along with separation of actinides, may provide a substantial future improvement in the amount of fuel that could be stored in a geologic repository. The survey and review of the candidate cesium and strontium separation technologies are presented herein. Because the AFCI program intends to manage cesium and strontium together, technologies that simultaneously separate both elements are of the greatest interest, relative to technologies that separate only one of the two elements.

  13. Scintillator handbook with emphasis on cesium iodide (United States)

    Tidd, J. L.; Dabbs, J. R.; Levine, N.


    This report provides a background of reasonable depth and reference material on scintillators in general. Particular attention is paid to the cesium iodide scintillators as used in the High Energy Astronomy Observatory (HEAO) experiments. It is intended especially for use by persons such as laboratory test personnel who need to obtain a working knowledge of these materials and their characteristics in a short time.

  14. Anomalous wetting of helium on cesium

    International Nuclear Information System (INIS)

    The authors report studies of the anomalous wetting of a cesium substrate by a liquid helium film by means of the technique of third sound. A hysteretic pre-wetting transition is observed as a function of the amount of helium in the experimental cell. 10 refs., 2 figs

  15. Composition and process for separating cesium ions from an acidic aqueous solution also containing other ions (United States)

    Dietz, M.L.; Horwitz, E.P.; Bartsch, R.A.; Barrans, R.E. Jr.; Rausch, D.


    A crown ether cesium ion extractant is disclosed as is its synthesis. The crown ether cesium ion extractant is useful for the selective purification of cesium ions from aqueous acidic media, and more particularly useful for the isolation of radioactive cesium-137 from nuclear waste streams. Processes for isolating cesium ions from aqueous acidic media using the crown ether cesium extractant are disclosed as are processes for recycling the crown ether cesium extractant and processes for recovering cesium from a crown ether cesium extractant solution. 4 figs.

  16. Strontium-90 and cesium-137 in milk

    International Nuclear Information System (INIS)

    The milk samples have been collected from 30 prefectures by prefectural public health laboratories and institutes (raw milk: 4 times per year for the report to WHO, and raw and city milk: 2 times per year), and analysed for strontium-90 and cesium-137 content at Japan Chemical Analysis Center. Collected samples were the raw milk and the city ones for the producing districts and the consuming ones, respectively. Three liters of fresh milk were carbonized in each prefectural public health laboratories and institutes, and then it was asked at Japan Chemical Analysis Center. The ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The nuclides was dissolved into hydrochloric acid and filtrated, after it was added with nitric acid and heated to dryness. The filtrate was radiochemically analysed for strontium-90 and cesium-137 using the method recommended by Science and Technology Agency. (author)

  17. Cesium stress and adaptation in pseudomonas fluorescens

    International Nuclear Information System (INIS)

    Industrialization and acid rain have led to a marked increment on the bioavailability of numerous metals. These metallic pollutants pose a serious threat to the ecosystem due to their ability to interact negatively with living organisms. Thus, considerable effort has been directed towards the development of environmentally-friendly technologies tailored to the management of metal wastes. As microbes are known to adapt to most environmental stresses, they constitute organisms of choice in the study of molecular adaptation processes. The adaptive features may be subsequently engineered for biotechnological applications. Cesium, a monovalent metal with chemical similarities to potassium but no know essential biological function has become a cause of environmental concern owing to its accidental release from the Chernobyl nuclear accident. This study examines the impact of cesium on the soil microbe Pseudomonas fluorescensts, and discusses the possibilities of its use in management of this nuclear waste. 15 refs., 3 figs

  18. Thermochemical evaluation and preparation of cesium uranates

    International Nuclear Information System (INIS)

    Two kinds of cesium uranates, Cs2UO4 and Cs2U2O7, which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U3O8 and Cs2CO3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs2UO4 and Cs2U2O7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs2UO4 and Cs2U2O7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  19. Cesium legacy safety project management work plan

    International Nuclear Information System (INIS)

    This Management Work Plan (MWP) describes the process flow, quality assurance controls, and the Environment, Safety, and Health requirements of the Cesium Legacy Safety Project. This MWP provides an overview of the project goals and methods for repackaging the non-conforming Type W overpacks and packaging the CsCl powder and pellets. This MWP is not intended to apply to other activities associated with the CsCl Legacy Safety Program (i.e., clean out of South Cell)

  20. Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae

    International Nuclear Information System (INIS)

    Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad

  1. Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae

    Energy Technology Data Exchange (ETDEWEB)

    Stek, M. Jr.; Minard, P.; Cruess, D.F.


    Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad.

  2. Sorption of cesium 137 by steel from sodium melt

    International Nuclear Information System (INIS)

    Sorption of cesium-137 radionuclide by Kh18N10T steel from sodium melt at different temperatures (150-450 deg C) has been studied. Equilibrium coefficients of cesium distribution between sodium and steel are determined, which depend on the conditions of sorption realization, such as cesium concentration in sodium melt, the content of oxygen admixture in sodium and the state of sorbing surface

  3. Cesium-137 as a radiation source

    International Nuclear Information System (INIS)

    The U.S. Department of Energy (DOE) Byproducts Utilization Program (BUP) seeks to develop and encourage widespread commercial use of defense byproducts that are produced by DOE. Cesium-l37 is one such byproduct that is radioactive and decays with emission of gamma rays. The beneficial use of this radiation to disinfect sewage sludge or disinfest food commodities is actively being pursued by the program. The radiation produced by cesium-l37(Cs-l37) is identical in form to that produced by cobalt-60(Co-60), an isotope that is widely used in commercial applications such as medical product sterilization. The choice of isotope to use depends on several factors ranging from inherent properties of the isotopes to availability and cost. The BUP, although centrally concerned with the beneficial use of Cs-l37, by investigating and assessing the feasibility of various uses hopes to define appropriate circumstances where cesium or cobalt might best be used to accomplish specific objectives. This paper discusses some of the factors that should be considered when evaluating potential uses for isotopic sources

  4. Removal of cesium from red deer meat

    International Nuclear Information System (INIS)

    The effect was studied of marinading on the reduction of cesium radionuclide activity in red deer meat contaminated by ingestion of feed containing 134Cs+137Cs from radioactive fallout following the Chernobyl accident. Two types of marinade were studied, viz., a vinegar infusion and a vinegar infusion with an addition of vegetables and spices. The meat was chopped to cubes of about 1.5 cm in size and the marinading process took place at temperatures of 5 and 11 degC. The drop of cesium content in the meat was determined by gamma spectrometry at given time intervals. The replacement of the marinade and the duration of the process were found to maximally affect efficiency. If the solution was not replaced, about 80% of cesium radionuclides were removed after seven hours of marinading. With one replacement of the infusion the drop in 134Cs+137Cs radioactivity amounted to up to 90% after seven hours of marinading. No effects were shown of vegetable additions to the vinegar infusion and of the change in temperature from 5 to 11 degC on the efficiency of the process. (author). 3 tabs., 6 refs

  5. 33 CFR 117.603 - Manchester Harbor. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Manchester Harbor. 117.603... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.603 Manchester Harbor. The Massachusetts Bay Transportation Authority Bridge at mile 1.0 in Manchester, shall operate as follows: (a)...

  6. 9 CFR 117.4 - Test animals. (United States)



  7. 14 CFR 91.117 - Aircraft speed. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aircraft speed. 91.117 Section 91.117... speed. (a) Unless otherwise authorized by the Administrator, no person may operate an aircraft below 10... than the maximum speed prescribed in this section, the aircraft may be operated at that minimum speed....

  8. 33 CFR 117.773 - Buffalo River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo River. 117.773 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.773 Buffalo River. (a) The draw of the Michigan Avenue bridge, mile 1.3, at Buffalo, shall operate as follows: (1) From March 22 through...

  9. 49 CFR 194.117 - Training. (United States)


    ... for emergency response operations in 29 CFR 1910.120, including volunteers or casual laborers employed during a response who are subject to those standards pursuant to 40 CFR part 311. ... 49 Transportation 3 2010-10-01 2010-10-01 false Training. 194.117 Section 194.117...

  10. 9 CFR 117.1 - Applicability. (United States)


    ... Applicability. (a) All animals used in licensed establishments in the preparation or testing of biological... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Applicability. 117.1 Section 117.1 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  11. 13 CFR 117.12 - Mediation. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Mediation. 117.12 Section 117.12... Mediation. (a) SBA shall, after ensuring that the complaint falls within the coverage of this Act and all... clearly within an exception, promptly refer the complaint to the Federal Mediation and...

  12. 33 CFR 117.189 - Sacramento River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sacramento River. 117.189 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.189 Sacramento River. (a) The draws of each bridge from Isleton to American River junction shall open on signal from May 1...

  13. 33 CFR 117.175 - Mokelumne River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mokelumne River. 117.175 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.175 Mokelumne River. (a) The draw of the California Department of Transportation highway bridge, the Mokelumne River Bridge, mile 3.0,...

  14. 33 CFR 117.527 - Kennebunk River. (United States)


    ... board gages in accordance with 33 CFR 118.160, of this chapter. ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kennebunk River. 117.527 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.527 Kennebunk River. The Dock...

  15. 33 CFR 117.217 - Norwalk River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Norwalk River. 117.217 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.217 Norwalk River. (a) The draw of.... to 12 p.m., on the first Saturday in December, to facilitate the running of the annual Norwalk...

  16. 33 CFR 117.299 - Loxahatchee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Loxahatchee River. 117.299... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.299 Loxahatchee River. The draw of the Florida East Coast Railway bridge across the Loxahatchee River, mile 1.2 at Jupiter, operates as...

  17. 33 CFR 117.291 - Hillsborough River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hillsborough River. 117.291... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.291 Hillsborough River. (a) The... the CSX Railroad Bridge across the Hillsborough River, mile 0.7, at Tampa, operates as follows:...

  18. 33 CFR 117.258 - Apalachicola River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apalachicola River. 117.258... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.258 Apalachicola River. The draw of the CSX Railroad bridge, mile 105.9, at River Junction shall open on signal Monday through Friday from 8...

  19. 33 CFR 117.391 - Chicago River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chicago River. 117.391 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Illinois § 117.391 Chicago River. The draws of the bridges operated by the City of Chicago over the Main Branch of Chicago River, the bridges on the...

  20. 33 CFR 117.300 - Manatee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Manatee River. 117.300 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.300 Manatee River. The draw of the CSX Railroad Bridge across the Manatee River, mile 4.5 Bradenton, operates as follows: (a) The bridge is...

  1. 33 CFR 117.237 - Christina River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Christina River. 117.237 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.237 Christina River. (a) The owners of... Bridge over Christina River at milepost 1.4 will be closing to river traffic.” Five short blasts of...

  2. 33 CFR 117.593 - Chelsea River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chelsea River. 117.593 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.593 Chelsea River. All drawbridges across the Chelsea River shall open on signal. The opening signal for each drawbridge is two...

  3. 33 CFR 117.531 - Piscataqua River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Piscataqua River. 117.531 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.531 Piscataqua River. (a) The following requirements apply to all bridges across the Piscataqua River: (1) Public vessels of the United...

  4. 33 CFR 117.411 - Missouri River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Missouri River. 117.411 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kansas § 117.411 Missouri River. The draws of the bridges across the Missouri River shall open on signal; except during the winter season between the...

  5. 33 CFR 117.333 - Suwannee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Suwannee River. 117.333 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.333 Suwannee River. The draw of Suwannee River bridge, mile 35 at Old Town need not be opened for the passage of vessels, however, the draw...

  6. 33 CFR 117.570 - Sassafras River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sassafras River. 117.570 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.570 Sassafras River. The draw of the Sassafras River (Route 213) bridge, mile 10.0 at Georgetown, Maryland, shall open on signal; except...

  7. Surface interactions of cesium and boric acid with stainless steel

    International Nuclear Information System (INIS)

    In this report, the effects of cesium hydroxide and boric acid on oxidized stainless steel surfaces at high temperatures and near one atmosphere of pressure are investigated. This is the first experimental investigation of this chemical system. The experimental investigations were performed using a mass spectrometer and a mass electrobalance. Surfaces from the different experiments were examined using a scanning electron microscope to identify the presence of deposited species, and electron spectroscopy for chemical analysis to identify the species deposited on the surface. A better understanding of the equilibrium thermodynamics, the kinetics of the steam-accelerated volatilizations, and the release kinetics are gained by these experiments. The release rate is characterized by bulk vaporization/gas-phase mass transfer data. The analysis couples vaporization, deposition, and desorption of the compounds formed by cesium hydroxide and boric acid under conditions similar to what is expected during certain nuclear reactor accidents. This study shows that cesium deposits on an oxidized stainless steel surface at temperatures between 1000 and 1200 Kelvin. Cesium also deposits on stainless steel surfaces coated with boric oxide in the same temperature ranges. The mechanism for cesium deposition onto the oxide layer was found to involve the chemical reaction between cesium and chromate. Some revaporization in the cesium hydroxide-boric acid system was observed. It has been found that under the conditions given, boric acid will react with cesium hydroxide to form cesium metaborate. A model is proposed for this chemical reaction

  8. Distribution and retention of cesium in Swedish boreal forest ecosystems

    International Nuclear Information System (INIS)

    The retention and distribution of cesium in forest environments are being studied at three locations in Sweden. The main part of the cesium found in the soil was recovered in horizons rich in organic matter. The cesium was retained in the soil organic matter in a more or less extractable form. As different soil types have a different distribution pattern of organic matter the distribution of cesium will depend on the forest soil type. The clay content in Swedish forest soils is in general low which will mitigate the retention of cesium in the soil mineral horizons. The cesium present in the tree was considered to be an effect of assimilation by the tissues in the canopy as well as by the roots. The redistribution of cesium within the trees was extensive which was considered to be an effect of a high mobility of cesium in the close system of a forest environment. The cesium will remain in the forest environment for a considerable time but can be removed by forest practice, by leaching out of the soil profile or by the radioactive decay. (au)

  9. Lanthanide doped strontium-barium cesium halide scintillators (United States)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew


    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  10. Sorption of cesium in intact rock

    Energy Technology Data Exchange (ETDEWEB)

    Puukko, E. [Univ. of Helsinki, Dept. of Chemistry (Finland)


    The mass distribution coefficient K{sub d} is used in performance assessment (PA) to describe sorption of a radionuclide on rock. The R{sub d} is determined using crushed rock which causes uncertainty in converting the R{sub d} values to K{sub d} values for intact rock. This work describes a method to determine the equilibrium of sorption on intact rock. The rock types of the planned Olkiluoto waste disposal site were T-series mica gneiss (T-MGN), T-series tonalite granodiorite granite gneiss (T-TGG), P-series tonalite granodiorite granite gneiss (P-TGG) and pegmatitic granite (PGR). These rocks contain different amount of biotite which is the main sorbing mineral. The sorption of cesium on intact rock slices was studied by applying an electrical field to speed up migration of cesium into the rock. Cesium is in the solution as a noncomplex cation Cs{sup +} and it is sorbed by ion exchange. The tracer used in the experiments was {sup 134}Cs. The experimental sorption on the intact rock is compared with values calculated using the in house cation exchange sorption model (HYRL model) in PHREEQC program. The observed sorption on T-MGN and T-TGG rocks was close to the calculated values. Two PGR samples were from a depth of 70 m and three samples were from a depth of 150 m. Cesium sorbed more than predicted on the two 70 m PGR samples. The sorption of Cs on the three 150 m PGR samples was small which was consistent with the calculations. The pegmatitic granite PGR has the smallest content of biotite of the four rock types. In the case of P-TGG rock the observed values of sorption were only half of the calculated values. Two kind of slices were cut from P-TGG drill core. The slices were against and to the direction of the foliation of the biotite rims. The sorption of cesium on P-TGG rock was same in both cases. The results indicated that there was no effect of the directions of the electric field and the foliation of biotite in the P-TGG rock. (orig.)

  11. Distillation device supplies cesium vapor at constant pressure (United States)

    Basiulis, A.; Shefsiek, P. K.


    Distillation apparatus in the form of a U tube supplies small amounts of pure cesium vapor at constant pressure to a thermionic converter. The upstream leg of the U tube is connected to a vacuum pump to withdraw noncondensable impurities, the bottom portion serves as a reservoir for the liquid cesium.

  12. Ion and electron thermoemission of cesium alumosilicates

    International Nuclear Information System (INIS)

    Relationships between and electron thermoemission of cesium aluminosilicate were studied. Measurements were made at 5.10-8-5.10-9 Tor and temperatures up to 1400 deg C. The effect of additions refractory metals Ti, Mo, Cu and Ir was studied. Ion thermoemission in the pulse regime was also studied. Conclusions are drawn that capacity depends upon additions. The temperature dependence of thermoionic emission current has two maxima and is characterized by instability in time. A conclusion is drawn that aluminosilicate thermionic cathodes can be reckoned as cathodes of a film type

  13. Cesium-137 in grass from Chernobyl fallout

    International Nuclear Information System (INIS)

    Grass ecosystem was monitored for 137Cs, a relatively long-lived radionuclide, for about 16 years since the Chernobyl reactor accident occurred on April 26, 1986. Cesium-137 in grass gramineae or poaceae the species, ranged from 122.9 Bq kg-1 (September 4, 1986) to 5.8 mBq kg-1 (October 16, 2001) that is a range of five orders of magnitude. It was observed that there was a trend of decreasing 137Cs with time reflecting a removal half-time of 40 months (3 1/3 years), which is the ecological half-life, T ec of 137Cs in grassland

  14. Plutonium and Cesium Colloid Mediated Transport (United States)

    Boukhalfa, H.; Dittrich, T.; Reimus, P. W.; Ware, D.; Erdmann, B.; Wasserman, N. L.; Abdel-Fattah, A. I.


    Plutonium and cesium have been released to the environment at many different locations worldwide and are present in spent fuel at significant levels. Accurate understanding of the mechanisms that control their fate and transport in the environment is important for the management of contaminated sites, for forensic applications, and for the development of robust repositories for the disposal of spent nuclear fuel and nuclear waste. Plutonium, which can be present in the environment in multiple oxidations states and various chemical forms including amorphous oxy(hydr)oxide phases, adsorbs/adheres very strongly to geological materials and is usually immobile in all its chemical forms. However, when associated with natural colloids, it has the potential to migrate significant distances from its point of release. Like plutonium, cesium is not very mobile and tends to remain adhered to geological materials near its release point, although its transport can be enhanced by natural colloids. However, the reactivity of plutonium and cesium are very different, so their colloid-mediated transport might be significantly different in subsurface environments. In this study, we performed controlled experiments in two identically-prepared columns; one dedicated to Pu and natural colloid transport experiments, and the other to Cs and colloid experiments. Multiple flow-through experiments were conducted in each column, with the effluent solutions being collected and re-injected into the same column two times to examine the persistence and scaling behavior of the natural colloids, Pu and Cs. The data show that that a significant fraction of colloids were retained in the first elution through each column, but the eluted colloids collected from the first run transported almost conservatively in subsequent runs. Plutonium transport tracked natural colloids in the first run but deviated from the transport of natural colloids in the second and third runs. Cesium transport tracked natural

  15. Extraction of radioactive cesium from ash of flammable radioactive material

    International Nuclear Information System (INIS)

    Huge amount of radioactive materials was released by the hydrogen explosion at Fukushima Daiichi Nuclear Power Plant due to the Great East Japan Earthquake on March 11, 2011. Suppression of the volume of radioactive materials stored by decontamination works is strongly required since the preparation of storage places is not easy. We are developing the technology for separation and concentration of radioactive cesium using nano-particle, Prussian blue, as a cesium adsorption material which has a high efficiency and good selectivity. We propose a method in which radioactive cesium is extracted from the ash of flammable materials into the water and the Prussian blue nano-particles are added to the water to collect cesium. The volume of radioactive wastes contaminated by cesium is expected to be cut down with these processes. (J.P.N.)

  16. Evaluation of electrochemical ion exchange for cesium elution

    International Nuclear Information System (INIS)

    Electrochemical elution was investigated as an alternative method to acid elution for the desorption of cesium from loaded ion exchange resins. The approach was found to have several potential advantages over existing technologies, in particular, electrochemical elution eliminates the need for addition of chemicals to elute cesium from the ion exchange resin. Also, since, in the electrochemical elution process the eluting solution is not in direct contact with the ion exchange material, very small volumes of the eluting solution can be used in a complete recycle mode in order to minimize the total volume of the cesium elute. In addition, the cesium is eluted as an alkaline solution that does not require neutralization with caustic to meet the tank farm specifications. Other advantages include easy incorporation of the electrochemical elution process into the present cesium recovery schemes

  17. A combined cesium-strontium extraction/recovery process

    International Nuclear Information System (INIS)

    A new solvent extraction process for the simultaneous extraction of cesium and strontium from acidic nitrate media is described. This process uses a solvent formulation comprised of 0.05 M di-t-butylcyclohexano-18-crown-6 (DtBuCH18C6), 0.1 M Crown 100' (a proprietary, cesium-selective derivative of dibenzo-18-crown-6), 1.2 M tributyl phosphate (TBP), and 5% (v/v) lauryl nitrile in an isoparaffinic hydrocarbon diluent. Distribution ratios for cesium and strontium from 4 M nitric acid are 4.13 and 3.46, respectively. A benchtop batch countercurrent extraction experiment indicates that >98% of the cesium and strontium initially present in the feed solution can be removed in only four extraction stages. Through proper choice of extraction and strip conditions, extracted cesium and strontium can be recovered either together or individually

  18. Adsorption of cesium on cement mortar from aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Volchek, Konstantin, E-mail: [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Kuang, Wenxing; DeMaleki, Zack [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, Canada K1N 6N5 (Canada)


    Highlights: {yields} The adsorption of cesium on cement mortar was investigated in a range of temperatures and cesium concentrations. {yields} The pseudo-second order kinetic model produced a good fit with the experimental kinetic data. {yields} Equilibrium test results correlated well with the Freundlich isotherm adsorption model. {yields} The interaction between cesium ions and cement mortar was dominated by chemical adsorption. - Abstract: The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L{sup -1} and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L{sup -1} while the respective surface concentration on coupons varied from 0.0395 to 22.34 {mu}g cm{sup -2}. Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol{sup -1} suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  19. 33 CFR 117.1081 - Black River. (United States)


    ... OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1081 Black River. The draw of the CP Rail railroad bridge, mile 1.0 at La Crosse, shall open on signal if at least two hours notice is given....

  20. Studies on release and deposition behaviour of cesium from contaminated sodium pools and cesium trap development for FBTR

    International Nuclear Information System (INIS)

    Investigations were carried out on the release and deposition behaviour of cesium from sodium pools in air-filled chamber in the temperature range of 673 to 873 K, using Cs-134 to simulate Cs-137. About 0.12 kg of sodium was loaded in a burn-pot together with 92.5 kBq of cesium. Experiments were carried out with 21% oxygen. Natural burning period of sodium and specific activity ratio between cesium and sodium showed a tendency to decrease and release fractions of both the species tended to increase with temperature. From the surface deposited aerosols it was observed that cesium has propensity to settle down closer to the point of release. A cesium trap has been developed for FBTR with RVC as getter material. Absorption kinetics and particle release behaviour studies pointed to its intended satisfactory performance in the plant. (author)

  1. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms

    International Nuclear Information System (INIS)

    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,mf=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,mf=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,mf=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The last chapter

  2. Microbial uptake of uranium, cesium, and radium

    International Nuclear Information System (INIS)

    The ability of diverse microbial species to concentrate uranium, cesium, and radium was examined. Saccharomyces cerevisiae, Pseudomonas aeruginosa, and a mixed culture of denitrifying bacteria accumulated uranium to 10 to 15% of the dry cell weight. Only a fraction of the cells in a given population had visible uranium deposits in electron micrographs. While metabolism was not required for uranium uptake, mechanistic differences in the metal uptake process were indicated. Uranium accumulated slowly (hours) on the surface of S. cerevisiae and was subject to environmental factors (i.e., temperature, pH, interfering cations and anions). In contrast, P. aeruginosa and the mixed culture of denitrifying bacteria accumulated uranium rapidly (minutes) as dense, apparently random, intracellular deposits. This very rapid accumulation has prevented us from determining whether the uptake rate during the transient between the initial and equilibrium distribution of uranium is affected by environmental conditions. However, the final equilibrium distributions are not affected by those conditions which affect uptake by S. cerevisiae. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several microbial species tested. The potential utility of microorganisms for the removal and concentration of these metals from nuclear processing wastes and several bioreactor designs for contacting microorganisms with contaminated waste streams will be discussed

  3. Intense non-relativistic cesium ion beam

    International Nuclear Information System (INIS)

    The Heavy Ion Fusion group at Lawrence Berkeley Laboratory has constructed the One Ampere Cesium Injector as a proof of principle source to supply an induction linac with a high charge density and high brightness ion beam. This is studied here. An electron beam probe was developed as the major diagnostic tool for characterizing ion beam space charge. Electron beam probe data inversion is accomplished with the EBEAM code and a parametrically adjusted model radial charge distribution. The longitudinal charge distribution was not derived, although it is possible to do so. The radial charge distribution that is derived reveals an unexpected halo of trapped electrons surrounding the ion beam. A charge fluid theory of the effect of finite electron temperature on the focusing of neutralized ion beams (Nucl. Fus. 21, 529 (1981)) is applied to the problem of the Cesium beam final focus at the end of the injector. It is shown that the theory's predictions and assumptions are consistent with the experimental data, and that it accounts for the observed ion beam radius of approx. 5 cm, and the electron halo, including the determination of an electron Debye length of approx. 10 cm

  4. Cesium separation Using Electrically Switched Ion Exchange

    International Nuclear Information System (INIS)

    Electrically Switched Ion Exchange (ESIX) is a separation technology being developed at Pacific Northwest National Laboratory as an alternative to conventional ion exchange for removing metal ions from wastewater. In ESIX, which combines ion exchange and electro-chemistry, ion uptake and elution can be controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto an electrode. This paper presents the results of experiments on high surface area electrodes and the development of a flow system for cesium ion separation. Bench-scale flow system studies showed no change in capacity or performance of the ESIX films at a flow rate up to 113 BV/h, the maxi-mum flow rate tested, and breakthrough curves supported once-through waste processing. A comparison of results for a stacked 5-electrode cell versus a single-electrode cell showed enhanced breakthrough performance. In the stacked configuration, break-through began at about 120 BV for a feed containing 0.2 ppm cesium at a flow rate of 13 BV/h. A case study for the KE Basin (a spent nuclear fuel storage basin) on the Hanford Site demonstrated that KE Basin wastewater could be processed continuously with minimal waste generation, reduced disposal costs, and lower capital expenditures

  5. Biosorption behavior and mechanism of cesium-137 on Rhodosporidium fluviale strain UA2 isolated from cesium solution

    International Nuclear Information System (INIS)

    In order to identify a more efficient biosorbent for 137Cs, we have investigated the biosorption behavior and mechanism of 137Cs on Rhodosporidium fluviale (R. fluviale) strain UA2, one of the dominant species of a fungal group isolated from a stable cesium solution. We observed that the biosorption of 137Cs on R. fluviale strain UA2 was a fast and pH-dependent process in the solution composed of R. fluviale strain UA2 (5 g/L) and cesium (1 mg/L). While a Langmuir isotherm equation indicated that the biosorption of 137Cs was a monolayer adsorption, the biosorption behavior implied that R. fluviale strain UA2 adsorbed cesium ions by electrostatic attraction. The TEM analysis revealed that cesium ions were absorbed into the cytoplasm of R. fluviale strain UA2 across the cell membrane, not merely fixed on the cell surface, which implied that a mechanism of metal uptake contributed largely to the cesium biosorption process. Moreover, PIXE and EPBS analyses showed that ion-exchange was another biosorption mechanism for the cell biosorption of 137Cs, in which the decreased potassium ions were replaced by cesium ions. All the above results implied that the biosorption of 137Cs on R. fluviale strain UA2 involved a two-step process. The first step is passive biosorption that cesium ions are adsorbed to cells surface by electrostatic attraction; after that, the second step is active biosorption that cesium ions penetrate the cell membrane and accumulate in the cytoplasm. - Highlights: • Microorganisms isolated from a cesium solution are considered as a biosorbent to remove cesium ions. • The biosorption equilibrium is fitted well to a Langmuir model with a correlation coefficient of 0.9997. • First attempt to explore biosorption mechanisms using PIXE and EPBS. • Living and dead microorganisms have different biosorption mechanisms. • The biosorption of 137Cs involved a two-step process: passive and active

  6. Spatial variability and Cesium-137 inventories in native forest

    International Nuclear Information System (INIS)

    With the nuclear fission discovery and development of nuclear weapons in 1940s, artificial radioisotopes were introduced in the environment. This contamination is due to worldwide fallout by superficial nuclear tests realized from early 1950s to late 1970s by USA, former URSS, UK, France and China. One of theses radioisotopes that have been very studied is cesium-137. Cesium-137 has a half-life of 30.2 years and its biological behavior is similar to the potassium. The behavior in soil matrix, depth distribution, spatial variability and inventories values of cesium-137 has been determinate for several regions of the world. In Brazil, some research groups have worked on this subject, but there are few works published about theses properties of cesium-137. The aim of this paper was study the depth distribution, spatial variability, and inventory of cesium-137 in native forest. Two native forests (Mata 1 and Mata UEL) were sampling in region of Londrina, PR. The results shows that there is a spatial variability of 40% for Mata 1 and 42% for Mata UEL. The depth distribution of cesium-137 for two forests presented a exponential form, characteristic to undisturbed soil. Cesium-137 inventory determinate for Mata 1 was 358 Bq m-2 and for Mata UEL was 320 Bq m-2. (author)

  7. Pollution of drug-technical materials by cesium-137

    International Nuclear Information System (INIS)

    Drug-technical raw materials are medicinal plants (flowers, folium, grasses, mushrooms, roots, fruits, berry, kidney, cortex), used in pharmacy. To limit receipt cesium-137 in people body in 1993 in the Republic of Belarus were created 'Temporary permission levels of the cesium-137 radionuclides contents in drug-technical raw materials' were created (TPL-1993). The permission levels of cesium-137 are following: for drug-technical raw material (flowers, folium, grass, mushrooms, roots and other plants parts) - 1850 Bq/kg, for dried up fruits and berries - 2590 Bq/kg. (Author)

  8. Synthesis and peculiarities of the cesium zeolite crystal structure (cesite)

    International Nuclear Information System (INIS)

    An attempt is made to synthesize cesium zeolite by introduction of amorphous seed crystals which correspond by composition with cesium-containing zeolite into the aluminosilicate gel, since this method can produce zeolite with a crystal structure it would not adopt under the usual conditions. It is seen that during crystablization upon introduction of a seed crystal the cesium content in zeolite decreases. A more complete structural elucidation of zeolite obtained by the suggested method was carried out by x0ray and IR spectral analyses. The data of x-ray analysis showed that the structures of synthesized zeolite and binary octagonal pores are similar

  9. Management of cesium loaded AMP- Part I preparation of 137Cesium concentrate and cementation of secondary wastes

    International Nuclear Information System (INIS)

    Separation of 137cesium from High Level Waste can be achieved by use of composite-AMP, an engineered form of Ammonium Molybdo-Phosphate(AMP). Direct vitrification of cesium loaded composite AMP in borosilicate glass matrix leads to separation of water soluble molybdate phase. A proposed process describes two different routes of selective separation of molybdates and phosphate to obtain solutions of cesium concentrates. Elution of 137Cesium from composite-AMP by decomposing it under flow conditions using saturated barium hydroxide was investigated. This method leaves molybdate and phosphate embedded in the column but only 70% of total cesium loaded on column could be eluted. Alternatively composite-AMP was dissolved in sodium hydroxide and precipitation of barium molybdate-phosphate from the resultant solution, using barium nitrate was investigated by batch methods. The precipitation technique gave over 99.9% of 137Cesium activity in solutions, free of molybdates and phosphates, which is ideally suited for immobilization in borosilicate glass matrix. Detailed studies were carried out to immobilize secondary waste of 137Cesium contaminated barium molybdate-phosphate precipitates in the slag cement matrix using vermiculite and bentonite as admixtures. The cumulative fraction of 137Cs leached from the cement matrix blocks was 0.05 in 140 days while the 137Cs leach rate was 0.001 gm/cm2/d. (author)

  10. Biosorption of uranium, radium, and cesium

    International Nuclear Information System (INIS)

    Some fundamental aspects of the biosorption of metals by microbial cells were investigated. These studies were carried out in conjunction with efforts to develop a process to utilize microbial cells as biosorbents for the removal of radionuclides from waste streams generated by the nuclear fuel cycle. It was felt that an understanding of the mechanism(s) of metal uptake would potentially enable the enhancement of the metal uptake phenomenon through environmental or genetic manipulation of the microorganisms. Also presented are the results of a preliminary investigation of the applicability of microorganisms for the removal of 137cesium and 226radium from existing waste solutions. The studies were directed primarily at a characterization of uranium uptake by the yeast, Saccharomyces cerevisiae, and the bacterium, Pseudomonas aeruginosa

  11. Structure of double hafnium and cesium sulfate

    International Nuclear Information System (INIS)

    The structure of a compound whose formula according to the structural investigation is Cssub(2+x)Hf(SOsub(4))sub(2+x)(HSOsub(4))sub(2-x)x3Hsub(2)O (x approximately 0.7) (a=10.220, b=12.004, c=15.767 A, space group Pcmn) is determined by diffractometric data (2840 reflections, anisotropic refinement, R=0.087). It is build of complex unions [Hf(SO4)4H2O]4-, Cs+ cations and water molecules. Eight O atoms surrounding Hf atom (dodecahedron Hf-O 2.10-2.22 A) belong to four sulphate groups and water molecule. Three sulphate groups are bidentate-cyclic, and one group - monodentate relative to Hf. The structure has a cesium deficit in particular positions

  12. Double manganese(III) cesium triphosphate

    International Nuclear Information System (INIS)

    Double triphosphates have been identified in research on interactions in the P2O5-M2O3-Cs2O-H2O system, where M(III) = Al, Ga, Cr, Fe, at 570-770K, which have the M(III)Cs2 - P3O10 composition; here we report the identification of a new phase made under analogous conditions in a system containing Mn(III) together with some of its physicochemical properties. The product was analyzed for phosphorus by a colorimetric method, for manganese by titration with EDTA, and for cesium by atomic absorption. The x-ray phase analysis was performed with a DRON-3.0 diffractometer. The IR spectra were recorded. Thermogravimetry indicates that the product is MnCs2P3O10·H2O

  13. Low-work-function surfaces produced by cesium carbonate decomposition (United States)

    Briere, T. R.; Sommer, A. H.


    Cesium carbonate (Cs2CO3) was heated to the decomposition temperature of approximately 600 C. The nonvolatile decomposition products were condensed on a nickel substrate while the carbon dioxide was removed by pumping. The deposited material is characterized by an effective work function of between 1.05 and 1.15 eV at 450 K and by photoemission in the visible and near-infrared region of the spectrum. It is suggested that the deposited material consists of Cs2O, possibly Cs2O2, and adsorbed cesium. Silver, evaporated from a heated silver bead, produced the typical photoemissive and thermionic properties of a silver-oxygen-cesium (S-1) photocathode. The material may be of interest for thermionic energy converters and for the formation of silver-oxygen-cesium photocathodes.

  14. Sorption of cesium and strontium by arid region desert soil

    International Nuclear Information System (INIS)

    Adsorption and ion exchange in soil systems are the principal mechanisms that retard the migration of nuclear waste to the biosphere. Cesium and strontium are two elements with radioactive isotopes (Cs137 and Sr90) that are commonly disposed of as nuclear waste. The sorption and ion exchange properties of nonradioactive cesium and strontium were studied in this investigation. The soil used in this study was collected at an experimental infiltration site on Frenchman Flat, a closed drainage basin on the Nevada Test Site. This soil is mostly nonsaline-alkali sandy loam and loamy sand with a cation exchange capacity ranging from 13 to 30 me/100g. The clay fraction of the soil contains illite, montmorillonite, and clinoptilolite. Ion exchange studies have shown that this soil sorbs cesium preferentially relative to strontium, and that charge for charge, the exchange-phase cations released from exchange sites exceed the cesium and strontium sorbed by the soil. 38 references, 22 figures

  15. Cesium iodide crystals fused to vacuum tube faceplates (United States)

    Fleck, H. G.


    A cesium iodide crystal is fused to the lithium fluoride faceplate of a photon scintillator image tube. The conventional silver chloride solder is then used to attach the faceplate to the metal support.

  16. Sorption of cesium on Olkiluoto mica gneiss, granodiorite and granite

    International Nuclear Information System (INIS)

    Cesium was selected as a model to study the sorption in bedrock occurring by ion exchange mechanism. The aim of the study was to supplement the existing data on sorption occurring by ion exchange mechanism in bedrock of the candidate sites for spent fuel disposal at Olkiluoto. The sorption of cesium was studied on crushed mica gneiss, tonalite (granodiorite) and granite in artificial groundwaters. Fresh water was represented by Allard water, pH 8 and pH 7, and saline water by Ol-So water, pH 7 and pH 9. In addition, a Na-Ca-Cl brine water and its 1:10 dilution were used as simulants. Cesium concentrations were between 10-8 and 10-3 mol/l. The distribution coefficients of the sorption, Rd and Ra values were determined by batch method. Isotherms were partly non-linear with slopes 0.7 - 1.0 depending on rock and water. At the end of the sorption experiment, the water was analysed for cations exchanged for cesium. The sorption of cesium was also studied as a function of ionic strength. The ionic strength increased in the order Allard < 0l-Br 1:10 < 0l-So < 0l-Br. The sorption of cesium was lower at higher ionic strength and higher Cs concentration. The mineral composition of rocks was determined by thin section analysis, and the sorption distribution ratios on thin sections in the different waters were determined by batch technique. The minerals, that sorbed most cesium were determined by autoradiography. These were biotite, muscovite and chlorite. Cordierite in mica gneiss also sorbed cesium very effectively. (orig.)

  17. Sorption of cesium on Olkiluoto mica gneiss, granodiorite and granite

    Energy Technology Data Exchange (ETDEWEB)

    Huitti, T.; Hakanen, M. [Univ. of Helsinki (Finland). Lab. of Radiochemistry; Lindberg, A. [Geological Survey of Finland, Espoo (Finland)


    Cesium was selected as a model to study the sorption in bedrock occurring by ion exchange mechanism. The aim of the study was to supplement the existing data on sorption occurring by ion exchange mechanism in bedrock of the candidate sites for spent fuel disposal at Olkiluoto. The sorption of cesium was studied on crushed mica gneiss, tonalite (granodiorite) and granite in artificial groundwaters. Fresh water was represented by Allard water, pH 8 and pH 7, and saline water by Ol-So water, pH 7 and pH 9. In addition, a Na-Ca-Cl brine water and its 1:10 dilution were used as simulants. Cesium concentrations were between 10{sup -8} and 10{sup -3} mol/l. The distribution coefficients of the sorption, R{sub d} and R{sub a} values were determined by batch method. Isotherms were partly non-linear with slopes 0.7 - 1.0 depending on rock and water. At the end of the sorption experiment, the water was analysed for cations exchanged for cesium. The sorption of cesium was also studied as a function of ionic strength. The ionic strength increased in the order Allard < 0l-Br 1:10 < 0l-So < 0l-Br. The sorption of cesium was lower at higher ionic strength and higher Cs concentration. The mineral composition of rocks was determined by thin section analysis, and the sorption distribution ratios on thin sections in the different waters were determined by batch technique. The minerals, that sorbed most cesium were determined by autoradiography. These were biotite, muscovite and chlorite. Cordierite in mica gneiss also sorbed cesium very effectively. (orig.) 12 refs.

  18. Cesium pre-implantation of embedded biological sections

    International Nuclear Information System (INIS)

    An ion implantation system which allows the implantation of a large surface of a specimen has been used to obtain an homogeneous enrichment with cesium of embedded biological tissues sections. In such a specimen, containing already oxygen at a high concentration, the addition of cesium allows both positive and negative secondary ions to be studied with the highest sensitivity, using the same primary ion source.

  19. Kelvin Probe Studies of Cesium Telluride Photocathode for AWA Photoinjector


    Wisniewski, Eric; Velazquez, Daniel; Yusof, Zikri; Spentzouris, Linda; Terry, Jeff; Harkay, Katherine


    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (~50 nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin Probe technique. The study incl...

  20. Adsorption Behaviour of Liquid 4He on Cesium Substrates


    Iov, Valentin


    The aim of this thesis is to investigate the wetting properties of 4He on cesium substrates using optical and electrical methods. Due to the fact that the cesium substrates are deposited at low temperatures onto a thin silver underlayer, it is necessary firstly to study and understand the adsorption of helium on silver. The work presented here is structured as follows: some of the fundamental concepts on the theory of physisorbed films, such as van der Waals interaction, adsorption isotherms ...

  1. Study of strontium and cesium migration in fractured crystalline rock

    International Nuclear Information System (INIS)

    The purpose of this investigation has been to study the retardation and dilution of non-active strontium and cesium relative to a non-absorbing substance (iodide) in a well-defined fracture zone in the Finnsjoen field research area. The investigation was carried out in a previously tracer-tested fracture zone. The study has encompassed two separate test runs with prolonged injection of strontium and iodide and of cesium and iodide. The test have shown that: - Strontium is not retarded, but rather absorbed to about 40% at equilibrium. - At injection stop, 36.3% of the injected mass of strontium has been absorbed and there is no deabsorption. -Cesium is retarded a factor of 2-3 and absorbed to about 30% at equilibrium. - At injection stop, 39.4% of the injected mass of cesium has been absorbed. Cesium is deabsorbed after injection stop (400h) and after 1300 hours, only 22% of the injected mass of cesium is absorbed. (author)

  2. Seasonal variation of cesium 134 and cesium 137 in semidomestic reindeer in Norway after the Chernobyl accident

    Directory of Open Access Journals (Sweden)

    I.M. H. Eikelmann


    Full Text Available The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively.

  3. 29 CFR 570.117 - General. (United States)


    ... to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS CHILD LABOR REGULATIONS, ORDERS AND STATEMENTS OF INTERPRETATION General Statements of Interpretation of the Child Labor Provisions of the Fair Labor Standards Act of 1938, as Amended Oppressive Child Labor § 570.117 General....

  4. 33 CFR 117.743 - Rahway River. (United States)


    ... Mount Laurel, New Jersey. (c) A marine traffic light system shall be maintained at the bridge and.... (h) During the downward bridge closing movement, the marine traffic light system located at the...; except, as provided in 33 CFR 117.31(b). However, if a train moving toward the bridge has crossed...

  5. Dose mapping experiments of refurbished cesium irradiator

    International Nuclear Information System (INIS)

    Full text: Cesium irradiator is a technology demonstration facility for irradiation of food commodities to achieve various purposes like control of sprouting in onion and potato, insect disinfestations of cereals and pulses, quarantine treatment of fresh fruits and vegetables and shelf life extension of perishable foods. The facility was installed in 1968 and recently refurbished with the new control console. The current source strength (137Cs) of the irradiator is 44.3 kCi. The real success of irradiation of food commodities lies in the adequate delivery of radiation dose to achieve the particular purpose of irradiation. Therefore, evaluation of dose distribution pattern in the product trays of the irradiation facility is of paramount importance. Two sets of dose mapping experiments of the product trays of the facility were carried out to find out the dose distribution profile and dose uniformity ratio. Reference standard dosimeter Fricke was used for the experiment. The standardized ionic concentrations of Fricke dosimeter are Ferrous Ammonium Sulphate (FeSO4(NH4)2SO4 6H2O ) - 1 mM, Sodium Chloride (NaCl) - 1 mM, Sulphuric acid (H2SO4) - 400 mM. The Optical Density (O.D) evaluation was carried out using Spectrophotometry with wave length of 304 nm. The dosimetry tray was partitioned into two planes namely bottom plane and top plane using card-board sheets. Polypropylene vials containing Fricke solution were prepared and fixed on the planes. Each plane was containing nine numbers of dosimeters. The product thickness was around 9 cm. The temperatures of irradiation and measurements were 30 deg C and 28 deg C respectively. The first set of experiment was intended to find out the dose distribution profile throughout the irradiation chamber. The dose rate at Dmin position was observed as 3.69 Gy/min with a poor Dose Uniformity Ratio (DUR) of 6.5. In order to improve the dose rate and DUR the second set of the experiment was carried out with modified product geometry

  6. Improvement of cesium retention in uranium dioxide by additional phases

    International Nuclear Information System (INIS)

    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs2O-Al2O3-SiO2 et Cs2O-ZrO2-SO2. The compounds CsAISi2O6 and Cs2ZrSi6O15 were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al2O3 + SiO2) or (ZrO2 + SiO2) and the intergranular phase was characterized. In the presence of (Al2O3 + SiO2), the sintering is realized at 1610 deg C in H2. It is a liquid phase sintering. On the other end, with (ZrO2 + SiO2), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO2+x. We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs

  7. Cesium and strontium in Black Sea macroalgae

    International Nuclear Information System (INIS)

    The trace level of metals and particularly radioactive ones should be monitored to evaluate the transfer along the trophic chain, assess the risk for biota and can be used for global changes assessment. Plants respond rapidly to all changes in the ecosystem conditions and are widely used as indicators and predictors for changes in hydrology and geology. In this work we represent our successful development and applications of a methodology for monitoring of stable and radioactive strontium and cesium in marine biota (Black Sea algae's). In case of radioactive release they are of high interest. We use ED-XRF, gamma spectrometers and LSC instrumentation and only 0.25 g sample. Obtained results are compared with those of other authors in same regions. The novelty is the connection between the radioactive isotopes and their stable elements in algae in time and space scale. All our samples were collected from Bulgarian Black Sea coast. - Highlights: • An extraction chromatography method for radiochemical separation of Sr and Cs. • Assessment of Sr and Cs accumulation capacity of six Black Sea macroalgae species. • Connection between the isotopes and their stable elements content in algae. • Assessment of Sr and Cs content in ecosystems along the Bulgarian coast

  8. Cesium-137 levels detected in Georgia otters

    International Nuclear Information System (INIS)

    Beginning in the 1940's and continuing through the 50's and early 60's, nuclear devices were tested by aerial detonation in the United States and other countries around the world. Cesium-137 (137Cs) is one of the most important radionuclide by-products due to its abundance and slow decay (30-year half-life). The uptake of 137Cs in animal tissue is the result of its similarity to potassium. The somatic and genetic effects of 137Cs, along with its effect on reproductive cells, can pose great hazards to wildlife species. A reported buildup of 137Cs in white-tailed deer in the lower coastal plain of Georgia during the 1960's was followed by a gradual decline during the 1970's. Although numerous studies have involved terrestrial mammals of Georgia, few have involved aquatic mammals such as the river otter. With continued atmospheric testing by some foreign countries and the increased use of nuclear power as an energy source, there is a need for continued monitoring of radionuclides in wildlife to ascertain the quality of the environment. This study was initiated as part of an overall study of environmental pollutants in the river otter of Georgia and deals with analysis of the 137Cs accumulations in this species

  9. Dicty_cDB: SLA117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

  10. Uptake of cesium ions by human erythrocytes and perfused rat heart: a cesium-133 NMR study

    Energy Technology Data Exchange (ETDEWEB)

    Davis, D.G.; Murphy, E.; London, R.E.


    Cesium-133 NMR studies have been carried out on suspended human erythrocytes and on perfused rat hearts in media containing CsCl. The resulting spectra exhibit two sharp resonances, arising from intra-and extracellular Cs/sup +/, separated in chemical shift by 1.0-1.4 ppm. Thus, intra- and extracellular resonances are easily resolved without the addition of paramagnetic shift reagents required to resolve resonance of the other alkali metal ions. Spin-lattice relaxation times in all cases are monoexponential and significantly shorter (3-4 times) for the intracellular component. When corrections are made for the pulse repetition rate, the total intensity of the intracellular and extracellular Cs/sup +/ resonances in erythrocytes is conserve, implying total observability of the intracellular pool. The uptake of Cs/sup +/ by erythrocytes occurs at approximately one-third the reported rate for K/sup +/ and was reduced by a factor of 2 upon addition of ouabain to the sample. These results indicate that /sup 133/Cs NMR is a promising tool for studying the distribution and transport of cesium ions in biological systems and, in some cases such as uptake by cellular Na,K-ATPase, for analysis of K/sup +/ ion metabolism.

  11. 33 CFR 117.677 - Big Sunflower River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Big Sunflower River. 117.677 Section 117.677 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Mississippi § 117.677 Big Sunflower River. The draw...

  12. 33 CFR 117.297 - Little Manatee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Manatee River. 117.297 Section 117.297 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.297 Little Manatee River. The draw...

  13. 25 CFR 117.15 - Collections from insurance companies. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Collections from insurance companies. 117.15 Section 117... COMPETENCY § 117.15 Collections from insurance companies. Moneys collected from insurance companies for loss... property. Moneys collected from insurance companies for loss or damage to unrestricted real or...

  14. 33 CFR 117.1001 - Cat Point Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cat Point Creek. 117.1001 Section 117.1001 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Virginia § 117.1001 Cat Point Creek. The draw of...

  15. 33 CFR 117.167 - Little Potato Slough. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw...

  16. 33 CFR 117.779 - Eastchester Bay (Arm of). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Eastchester Bay (Arm of). 117.779 Section 117.779 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.779 Eastchester Bay (Arm of). The...

  17. 33 CFR 117.751 - Shark River (South Channel). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Shark River (South Channel). 117.751 Section 117.751 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.751 Shark River...

  18. 13 CFR 117.20 - Supervision and coordination. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Supervision and coordination. 117.20 Section 117.20 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN... AMENDED § 117.20 Supervision and coordination. The Administrator may from time to time assign to...

  19. 46 CFR 201.117 - Inclusion in record. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part...

  20. 25 CFR 117.10 - Purchase of automotive equipment. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Purchase of automotive equipment. 117.10 Section 117.10... COMPETENCY § 117.10 Purchase of automotive equipment. The superintendent may disburse from the surplus funds of an adult Indian not to exceed $2,000 for the purchase of automotive equipment when the...

  1. 33 CFR 117.9 - Delaying opening of a draw. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Delaying opening of a draw. 117.9... DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.9 Delaying opening of a draw. No person shall unreasonably delay the opening of a draw after the signals required by § 117.15 have been given. Note:...

  2. 46 CFR 117.70 - Ring life buoys. (United States)


    ... the body of the ring life buoy. (3) Each floating waterlight installed after March 11, 1997, on a... 46 Shipping 4 2010-10-01 2010-10-01 false Ring life buoys. 117.70 Section 117.70 Shipping COAST... Ring Life Buoys and Life Jackets § 117.70 Ring life buoys. (a) A vessel must have one or more ring...

  3. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    International Nuclear Information System (INIS)

    Highlights: • There are radioactively contaminated soils having a radioactive cesium transfer of 0.01. • Micro-PIXE analysis has revealed an existence of phosphorus in a contaminated soil. • Radioactive cesium captured by phosphorus compound would be due to radioactive transfer. -- Abstract: Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ∼0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds

  4. A fundamental study on cesium migration to sodium at low temperature

    International Nuclear Information System (INIS)

    Our experiment study aims to understand the behavior of cesium in severe accident of sodium cooled fast breeder reactor, especially cesium migration rate to sodium. In past study, exact migration rate of cesium to sodium has not been reported because of difficulty of the cesium-sodium interfacial area evaluations of gas bubble. In this study, we developed a pool-type experimental apparatus which can simplify the shape of interfacial area, and measured cesium migration rate in a low temperature range of 200degC to 300degC. The cesium migration rates obtained under the condition that the cesium mixed argon gas flow is the same temperature with sodium vary in the range of 10-3 - 10-1 mol/m2min and increase with increasing the system temperature. The difference of cesium migration rates between non-oxidized sodium surface and oxidized sodium surface is also clearly observed. (author)

  5. Viscosity and crystallization mechanism of cesium loaded iron phosphate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Joseph, Kitheri, E-mail: [Chemistry Group, IGCAR, Kalpakkam 603 102 (India); Kutty, K.V. Govindan [Chemistry Group, IGCAR, Kalpakkam 603 102 (India); Goswami, M.C. [National Metallurgical Laboratory, Jamshedpur 831 007 (India); Rao, P.R. Vasudeva [Chemistry Group, IGCAR, Kalpakkam 603 102 (India)


    Highlights: • Melt viscosity of cesium loaded iron phosphate glasses is measured and reported for the first time. • Viscosity – temperature followed Arrhenius model. • Activation energy of viscous flow is strongly correlated to glass transition temperature of the glasses. • Process of crystallization of cesium loaded glass by approximation-free kinetic method to understand the mechanism. • Cesium loaded IPG and IPG shows bulk crystallization mechanism. - Abstract: This paper describes the melt viscosity behaviour and the crystallization mechanism of a series of iron phosphate glasses. High temperature viscosity measurements were carried out on pristine iron phosphate glass and a series of cesium loaded iron phosphate glasses in order to understand the effect of addition of Cs{sub 2}O on viscosity of iron phosphate glasses. Activation energy of viscous flow was estimated from the experimental data by applying Arrhenius model of viscosity–temperature relationship. Activation energy of viscous flow is observed to be strongly correlated to glass transition temperature of these glasses. Fragility of iron phosphate and cesium loaded iron phosphate glass systems were also evaluated in region of high temperature. Crystallization of these glasses was studied using thermal analysis techniques. Temperature integral approximation free method was utilized to evaluate the kinetic parameters such as activation energy of crystallization (E{sub c}) and Avrami exponent (n). The value of Avrami exponent ‘n’ obtained showed that the glasses under present study crystallize via bulk crystallization mechanism, i.e., nucleation and three dimensional growth.

  6. Cesium corrosion process in Fe–Cr steel

    International Nuclear Information System (INIS)

    A cesium corrosion out-pile test was performed to Fe–Cr steel in a simulated fuel pin environment. In order to specify the corrosion products, the corroded area was analyzed by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). A cesium corrosion process in Fe–Cr steel was successfully developed proceeding from both experimental results and thermochemical consideration. The corroded area was mainly formed by Fe layer and Fe depleted oxidized layer. The Fe depleted oxidized layer was formed by Cr0.5Fe0.5 and Cr2O3. The presumed main corrosion reactions were 2Cr+2/3 O2→Cr2O3(ΔG650°C=-894.1kJ/mol) and Cr23C6+46Cs+46O2→23Cs2CrO4+6C(ΔG650°C=-25018.1kJ/mol). Factors of these reactions are chromium, carbon, oxygen and cesium. Therefore, cesium corrosion progression must be dependent on the chromium content, carbon content in the steel, the supply rate of oxygen and temperature which correlated with the diffusion rate of cesium and oxygen into the specimen

  7. Viscosity and crystallization mechanism of cesium loaded iron phosphate glasses

    International Nuclear Information System (INIS)

    Highlights: • Melt viscosity of cesium loaded iron phosphate glasses is measured and reported for the first time. • Viscosity – temperature followed Arrhenius model. • Activation energy of viscous flow is strongly correlated to glass transition temperature of the glasses. • Process of crystallization of cesium loaded glass by approximation-free kinetic method to understand the mechanism. • Cesium loaded IPG and IPG shows bulk crystallization mechanism. - Abstract: This paper describes the melt viscosity behaviour and the crystallization mechanism of a series of iron phosphate glasses. High temperature viscosity measurements were carried out on pristine iron phosphate glass and a series of cesium loaded iron phosphate glasses in order to understand the effect of addition of Cs2O on viscosity of iron phosphate glasses. Activation energy of viscous flow was estimated from the experimental data by applying Arrhenius model of viscosity–temperature relationship. Activation energy of viscous flow is observed to be strongly correlated to glass transition temperature of these glasses. Fragility of iron phosphate and cesium loaded iron phosphate glass systems were also evaluated in region of high temperature. Crystallization of these glasses was studied using thermal analysis techniques. Temperature integral approximation free method was utilized to evaluate the kinetic parameters such as activation energy of crystallization (Ec) and Avrami exponent (n). The value of Avrami exponent ‘n’ obtained showed that the glasses under present study crystallize via bulk crystallization mechanism, i.e., nucleation and three dimensional growth

  8. The diffusion of cesium, strontium, and europium in silicon carbide (United States)

    Dwaraknath, S. S.; Was, G. S.


    A novel multi-layer diffusion couple was used to isolate the diffusion of strontium, europium and cesium in SiC without introducing radiation damage to SiC and at concentrations below the solubility limit for the fission products in SiC. Diffusion occurred by both bulk and grain boundary pathways for all three fission products between 900∘ C and 1 ,300∘ C. Cesium was the fastest diffuser below 1 ,100∘ C and the slowest above this temperature. Strontium and europium diffusion tracked very closely as a function of temperature for both bulk and grain boundary diffusion. Migration energies ranged from 1.0 eV to 5.7 eV for bulk diffusion and between 2.2 eV and 4.7 eV for grain boundary diffusion. These constitute the first measurements of diffusion of cesium, europium, and strontium in silicon carbide, and the magnitude of the cesium diffusion coefficient supports the premise that high quality TRISO fuel should have minimal cesium release.

  9. Dissociative excitation of cesium atom upon e-CsOH collisions

    International Nuclear Information System (INIS)

    The process of dissociative excitation of cesium atom in collisions with mono-kinetic molecules of cesium hydroxide is studied. It is established that behaviour of dissociative excitations the cesium atom in spectral series corresponds of to the grade dependence of cross sections on the main quantum number of the upper level. The values of constants, characterizing the behaviour of cross sections in the eight spectral series of the cesium atom are determined

  10. Discoveries of Elements 113, 115 and 117

    International Nuclear Information System (INIS)

    Discovery of two isotopes of the new element 117 in the 249Bk + 48Ca reaction is described. A new 243Am + 48Ca experiment was carried out to firmly establish the discoveries of new elements 115 and 113. A total of thirty one decay chains of 288115 are now observed in the Am reaction. In addition, four new decay chains are assigned to 289115.

  11. 137Cesium and soil carbon in a small agricultural watershed

    International Nuclear Information System (INIS)

    Scientific, political, and social interests have developed recently in the concept of using agricultural soils to sequester carbon. Studies supporting this concept indicate that soil erosion and subsequent redeposition of eroded soils in the same field may establish an ecosystem disequilibrium that promotes the buildup of carbon on agricultural landscapes. The problem is to determine the patterns of soil erosion and redeposition on the landscape and to relate these to soil carbon patterns. Radioactive 137cesium (137Cs) can be used to estimate soil erosion patterns and, more importantly, redeposition patterns at the field level. The purpose of this study was to determine the relationship between 137Cs, soil erosion, and soil carbon patterns on a small agricultural watershed. Profiles of soils from an upland area and soils in an adjacent riparian system were collected in 5 cm increments and the concentrations of 137Cs and carbon were determined. 137Cs and carbon were uniformly mixed in the upper 15-20 cm of upland soils. 137Cs (Bq g-1) and carbon (%) in the upland soils were significantly correlated (r2=0.66). Carbon content of the 0-20 cm layer was higher (1.4±0.3%) in areas of soil deposition than carbon content (1.1±0.3%) in areas of soil erosion as determined by the 137Cs technique. These data suggest that measurements of 137Cs in the soils can be useful for understanding carbon distribution patterns in surface soil. Carbon content of the upland soils ranged from 0.5 to 1.9% with an average of 1.2±0.4% in the 0-20 cm layer while carbon below this upper tilled layer (20-30 cm) ranged from 0.2 to 1.5% with an average of 0.5±0.3%. Total carbon was 2.66 and 3.20 kg m-2 in the upper 20 cm and upper 30 cm of the upland soils, respectively. Carbon content of the 0-20 cm layer in the riparian system ranged from 1.1 to 67.0% with an average 11.7±17.1%. Carbon content below 20 cm ranged from 1.8 to 79.3% with an average of 18.3±17.5%. Soil carbon in the upper 20 cm

  12. Sorption of cesium and uranium to Feldspar

    International Nuclear Information System (INIS)

    Within safety assessment studies, for nuclear waste disposal in deep geologic formations, calculation for the migration of radionuclides through the geosphere are often carried out with models taking sorption into account. In the past 8 years the insight grew that other physico-chemical processes, besides sorption, could affect migration behaviour. While the currently used transport models were being improved taking either linear or non-linear sorption into account, the coupling of geochemical and transport models came into scope. In spite of these developments models which are still based on the sorption theory are frequently applied in studying migration behaviour of radionuclides. This is caused by the necessity of making preliminary pronouncements, while coupled models are still in stage of development and thermodynamic data are very limited available. Therefore one has to obtain insight in the reliability of the models based on the sorption theory. within the sorption database there is a lack of knowledge about mineralogy, composition of the fluid and the experimental conditions underlying the data. Therefore the Expert Group on geochemical Modelling supported by the Finnish proposal in order to obtain insight in the possible deviation of the sorption coefficients that can be estimated from experiments performed with standard samples, fluid composition and experimental conditions. Nine laboratories from OECD membership countries took part in this intercalibration study. In the framework of the Dutch safety assessment studies the Dutch National Institute of Public health and Environmental protection (RIVM) has decided to participate in this exercise. In this report the results are presented of sorption experiments for cesium and natural Uranium to Feldspar. (H.W.). 4 refs.; 1 fig.; 7 tabs

  13. Cesium in the Savannah River Site environment

    International Nuclear Information System (INIS)

    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of 137Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of 137Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope 137Cs releases have resulted in a negligible risk to the environment and the population it supports

  14. Cesium in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of {sup 137}Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of {sup 137}Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope {sup 137}Cs releases have resulted in a negligible risk to the environment and the population it supports.

  15. Cesium in the Savannah River Site environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of [sup 137]Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of [sup 137]Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope [sup 137]Cs releases have resulted in a negligible risk to the environment and the population it supports.

  16. Spins and magnetic moments of rubidium and cesium nuclides far from stability

    International Nuclear Information System (INIS)

    Previous studies at ISOLDE have concerned spins and magnetic moments of neutron-deficient rubidium and cesium isotopes. Here, the main results obtained, and, in the case of cesium, new moment measurements are briefly discussed also the results from measurements on neutron-rich nuclides of rubidium and cesium. (orig./AH)

  17. Environmental application of cesium-137 irradiation technology: Sludges and foods (United States)

    Sivinski, Jacek S.

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation.

  18. Environmental application of cesium-137 irradiation technology: sludges and foods

    International Nuclear Information System (INIS)

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation. (author)

  19. Dating of mine waste in lacustrine sediments using cesium-137 (United States)

    Rember, W. C.; Erdman, T. W.; Hoffmann, M. L.; Chamberlain, V. E.; Sprenke, K. F.


    For over a century Medicine Lake in northern Idaho has received heavy-metal-laden tailings from the Coeur d'Alene mining district. Establishing the depositional chronology of the lake bottom sediments provides information on the source and rate of deposition of the tailings. Cesium-137, an isotope produced in the atmosphere by nuclear bomb tests, was virtually absent in the environment prior to 1951, but reached its apex in 1964. Our analysis of cesium-137 in the sediments of Medicine Lake revealed that 14 cm of fine-grained tailings were deposited in the lake from 1951 to 1964 and tailing deposition downstream was greatly reduced by the installation of tailings dams in the district in 1968. Cesium-137 analysis is accomplished by a fairly simple gamma-ray counting technique and should be a valuable tool for analyzing sedimentation in any lacustrine environment that was active during the 1950s and 1960s.

  20. Cesium 137 in oils and plants from Guatemala

    International Nuclear Information System (INIS)

    Since 1990 the project of radioactive and environmental contamination started in Guatemala. Studies about the radioactive contamination levels are made within the framework of this project. Cesium-137 has been an interest radionuclide, because it is a fission product released to the environment by the use of nuclear weapons and nuclear power plants accidents. The sampling consisted in collection of soil and grass in 20 provinces of Guatemala, one point by province, and it was made in 1990. The cesium-137 concentration in the samples, was determined by gamma spectrometry, using an hyper pure germanium detector. The results show the presence of radioactive contamination in soil and grass due to cesium-137, at levels that might be considered as normal. The levels found are not harmful for human health, and its importance is the fact that can be used as reference levels for the environmental radioactivity monitoring in Guatemala

  1. Study of radiatively sustained cesium plasmas for solar energy conversion (United States)

    Palmer, A. J.; Dunning, G. J.


    The results of a study aimed at developing a high temperature solar electric converter are reported. The converter concept is based on the use of an alkali plasma to serve as both an efficient high temperature collector of solar radiation as well as the working fluid for a high temperature working cycle. The working cycle is a simple magnetohydrodynamic (MHD) Rankine cycle employing a solid electrode Faraday MHD channel. Research milestones include the construction of a theoretical model for coupling sunlight in a cesium plasma and the experimental demonstration of cesium plasma heating with a solar simulator in excellent agreement with the theory. Analysis of a solar MHD working cycle in which excimer laser power rather than electric power is extracted is also presented. The analysis predicts a positive gain coefficient on the cesium-xenon excimer laser transition.

  2. On the compartmental modeling of cesium migration in soils

    International Nuclear Information System (INIS)

    The prediction of the migration of radionuclides in soil following deposition after a nuclear accident is important for both external dose and plant uptake prediction. In this paper, the validity conditions of compartment models for cesium migration in soils are investigated. A compartment model is derived from a diffusion-convection model. The model considers free and bound cesium compartments and is applied to measured profiles of 137Cs of undisturbed soil in Northern Greece. It is concluded that the rate of cesium transfer must vary linearly with depth and that from measured equilibrium profiles, the ratios of model parameters can be determined but not the parameters themselves. This model is applied to measured profiles of 137Cs in soil due to wet deposition following the Chernobyl accident

  3. Thallous and cesium halide materials for use in cryogenic applications

    International Nuclear Information System (INIS)

    Certain thallous and cesium halides, either used alone or in combination with other ceramic materials, are provided in cryogenic applications such as heat exchange material for the regenerator section of a closed-cycle cryogenic refrigeration section, as stabilizing coatings for superconducting wires, and as dielectric insulating materials. The thallous and cesium halides possess unusually large specific heats at low temperatures, have large thermal conductivities, are nonmagnetic, and are nonconductors of electricity. They can be formed into a variety of shapes such as spheres, bars, rods, or the like and can be coated or extruded onto substrates or wires. (author)

  4. Selective chemical binding enhances cesium tolerance in plants through inhibition of cesium uptake (United States)

    Adams, Eri; Chaban, Vitaly; Khandelia, Himanshu; Shin, Ryoung


    High concentrations of cesium (Cs+) inhibit plant growth but the detailed mechanisms of Cs+ uptake, transport and response in plants are not well known. In order to identify small molecules with a capacity to enhance plant tolerance to Cs+, chemical library screening was performed using Arabidopsis. Of 10,000 chemicals tested, five compounds were confirmed as Cs+ tolerance enhancers. Further investigation and quantum mechanical modelling revealed that one of these compounds reduced Cs+ concentrations in plants and that the imidazole moiety of this compound bound specifically to Cs+. Analysis of the analogous compounds indicated that the structure of the identified compound is important for the effect to be conferred. Taken together, Cs+ tolerance enhancer isolated here renders plants tolerant to Cs+ by inhibiting Cs+ entry into roots via specific binding to the ion thus, for instance, providing a basis for phytostabilisation of radiocesium-contaminated farmland.

  5. Selective chemical binding enhances cesium tolerance in plants through inhibition of cesium uptake

    DEFF Research Database (Denmark)

    Adams, Eri; Chaban, Vitaly; Khandelia, Himanshu; Shin, Ryoung


    High concentrations of cesium (Cs(+)) inhibit plant growth but the detailed mechanisms of Cs(+) uptake, transport and response in plants are not well known. In order to identify small molecules with a capacity to enhance plant tolerance to Cs(+), chemical library screening was performed using...... Arabidopsis. Of 10,000 chemicals tested, five compounds were confirmed as Cs(+) tolerance enhancers. Further investigation and quantum mechanical modelling revealed that one of these compounds reduced Cs(+) concentrations in plants and that the imidazole moiety of this compound bound specifically to Cs......(+). Analysis of the analogous compounds indicated that the structure of the identified compound is important for the effect to be conferred. Taken together, Cs(+) tolerance enhancer isolated here renders plants tolerant to Cs(+) by inhibiting Cs(+) entry into roots via specific binding to the ion thus, for...

  6. Cesium Ion Exchange Using Tank 241-AN-104 Supernate

    International Nuclear Information System (INIS)

    The River Protection Project is to design and build a high level nuclear waste treatment facility. The waste treatment plant is to process millions of gallons of radioactive waste stored in tanks at the Hanford Site. The high level nuclear waste treatment process includes various unit operations, such as ultrafiltration, precipitation, evaporation, ion exchange, and vitrification. Ion exchange is identified as the optimal treatment method for removal of cesium-137 and Tc-99 from the waste. Extensive ion exchange testing was performed using small-scale columns with actual waste samples. The objectives of this study were to: demonstrate SuperLig 644 ion exchange performance and process steps for the removal of cesium from actual AN-104 tank waste; pretreat actual AN-104 tank waste to reduce the concentration of cesium-137 in the waste below LAW vitrification limit; produce and characterize cesium eluate solutions for use in eluate evaporation tests. The experiments consisted of batch contact and small-scale column tests. The batch contact tests measured sorption partition coefficients Kds. The Kds were used to predict the effective resin capacity. The small-scale column tests, which closely mimic plant conditions, generated loading and elution profile data used to determine whether removal targets and design requirements were met

  7. A method for reducing the cesium-137 content in meat

    International Nuclear Information System (INIS)

    Reports a study of a method for reducing the amount of cesium-137 in meat from wild animals. The method is intended for use in the kitchen and is based on a combined leaching and mechanical process. (K.A.E.)

  8. Cesium-137 Levels Detected in Otters from Austria

    Directory of Open Access Journals (Sweden)

    Gutleb A.C.


    Full Text Available Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra. The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  9. Fission-product tellurium and cesium telluride chemistry revisited

    International Nuclear Information System (INIS)

    The chemistry of fission-product tellurium is discussed with a focus on conditions in an operating CANDU reactor and in an accident scenario, i.e., a loss of coolant accident (LOCA). Cesium telluride, Cs2Te, is likely to be one of the most abundant tellurium species released to containment. Available thermodynamic data on gas phase Cs2Te is not complete; hence the volatility of cesium telluride was studied by Knudsen-cell mass spectrometry. Cesium telluride was found to vapourize incongruently, becoming more tellurium-rich in the condensed phase as vapourization progressed. Vapour-phase species that were observed were elemental cesium and tellurium, CsTe, Cs2Te, Cs2Te2 and Cs2Te3. Second-law enthalpies and entropies were obtained for many of these species, and a third-law value, ΔH298o, of 186 ± 2 kJ·mol-1 was obtained for Cs2Te. (author)

  10. Discovery of Cesium, Lanthanum, Praseodymium and Promethium Isotopes


    May, E.; Thoennessen, M


    Currently, forty-one cesium, thirty-five lanthanum, thirty-two praseodymium, and thirty-one promethium, isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  11. Strontium-90 and cesium-137 in fresh water

    International Nuclear Information System (INIS)

    Japan Chemical Analysis Center has analysed the strontium-90 and Cesium-137 contents in fresh water from 7 prefectures in Japan by the commission of Science and Technology Agency of Japanese Government. The method described in ''Radioactivity Survey Data in Japan No. 43 (NIRS-RSD-43, 1977) was applied to the analysis of these two radionuclides in samples. (author)

  12. Cesium ion desorption ionization with Fourier transform mass spectrometry

    International Nuclear Information System (INIS)

    Cesium ions (Cs+) are used for the production of the feed ions necessary to obtain Fourier transform mass spectra (FTMS). The molecule chosen for the initial study of this Cs+ desorption ionization (DI-FTMS) was vitamin B-12 because of its nonvolatile, thermally labile character. 21 references

  13. Membrane-based separation technologies for cesium, strontium, and technetium

    Energy Technology Data Exchange (ETDEWEB)

    Kafka, T.


    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah.

  14. Hot demonstration of proposed commercial cesium removal technology

    International Nuclear Information System (INIS)

    This report describes the work done in support of the development of technology for the continuous removal and concentration of radioactive cesium in supernatant from Melton Valley Storage Tanks (MVSTs) at the ORNL site. The primary objective was to test candidate absorbers and ion exchangers under continuous-flow conditions using actual supernatant from the MVSTs. An experimental system contained in a hot-cell facility was constructed to test the materials in columns or modules using the same batch of supernatant to allow comparison on an equal basis. Resorcinol/formaldehyde (RF) resin was evaluated at three flow rates with 50% breakthrough ranges of 35 to 50 column volumes (CV) and also through a series of five loading/elution/regeneration cycles. The results reported here include the cesium loading breakthrough curves, elution curves (when applicable), and operational problems and observations for each material. The comparative evaluations should provide critical data for the selection of the sorbent for the ORNL Cesium Removal Demonstration project. These results will be used to help determine the design parameters for demonstration-scale systems. Such parameters include rates of cesium removal, quantity of resin or sorbent to be used, and elution and regeneration requirements, if applicable

  15. Cesium-137 Levels Detected in Otters from Austria


    Gutleb A.C.; Mraz, G.


    Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra). The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  16. Selective extraction of cesium: from compound to process

    International Nuclear Information System (INIS)

    Under the French law of 30 December 1991 on nuclear waste management, research is conducted to recover long-lived fission products from high-level radioactive effluents generated by spent fuel reprocessing, in order to destroy them by transmutation or encapsulate them in specific matrices. Cesium extraction with mono and bis-crown calix(4)arenes (Frame 1) is a candidate for process development. These extractants remove cesium from highly acidic or basic pH media even with high salinity. A real raffinate was treated in 1994 in a hot cell to extract cesium with a calix-crown extractant. The success of this one batch experiment confirmed the feasibility of cesium decontamination from high-level liquid waste. It was then decided to develop a process flowchart to extract cesium selectively from high-level raffinate, to be included in the general scheme of long-lived radionuclide partitioning. It was accordingly decided to develop a process based on liquid-liquid extraction and hence optimize a calixarene/diluent solvent according to: - hydraulic properties: density, viscosity, interfacial tension, - chemical criteria: sufficient cesium extraction (depending on the diluent), kinetics, third phase elimination... New mono-crown-calixarenes branched with long aliphatic groups (Frame 2) were designed to be soluble in aliphatic diluents. To prevent third phase formation associated with nitric acid extraction, the addition of modifiers (alcohol, phosphate and amide) in the organic phase was tested (Frame 3). Table 1 shows examples of calixarene/diluent systems suitable for a process flowchart, and Figure 2 provides data on cesium extraction with these new systems. Alongside these improvements, a system based on a modified 1,3-di(n-octyl-oxy)2,4-calix[4]arene crown and a modified diluent was also developed, considering a mixed TPH/NPHE system as the diluent, where TPH (hydrogenated tetra propylene) is a common aliphatic industrial solvent and NPHE is nitrophenyl

  17. Demonstration test for decontamination technology of cesium-contaminated ash

    International Nuclear Information System (INIS)

    KEPCO Engineering and Construction Company (KEPCO E and C), architecture and engineering company of nuclear power plant, developed the 'decontamination technology of cesium-contaminated ash' in the basis of pre-owned 'decontamination technology of cesium-contaminated soil'. The new technology was demonstrated in Fukushima prefecture during 12 days from November 5, 2013, in order to verify the performance. Demonstration equipment (CEDECON-DA), with a capacity of treatment of 20 ℓ per batch, can be carried in a container in order to promote the ease of transportation and in-situ installation. Through the demonstration test it was verified the superior performance and the possibility of commercialization. This technique comprises of cesium separation and cesium coagulation processes. Briefly speaking, the principal of this process is as follows; cesium is separated from ash, detached to the coagulation and then deposited. The decontaminated ash can be disposed of into municipal landfills as conventional non-radioactive waste. The present technology is evaluated such that the disposal amount of radioactive waste will be significantly reduced. The ash with average concentration of 6,200 Bq/kg from a conventional incineration plant was used for the demonstration test. Each separate performance test has been carried out under acid, neutral and alkaline conditions, respectively. The test result for alkaline condition showed the highest decontamination ratio of 82-85% and the volume reduction ratio of 95%. Radioactive Waste Management and Nuclear Facility Decommissioning Technology Center (RANDEC) performed the radiation protection management, activity measurement and evaluation in the demonstration test results. (author)

  18. Some aspects of cesium deposition in Transilvania (Romania)

    International Nuclear Information System (INIS)

    Following the accident of the Chernobyl atomic electric power station, a great quantity of radionuclides (∼100MCi) escaped from the reactor. It was estimated that 13% of the inventory activity of cesium representing 1.5-2 MCi left the reactor. The radioactive deposits were very nonuniform for the same distance and in the same direction from Chernobyl nuclear center having a close dependence upon direction and speed of wind and pluviometric conditions. The rains, especially the storms, spectacularly increased the radioactive fallout. Although, for the first two-three days, subsequent to accident, the meteorological conditions were favorable for Romania, after April 29/30, because of the changing in the wind direction on SW (initial it was N and NW) the countries were on this direction - Romania, Bulgaria, Greece, former Yugoslavia - began to be intensely contaminated with radioactive fallout. In Romania, the radioactive cloud passing coincided with abundant rains, especially on the direction mentioned above. On this direction, the cesium deposits are of 8-2 times larger than other Romanian regions. The torrential rain which fell on May 1st 1986, in the western side of Cluj Napoca town caused an intense contamination especially with short-life isotopes as Te, I, Ba, La, Mo. Medium and long-life isotopes as Ru, Zr, Cs, Sr were present in large quantities in this area.too. For the total contribution the value obtained was 1130 kBq/m2, much larger than the average in Romania. This work presents data about cesium content of pollen samples gathered daily between 1-30 May 1986; cesium deposits in five areas and some measurements in connection with cesium mitigation in soils

  19. Distribution and retention of cesium and strontium in Swedish boreal forest ecosystems

    International Nuclear Information System (INIS)

    The retention and distribution of cesium, and to some extent strontium, in forest environments are being studied at three sites in Sweden. The main part of the cesium found in the soil was recovered in horizons rich in organic matter. The cesium was retained in the soil organic matter in a more or less extractable form. As different soil types have a different distribution pattern of organic matter, the distribution of cesium will depend on the forest soil type. The clay content in Swedish forest soils is, in general, low which will mitigate the retention of cesium in the soil mineral horizons. The cesium and strontium present in the trees was considered to be an effect of assimilation by the tissues in the canopy as well as by the roots. The redistribution of cesium within the trees was extensive which was considered to be the effect of a high mobility of cesium in the trees. The recovery of strontium-90 in pines, in relation to the deposition rate was higher compared to the relative recovery of cesium-137, 30 years after deposition. The cesium and strontium will remain in the forest environment for a considerable time but can be reduced by forest practice, by leaching out of the soil profile or by radioactive decay

  20. CD117 expression on blast cells in acute myeloid leukemia

    Directory of Open Access Journals (Sweden)

    Goryainova N.V.


    Full Text Available The aim of the present work was to analyze the frequency of CD117 (c-KIT antigen expression on the blast cells in acute myeloid leukemia (AML, evaluation of the presence of the relationship between the expression of the c-KIT and leukemia according to the FAB classification and definition of co-expression of the antigen CD117, antigens CD33 and CD34. The data of 47 patients with AML were diagnosed. M0 AML variant was established in 3 (6% patients, M1 – in 2 (4%, M2 – in 9 (20%, M4 – in 22 (47% and M5 – in 11 (23%. For immunophenotypic stu¬dies monoclonal antibodies (mAb that detect antigens of anti-CD34, anti-CD33 and anti-CD117 (Becton Dickinson, USA were used. The presence of the antigen CD117 was detected in 39 people, accounting for 83% of all surveyed. Antigen c-KIT was present in 48.117.0% cells on average: in all 3 cases – AML M0, in2 cases of AML M1, in 6 cases – AML M2, 20 of 22 cases – AML M4 and in 8 of 11 AML M5 cases. Average levels of CD117 in investigated leukemia cases statistically differed significantly (p=0.0067. Among 39 CD117- positive patients in 25 (53% co-expression of CD117+/CD34+ was revealed. Expression of CD117+/CD34- was observed in 14 cases (30%, CD117-/CD34+ – in 4 cases (8,5%, CD117-/CD34- – in 4 cases (8.5%. CD34 had of 64% of cells of myeloid origin. A high positive cor¬relation between expression of CD117 and CD34 (r=+0,5169 was determined, being statistically significant (p0,0067.

  1. 29 CFR 784.117 - Combinations of exempt work. (United States)


    ... under another section of the Act, is permitted. Where a part of an employee's covered work in a workweek... work exempt from both the minimum wage and overtime requirements under another section of the Act. In... 29 Labor 3 2010-07-01 2010-07-01 false Combinations of exempt work. 784.117 Section 784.117...

  2. 9 CFR 117.5 - Segregation of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Segregation of animals. 117.5 Section 117.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT...

  3. 9 CFR 117.6 - Removal of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Removal of animals. 117.6 Section 117.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED...

  4. 9 CFR 117.3 - Admittance of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Admittance of animals. 117.3 Section 117.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT...

  5. 33 CFR 117.1021 - North Landing River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false North Landing River. 117.1021... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Virginia § 117.1021 North Landing River. The draw of... vessels of the United States, commercial vessels, and vessels in an emergency endangering life or...

  6. 27 CFR 24.117 - Maintenance of application file. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Maintenance of application file. 24.117 Section 24.117 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Maintenance of application file. The proprietor shall maintain an application file with the...

  7. 33 CFR 117.624 - Black River (South Haven). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black River (South Haven). 117... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Michigan § 117.624 Black River (South Haven). The draw of the Dyckman Avenue bridge, mile 1.9 at South Haven, shall open as follows: (a) From May...

  8. 33 CFR 117.598 - Eel Pond Channel. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Eel Pond Channel. 117.598 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.598 Eel Pond Channel. The following requirements apply to the draw of Eel Pond (Water Street) drawbridge at mile 0.0 at...

  9. 33 CFR 117.927 - Coosaw River (Whale Branch). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Coosaw River (Whale Branch). 117.927 Section 117.927 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Whale Branch). The draw of the Seaboard System Railroad bridge, mile 5.3 at Seabrook, and the draw...

  10. 40 CFR 98.117 - Records that must be retained. (United States)


    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.117 Section 98.117 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... company records of measurements are used to estimate the carbon input and output to each EAF,...

  11. Dicty_cDB: SLF117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF117 (Link to dictyBase) - - - Contig-U16200-1 SLF117E (Link to Original ... qriprcrktrnr lqesqersc**ttttsyc*krsp*tpq*nlitqrch**vtt *sr*dqt*ignrncqqnrn akkdgrflwwfqslnqfdffliqc*kkkyy ...

  12. 40 CFR 89.117 - Test fleet selection. (United States)


    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Test fleet selection. 89.117 Section... Certification Provisions § 89.117 Test fleet selection. (a) The manufacturer must select for testing, from each... of maximum torque and secondarily at rated speed. (b) Each engine in the test fleet must...

  13. 28 CFR 0.117 - Office of Chief Immigration Judge. (United States)


    ... accordance with the Immigration and Nationality Act, 8 U.S.C. 1226 and 1252 and 8 CFR 3.9. ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Office of Chief Immigration Judge. 0.117... Executive Office for Immigration Review § 0.117 Office of Chief Immigration Judge. The Chief...

  14. 32 CFR 643.117 - Hunting, trapping, and fishing. (United States)


    ... 32 National Defense 4 2010-07-01 2010-07-01 true Hunting, trapping, and fishing. 643.117 Section... PROPERTY REAL ESTATE Additional Authority of Commanders § 643.117 Hunting, trapping, and fishing. Applications to hunt, trap, and fish on military reservations are governed by AR 420-74....

  15. 25 CFR 117.14 - Miscellaneous expenditure of surplus funds. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Miscellaneous expenditure of surplus funds. 117.14... AND EXPENDITURE OF INDIVIDUAL FUNDS OF MEMBERS OF THE OSAGE TRIBE OF INDIANS WHO DO NOT HAVE CERTIFICATES OF COMPETENCY § 117.14 Miscellaneous expenditure of surplus funds. Upon application by an...

  16. 27 CFR 479.117 - Action by Customs. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Action by Customs. 479.117... OTHER FIREARMS Importation and Exportation Exportation § 479.117 Action by Customs. Upon receipt of a... of Customs may order such inspection as deemed necessary prior to lading of the merchandise....

  17. Spectrally selective optical pumping in Doppler-broadened cesium atoms

    International Nuclear Information System (INIS)

    The D1 line spectrally selective pumping process in Doppler-broadened cesium is analyzed by solving the optical Bloch equations. The process, described by a three-level model with the Λ scheme, shows that the saturation intensity of broadened atoms is three orders of magnitude larger than that of resting atoms. The |Fg = 3> → |Fe = 4> resonance pumping can result in the ground state |Fg = 4, mF = 4> sublevel having a maximum population of 0.157 and the population difference would be about 0.01 in two adjacent magnetic sublevels of the hyperfine (HF) state Fg = 4. To enhance the anisotropy in the ground state, we suggest employing dichromatic optical HF pumping by adding a laser to excite D1 line |Fg = 4> → |Fe = 3> transition, in which the cesium magnetometer sensitivity increases by half a magnitude and is unaffected by the nonlinear Zeeman effect even in Earth's average magnetic field. (atomic and molecular physics)

  18. Electrode activation in cesium-free negative ion sources

    International Nuclear Information System (INIS)

    Features of emission electrode activation leading to enhancement of negative ion emission in cesium-free discharges are discussed. In some ion sources with cesium-free discharges, the emission of negative ions has been increased significantly by emission electrode activation using strong heating of the negative biased electrode by discharge plasma. A simple explanation of this enhancement is that it is due to an accumulation on the emission surface of the plasma electrode of impurities with low ionization potential that decreases in surface work function and increases the secondary emission of negative ions similar to ''Cesiation.'' The negative biasing of emission surface is important for accumulation and trapping the impurities on the emission surface. To effectively control the activation process it is important to directly detect the evolution of the work function and the impurity concentration during electrode activation with enhancement of negative ion emission.

  19. Trapping and cooling cesium atoms in a speckle field

    International Nuclear Information System (INIS)

    We present the results of two experiments where cold cesium atoms are trapped in a speckle field. In the first experiment, a YAG laser creates the speckle pattern and induces a far-detuned dipole potential which is a nearly-conservative potential. Localization of atoms near the intensity maxima of the speckle field is observed. In a second experiment we use two counterpropagating laser beams tuned close to a resonance line of cesium and in the lin perpendicular to lin configuration, one of them being modulated by a holographic diffuser that creates the speckle field. Three-dimensional cooling is observed. Variations of the temperature and of the spatial diffusion coefficient with the size of a speckle grain are presented. (orig.)

  20. Cesium exchange reaction on natural and modified clinoptilolite zeolites

    International Nuclear Information System (INIS)

    Cesium cation exchange reaction with K, Na, Ca and Mg ions on natural and modified clinoptilolite has been studied. Batch cation-exchange experiments were performed by placing 0.5 g of clinoptilolite into 10 ml or 20 ml of 1 x 10-3M CsCl solution for differing times. Two type deposits of clinoptilolite zeolites from, Nizny Hrabovec (NH), Slovakia and Metaxades (MX), Greece were used for ion-exchange study. The distribution coefficient (Kd) and sorption capacity (Γ) were evaluated. For the determination of K, Na, Ca and Mg isotachophoresis method, the most common cations in exchange reaction was used. Cesium sorption was studied using 137Cs tracer and measured by γ-spectrometry. (author)

  1. Kelvin Probe Studies of Cesium Telluride Photocathode for AWA Photoinjector

    CERN Document Server

    Wisniewski, Eric; Yusof, Zikri; Spentzouris, Linda; Terry, Jeff; Harkay, Katherine


    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (~50 nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin Probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating.

  2. Strontium-90 and cesium-137 in air-borne dust

    International Nuclear Information System (INIS)

    Under the commission of Science and Technology Agency, Japan Chemical Analysis Center and prefectural public health laboratories and institutes have determined the levels of strontium-90 and cesium-137 in air-borne dust samples. Dust samples were collected by the aspiration of 3000 m3 or more air at 1.0 -- 1.5 m above the ground surface in 10 prefectural public health laboratories and institutes. The samples collected during three months were combined, and were forwarded to Japan Chemical Analysis Center after carbonization. These samples were ashed in an electric muffle furnance at Japan Chemical Analysis Center. The ash to which both some carriers and hydrochloric acid were added, was destroyed under heating. The solution was dissolved into hydrochloric and filtered, after it was added with nitric acid and heated to dryness. The filtrate was radiochemically analysed for strontium-90 and cesium-137 with low background beta-ray spectrometer. (author)

  3. Cesium and lead uptake by CSH phases of hydrated cement

    International Nuclear Information System (INIS)

    As Kd from radwaste elements in concrete systems show a wide range of values, a modelling of cesium and lead immobilization in Calcium Silicate Hydrate (CSH, xCaO.SiO2.H2O, with 0.7 (aged cements)SiOH) and precipitation equilibria. Values of Kd from cesium and lead in CSH matrix can thus be calculated with Ca/Si evolution and ionic strength effect. Predictive calculations have been carried out with success with different Ca/Si ratios, ionic strengths and liquid/solid ratios, and results are well superimposed with experimental isotherm data. If the CSH really allow accounting for the radwaste behavior in hydrated cement matrices, this model can be used in safety assessment calculations, with varying pH and [Ca2+] as cement degradation state parameters. Copyright (2001) Material Research Society

  4. New thermodynamic regularity for cesium over the whole liquid range

    CERN Document Server

    Ghatee, M H


    In this paper we derive an equation of state for liquid cesium based on a suggested potential function in accord to the characteristics large attraction and soft repulsion at the asymptotes of interaction potentials. By considering the interaction of nearest adjacent atoms in dense fluid, the equation of state predicts that the isotherm is linear function of, where is the compression factor, is the molar volume, and is the molar density. The linear parameters are identified as interaction coefficients related to attraction and repulsion, and are used to evaluate the molecular parameters with interesting implications. The isotherm is intended to resolve the particular thermodynamic properties of alkali metals, which have been known for their unusual change of the nature of intermolecular force as the characteristic metal-nonmetal transition range is approached. When applied to liquid cesium, the isotherms persist linear over the whole liquid range including the metal non-metals transition range and at the crit...

  5. Strontium-90 and cesium-137 in air-borne dust

    International Nuclear Information System (INIS)

    The levels of strontium-90 and cesium-137 in airborne dust have been determined by Japan Chemical Analysis Center under the contact with Science and Technology Agency. Dust samples were collected at 1.0 -- 1.5m above the ground surface with electrostatic precipitators or on filter papers by each prefectural public health laboratories and institutes in 9 prefectures, and these samples were forwarded to Japan Chemical Analysis Center after the carbonization. These samples were asked in an electric muffle furnance at Japan Chemical Analysis Center. The ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The solution was dissolved into hydrochloric acid and filtered, after it was added with nitric acid and heated to dryness. The filtrate was analysed for strontium-90 and cesium-137 using the method recommended by science and Technology Agency. (author)

  6. Cesium-137, a drama recounted; Cesio-137, um drama recontado

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar


    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  7. Migration behavior of cesium in compacted sodium montmorillonite

    International Nuclear Information System (INIS)

    For safety assessments of geological disposal of high-level radioactive wastes, it is important to study the migration behavior of radioactive nuclides in compacted bentonite. In the present study, the apparent diffusion coefficients and activation energies of the diffusion were determined for cesium ions in compacted montmorillonite, a major clay mineral in bentonite. The activation energies obtained in the present study were 32.9 to 52.9 kJ mol-1, clearly higher than for the diffusion of cesium ions in free water, 16.2 kJ mol-1. The activation energies for Na-montmorillonite specimens with dry densities of 1.0, 1.2, and 1.4 x 103 kg m-3 were similar at approximately 34 kJ mol-1. When the dry density of the Na-montmorillonite specimens increases, the activation energy also increases, to reach 52.9 kJ mol-1 at 1.8 x 103 kg m-3. These findings suggest that the cesium in the compacted Na-montmorillonite diffuses with a different process from that in free water. Basal spacings were determined by the X-ray diffraction method for water-saturated, compacted Na-montmorillonite specimens. Three-water layer hydrate in the interlamellar space was observed for the Na-montmorillonite with dry densities of 1.0, 1.2, and 1.4 x 103 kg m-3, where the activation energies for the diffusion were nearly constant. Only the two-water layer hydrate was found in the Na-montmorillonite with dry densities of 1.6 and 1.8 x 103 kg m-3, in which the activation energy increases with the dry density. It is possible that the basal spacing could affect the migration behavior of cesium in compacted Na-montmorillonite. (author)

  8. Radioactive cesium. Dynamics and transport in forestal food-webs

    International Nuclear Information System (INIS)

    This report summarises results from a radioecological study during 1994-1995 concerning turnover, redistribution and loss of radioactive Cesium (134 and 137) in boreal forest ecosystems, as well as uptake and transfer in important food-chains over moose, vole and vegetation. The basis for this report are 9 publications published 1994-95. These reports are presented in summary form. 9 refs, 17 figs

  9. Optimized production of a cesium Bose-Einstein condensate


    Kraemer, Tobias; Herbig, Jens; Mark, Michael; Weber, Tino; Chin, Cheng; Naegerl, Hanns-Christoph; Grimm, Rudolf


    We report on the optimized production of a Bose-Einstein condensate of cesium atoms using an optical trapping approach. Based on an improved trap loading and evaporation scheme we obtain more than $10^5$ atoms in the condensed phase. To test the tunability of the interaction in the condensate we study the expansion of the condensate as a function of scattering length. We further excite strong oscillations of the trapped condensate by rapidly varying the interaction strength.

  10. Cesium dihydrophosphate monocrystal growth and certain of their properties

    International Nuclear Information System (INIS)

    Crystals of cesium dihydrophosphate (centrisymmetrical, monoclinic, point symmetric group 2/m) are obtained by methods involving solvent evaporation and temperature reduction. At -122 deg C, a ferroelectric phase transition occurs, and at 230 and 265 deg C first-kind transitions, which are not accompanied by composition changes. CsH2PO4 solubility substantially increases with higher medium acidity, and remains approximately constant in alkali medium

  11. Behaviour of radioactive cesium in northern boreal forest ecosystems

    International Nuclear Information System (INIS)

    Full text: In 1997-2001 a large number of environmental samples have been collected from the Muddusjaervi area in Finnish Lappland. These samples include soil, water, sediment, vegetation and fish samples. Radioactive contamination in this subarctic environment has mainly resulted from the nuclear weapons test fallout in the 1950s and 1960s. Chernobyl accident did not considerably increase the contamination level in this area. The Laboratory of Radiochemistry, University of Helsinki, has been studying the behaviour of fallout radionuclides in the environment and in food chains in Lappland from the beginning of the 1960s. The study area lies in the middle of northern reindeer herding area where accumulation of radioactive cesium has been observed in food chains. In this paper we report on the behaviour of radioactive cesium in soil columns. The soil in this area is typically nutrient-poor podzolic soil. Altogether thirty soil columns were collected and they were divided into horizons (litter, organic and mineral layers). The activity concentrations of the horizons were determined by gamma spectrometry. In general, cesium has been concentrated mainly in the litter and organic layers and it has not been migrated considerably to mineral layers. To study the long term behaviour of cesium in soil the activity concentrations have been compared to those found in earlier decades and to the activity concentrations earlier determined for other radionuclides, especially for Pu. A further major objective was to study runoff of radionuclides from ground to lakes and brooks and therefore many of the soil samples were collected from various distances from lakes and brooks. (author)

  12. Detection of the actinides and cesium from environmental samples (United States)

    Snow, Mathew Spencer

    Detection of the actinides and cesium in the environment is important for a variety of applications ranging from environmental remediation to safeguards and nuclear forensics. The utilization of multiple different elemental concentrations and isotopic ratios together can significantly improve the ability to attribute contamination to a unique source term and/or generation process; however, the utilization of multiple elemental "signatures" together from environmental samples requires knowledge of the impact of chemical fractionation for various elements under a variety of environmental conditions (including predominantly aqueous versus arid conditions). The research reported in this dissertation focuses on three major areas: 1. Improving the understanding of actinide-mineral interactions at ultra-low concentrations. Chapter 2 reports a batch sorption and modeling study of Np(V) sorption to the mineral goethite from attomolar to micromolar concentrations. 2. Improving the detection capabilities for Thermal Ionization Mass Spectrometry (TIMS) analyses of ultra-trace cesium from environmental samples. Chapter 4 reports a new method which significantly improves the chemical yields, purification, sample processing time, and ultimately, the detection limits for TIMS analyses of femtogram quantities of cesium from a variety of environmental sample matrices. 3. Demonstrating how actinide and cesium concentrations and isotopic ratios from environmental samples can be utilized together to determine a wealth of information including environmental transport mechanisms (e.g. aqueous versus arid transport) and information on the processes which generated the original material. Chapters1, 3 and 5 demonstrate these principles using Pu, Am, Np, and Cs concentrations and isotopic ratios from contaminated soils taken near the Subsurface Disposal Area (SDA) of Idaho National Laboratory (INL) (a low level radioactive waste disposal site in southeastern Idaho).

  13. Corrections to our results for optical nanofiber traps in Cesium

    CERN Document Server

    Ding, D; Choi, K S; Kimble, H J


    Several errors in Refs. [1, 2] are corrected related to the optical trapping potentials for a state-insensitive, compensated nanofiber trap for the D2 transition of atomic Cesium. Section I corrects our basic formalism in Ref. [1] for calculating dipole-force potentials. Section II corrects erroneous values for a partial lifetime and a transition wavelength in Ref. [1]. Sections III and IV present corrected figures for various trapping configurations considered in Refs. [1] and [2], respectively.

  14. Electrically switched cesium ion exchange. FY 1997 annual report

    International Nuclear Information System (INIS)

    This paper describes the Electrically Switched Ion Exchange (ESIX) separation technology being developed as an alternative to ion exchange for removing radionuclides from high-level waste. Progress in FY 1997 for specific applications of ESIX is also outlined. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution can be controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. Based on the ferrocyanide film capacity, stability, rate of uptake, and selectivity shown during performance testing, it appears possible to retain a consistent rate of removal and elute cesium into the same elution solution over several load/unload cycles. In batch experiments, metal hexacyanoferrate films showed high selectivities for cesium in concentrated sodium solutions. Cesium uptake was unaffected by Na/Cs molar ratios of up to 2 x 104 , and reached equilibrium within 18 hours. During engineering design tests using 60 pores per inch, high surface area nickel electrodes, nickel ferrocyanide films displayed continued durability. losing less than 20% of their capacity after 1500 load/unload cycles. Bench-scale flow system studies showed no change in capacity or performance of the ESIX films at a flow rate up to 13 BV/h, the maximum flow rate tested, and breakthrough curves further supported once-through waste processing. 9 refs., 24 figs

  15. Studies on the Separation of Cesium From Fission Products

    Institute of Scientific and Technical Information of China (English)

    QIANLi-juan; ZHANGSheng-dong; GUOJing-ru; CUIAn-zhi; YANGLei; WUWang-suo


    135Cs is a long-life fission product. When measuring its thermal cross section, we must separate radiochemical purity cesium from fission products. Except for decontaminating radio- nuclides, others which can be activated must be avoided to come into solution. So ion exchanger is used. Inorganic ion exchangers have received increased attention because of their high resistance to radiation and their very efficient separation of alkali metal ions.

  16. Extraction of rubidium and cesium from micas following sulfate-extraction technology

    International Nuclear Information System (INIS)

    Results are presented of semicommercial tests of procedure of rubidium and cesium extraction from micas. Micas has been processed by the 40% solution of sulphuric acid at boiling temperature. Separate extraction of cesium and rubidium from the solution with arylalkylsubstituted phenol has been conducted after alum crystallization and decomposition by lime. Pure rubidium carbonate and technical cesium carbonate with their 80 and 95% extraction, respectively, are prepared

  17. Investigations of the method of sodium decontamination from cesium and tritium aiming its utilization or disposal

    International Nuclear Information System (INIS)

    Effective methods of removing cesium and tritium from sodium are submitted. It is shown, that the cleaning from cesium with consecutive use of portions of carbon materials will allow on the orders to reduce amount of sorbent, in which is concentrated cesium. For cleaning from tritium technological process with use of a cold trap and special dosage hydrogen in sodium is offered. The data on required time of cleaning and depth of cleaning at various capacity of hydrogen source are given. (author)

  18. Test procedures and instructions for Hanford complexant concentrate supernatant cesium removal using CST

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W.


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Complexant Concentrate supernatant liquor from tank 241-AN-107, in a bench-scale column. The cesium sorbent to be tested is crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-023, Hanford Complexant Concentrate Supernatant Cesium Removal Test Plan.

  19. Test procedures and instructions for Hanford tank waste supernatant cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Hendrickson, D.W., Westinghouse Hanford


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test using Hanford Double-Shell Slurry Feed supernatant liquor from tank 251-AW-101 in a bench-scale column.Cesium sorbents to be tested include resorcinol-formaldehyde resin and crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-022, Hanford Tank Waste Supernatant Cesium Removal Test Plan.


    Energy Technology Data Exchange (ETDEWEB)

    Nash, C.; Hang, T.; Aleman, S.


    Ion exchange modeling was conducted at the Savannah River National Laboratory to compare the performance of two organic resins in support of Small Column Ion Exchange (SCIX). In-tank ion exchange (IX) columns are being considered for cesium removal at Hanford and the Savannah River Site (SRS). The spherical forms of resorcinol formaldehyde ion exchange resin (sRF) as well as a hypothetical spherical SuperLig{reg_sign} 644 (SL644) are evaluated for decontamination of dissolved saltcake wastes (supernates). Both SuperLig{reg_sign} and resorcinol formaldehyde resin beds can exhibit hydraulic problems in their granular (nonspherical) forms. SRS waste is generally lower in potassium and organic components than Hanford waste. Using VERSE-LC Version 7.8 along with the cesium Freundlich/Langmuir isotherms to simulate the waste decontamination in ion exchange columns, spherical SL644 was found to reduce column cycling by 50% for high-potassium supernates, but sRF performed equally well for the lowest-potassium feeds. Reduced cycling results in reduction of nitric acid (resin elution) and sodium addition (resin regeneration), therefore, significantly reducing life-cycle operational costs. These findings motivate the development of a spherical form of SL644. This work demonstrates the versatility of the ion exchange modeling to study the effects of resin characteristics on processing cycles, rates, and cold chemical consumption. The value of a resin with increased selectivity for cesium over potassium can be assessed for further development.

  1. Transition of cesium in food chains [after Chernobyl catastrophe

    International Nuclear Information System (INIS)

    An investigation of 25,000 samples of foodstuffs and feedstuffs in Czechoslovakia, contaminated by fall-out cesium after the accident in the Chernobyl nuclear power plant, performed from May 5, 1986 to March 31, 1988, revealed that both the values of cesium transfer-factors in food--animal tissues--milk transitions and the values of biological half-life of cesium are functions of internal and external conditions of contamination. Organism individuality as the main internal condition causes the variance of about +/- 50% of the mean value of the respective transfer-factor. Through the external conditions, mainly the environmental contamination level, type of ingested food and time of ingestion, the mean values of transfer-factors are influenced up to 500%, e.g. to the value of 0.5. But this value converges with growing up contamination of food and environment to the limit of 0.3. The first two to three biological half-lives after the last ingestion of contaminated food are up to ten-times shorter than those at stabilized state

  2. Cesium transfer to agricultural crops for three years after Chernobyl

    International Nuclear Information System (INIS)

    In 1986 about 50 farms in the fallout region were selected for sampling at fixed sites of the soil surface layer and of the grassland and grain crops to come. The aim was to cover the different soil types and the farming practices of the region during studies on the transfer levels and on the change with time in transfer of cesium to the crops. It was found that the transfer level, as expected, was much higher for the grassland than for the grain crops. However, within both groups of considerable variation in the transfer level for the same year as measured by the transfer factors has occurred. For the former crops it can be concluded that the transfer factor during year 1 depends on the interception capacity of the plant cover and on the dilution by growth i.e on soil fertility and on fertilization level. In the following years the cesium TF-value for the grass cover was reduced by a factor from 2 to about 10. The reduction rate differed above all between the organic soils and the mineral soils and should largely depend on the type of the grass cover, on the different cesium fixing capacities of the two soil groups and on the potassium fertilization level. On ploughed land the transfer by root uptake to grain crops was about one magnitude lower than the transfer to the hey crops. (orig.)

  3. Example of cesium sorption database in natural minerals

    International Nuclear Information System (INIS)

    In the database of the National Institute for Materials Science (MatNavi), the adsorption data of cesium, strontium, and iodine have been published. Among these data, the authors picked up the data of cesium adsorption against natural ores, which were measured and compiled by the authors, graphically expressed them for clarifying the overall trends, and described each mineral’s adsorption characteristics and future challenges. The partition coefficients for the following minerals are compiled: bentonite, acid clay, montmorillonite, beidellite, vermiculite, illite, mordenite, zeolite, etc. Many of the recorded data in MatNavi are the data obtained in the systems without existence of a large amount of competing ions. On the other hand, in the accumulated water at the Fukushima Daiichi Nuclear Power Station, competing ions due to seawater are contained. In the immersion liquid of incineration fly ash and the immersion liquid of plants/vegetation, too, competing ions are considered to be contained. Accumulation of adsorption data under different solution conditions are considered important. In addition, the concentrations of radioactive cesium in decontamination target are lower values by 5-7 orders, compared with the lower limit of 0.01 ppm in the existing data. In face of experiments, the influence of adsorption to containers and filters cannot be neglected. (A.O.)

  4. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper


    Houssni El-Saied; Samya El-Sherbiny; Omnia Ali; Wafaa El-Saied; Said Rohyem


    In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+) on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the...

  5. Mobility of cesium through the Callovo-Oxfordian claystones under partially saturated conditions

    International Nuclear Information System (INIS)

    The diffusion of cesium was studied in an unsaturated core of Callovo-Oxfordian claystone, which is a potential host rock for retrievable disposal of high-level radioactive wastes. In-diffusion laboratory experiments were performed on rock samples with water saturation degrees ranging from 81% to 100%. The analysis of both cesium concentration monitoring in the source reservoir and postmortem cesium rock concentration profile of the samples was carried out using a chemical-transport code where the sorption of cesium was described by a multi-site ion-exchange model. The results showed that cesium exhibited a clear trend related to the saturation degree of the sample. The more dehydrated the rock sample, the slower the decrease of cesium concentration, and the thinner the penetration depth of cesium was. The effective diffusion coefficient (De) for cesium decreased from 18.5 *10-11 m2 s-1 at full-saturation to 0.3 * 10-11 m2 s-1 for the more dehydrated sample. This decrease is almost 1 order of magnitude higher than that for tritiated water (HTO), although a similar behavior could have been expected, since cesium is known to diffuse in the same parts of the pore space as HTO in fully saturated claystones. (authors)

  6. Cesium transport in Four Mile Creek of the Savannah River Plant

    International Nuclear Information System (INIS)

    The behavior of a large radioactive cesium release to a Savannah River Plant (SRP) stream was examined using a stable cesium release to Four Mile Creek. Measurements following the release show that most of the cesium released was transported downstream; however, sorption and desorption decreased the maximum concentration and increased the travel time and duration, relative to a dye tracer, at sampling stations downstream. The study was made possible by the development of an analytical technique using ammonium molybdophosphate and neutron activation that permitted the measurement of stable cesium concentrations as low as 0.2 μg/L

  7. Radioactive cesium dynamics derived from hydrographic observations in the Abukuma River Estuary, Japan. (United States)

    Kakehi, Shigeho; Kaeriyama, Hideki; Ambe, Daisuke; Ono, Tsuneo; Ito, Shin-Ichi; Shimizu, Yugo; Watanabe, Tomowo


    Large quantities of radioactive materials were released into the air and the ocean as a result of the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident, caused by the 2011 Tohoku earthquake and the subsequent major tsunami off the Pacific coast. There is much concern about radioactive contamination in both the watershed of the Abukuma River, which flows through Fukushima Prefecture, and its estuary, where it discharges into the sea in Miyagi Prefecture. We investigated radioactive cesium dynamics using mixing diagrams obtained from hydrographic observations of the Abukuma River Estuary. Particulate radioactive cesium dominates the cesium load in the river, whereas the dissolved form dominates in the sea. As the salinity increased from <0.1 to 0.1-2.3, the mixing diagram showed that dissolved radioactive cesium concentrations increased, because of desorption. Desorption from suspended particles explained 36% of dissolved radioactive cesium in estuarine water. However, the dissolved and particulate radioactive cesium concentrations in the sea decreased sharply because of dilution. It is thought that more than 80% of the discharged particulate radioactive cesium was deposited off the river mouth, where the radioactive cesium concentrations in sediment were relatively high (217-2440 Bq kg(-1)). Radioactive cesium that was discharged to the sea was transported southward by currents driven by the density distribution. PMID:26698826

  8. Laboratory plant for the separation of cesium from waste solutions of the PUREX process

    International Nuclear Information System (INIS)

    A laboratory plant for the separation of cesium from a fission product waste solution of the fuel reprocessing is described. The plant consists of two stages. In the first stage cesium is adsorbed on ammonium molybdatophosphate (AMP). Then the adsorbent is dissolved. From the solution cesium is adsorbed on a cationic ion exchanger in the second stage. Then AMP can be reproduced from this solution. For the elution of cesium in the second stage a NH4NO3 solution (3 m) is used. Flow sheet, construction and the control device of the plant are described and the results of tests with a model solution are given. (author)

  9. Structure of cesium loaded iron phosphate glasses: An infrared and Raman spectroscopy study

    International Nuclear Information System (INIS)

    The structure of cesium loaded iron phosphate glasses (IPG) was investigated using infrared and Raman spectroscopy. The spectra of the cesium doped samples revealed a structural modification of the parent glass owing to the incorporation of cesium. The structural changes could be correlated with the variation observed in the glass transition temperature of these glasses. Increased Cs-mediated cationic cross linking appears to be the reason for the initial rise in glass transition temperature up to 21 mol% Cs2O in IPG; while, breakdown of the phosphate network with increasing cesium content, brings down the glass transition temperature.

  10. Radioactive cesium content in selected food products. Pt. 1. Radioactive cesium content in dried milk (1987-1988)

    International Nuclear Information System (INIS)

    The content of radioactive cesium in dried and dried skimmed milk from selected dairies was double determined. The highest content was found in samples from milk from OSM Siedlce (98 Bq/kg) and skimmed milk from Radzyn Podlaski and Ostroleka, (the former 90, the latter 62 Bq/kg). The lowest level of radioactive cesium was observed in samples from dried milk from Sieradz, Slups, Wrzesnia, Olecko and Elblag (about or below 10 Bq/kg). Although those levels of contamination with radiocesium did not exceed values recommended by FAO they were determined as high for year 1987/88 as compared milk dates from previous 1985 year. (author). 13 refs, 4 tabs

  11. Radioactive cesium. Dynamics and transport in forestal food-webs; Radioaktivt cesium. Dynamik och transport i skogliga naeringsvaevar

    Energy Technology Data Exchange (ETDEWEB)

    Palo, T.; Nelin, P. [Swedish Univ. of Agricultural Sciences, Umeaa (Sweden). Dept. of Animal Ecology; Bergman, R.; Nylen, T. [FOA NBC Defence, Umeaa (Sweden)


    This report summarises results from a radioecological study during 1994-1995 concerning turnover, redistribution and loss of radioactive Cesium (134 and 137) in boreal forest ecosystems, as well as uptake and transfer in important food-chains over moose, vole and vegetation. The basis for this report are 9 publications published 1994-95. These reports are presented in summary form. 9 refs, 17 figs.

  12. Cesium and strontium exchange properties of marsh soils

    International Nuclear Information System (INIS)

    The cesium and strontium exchange properties of some typical marsh soils of the estuary and lower river Weser region were described. Soil samples were taken according to the existing soil maps 1:25000 of Lower Saxony e.g. a “sea marsh soil”. a “brackish marsh soil”, and a “river marsh soil”. The exchange properties were determined by Cs/Ca and Sr/Ca exchange curves (Q/I relations) as generally used in soil potassium research. In addition to the Q/I relations the following investigations were carried out: - Cs and Sr desorption experiments (one time equilibration with Ca++ solutions) - Cs and Sr reexchange experiments (eight times equilibration with water, Ca++, Ba++, and K+ solutions) - the naturally-occuring Cs and Sr contents of the soils including amounts caused by imissions or fallout, respectively - clay mineral composition and swelling of layer silicates due to saturation with Ca++, Sr++, Cs+, and K+ ions. Q/I relations as well as desorption and reexchange experiments indicated strong cesium and low strontium fixation by the soils investigated. This was considered the reason for the stronger transfer of Sr from soil to plants as compared with Cs. Furthermore, the reexchange experiment revealed nearly complete reversibility of the Sr sorption reactions by equilibration with the divalent cations Ca++ and Ba++ and some Sr fixation after treatment with K+ solutions. However, cesium was much better reexchanged by K+ than by Ca++ and Ba++ ions. This led to the conclusion that Cs fixed in interlayer positions of clay minerals could be remobilized by potassium and ammonium fertilization. The naturally-occuring Cs contents of the soils were found to be below the detection limit of the analytical methods used. The contents of naturally-occuring exchangeable Sr, however, was in agreement with the amounts of “labile Sr” as derived from the Sr/Ca exchange curves. Concerning the cesium exchange properties a clear distinction between “sea and river marsh

  13. Elastic and inelastic scattering of cesium, cesium iodide, and cesium chloride by argon and xenon in the crossed atomic and molecular beams

    International Nuclear Information System (INIS)

    Velocity and angular distributions of cesium atoms and two cesium halide molecules scattered by rare gas atoms have been measured for the following systems at the indicated initial relative collision energies, anti E: Cs + Ar, anti E = 0.94, 1.29, and 1.85 kcal/mole; Cs + Xe, E = 1.15, 1.91, and 3.10 kcal/mole; Csl + Ar, anti E = 1.06, 1.46, and 2.08 kcal/mole; CsI + Ar, anti E = 1.36, 1.63, and 1.94 kcal/mole; CsI + Xe, anti E = 1.52, 2.52, and 4.09 kcal/mole. At the collision energies indicated the atom-atom scattering can only be elastic. Thus the experiments with those systems can be used for apparatus calibration and a standard of comparison for the diatom-atom experiments. The velocity distributions in the diatom-atom systems are analyzed for the relative contributions of elastic and inelastic scattering

  14. A low phase noise microwave frequency synthesis for a high-performance cesium vapor cell atomic clock

    International Nuclear Information System (INIS)

    We report the development, absolute phase noise, and residual phase noise characterization of a 9.192 GHz microwave frequency synthesis chain devoted to be used as a local oscillator in a high-performance cesium vapor cell atomic clock based on coherent population trapping (CPT). It is based on frequency multiplication of an ultra-low phase noise 100 MHz oven-controlled quartz crystal oscillator using a nonlinear transmission line-based chain. Absolute phase noise performances of the 9.192 GHz output signal are measured to be −42, −100, −117 dB rad2/Hz and −129 dB rad2/Hz at 1 Hz, 100 Hz, 1 kHz, and 10 kHz offset frequencies, respectively. Compared to current results obtained in a state-of-the-art CPT-based frequency standard developed at LNE-SYRTE, this represents an improvement of 8 dB and 10 dB at f = 166 Hz and f = 10 kHz, respectively. With such performances, the expected Dick effect contribution to the atomic clock short term frequency stability is reported at a level of 6.2 × 10−14 at 1 s integration time, that is a factor 3 higher than the atomic clock shot noise limit. Main limitations are pointed out

  15. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    International Nuclear Information System (INIS)

    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 ± 15 Bq.m-2 for South region to 15 ± 2 Bq.m-2 for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  16. Vacuum squeezed light for atomic memories at the D2 cesium line

    CERN Document Server

    Burks, Sidney; Giacobino, Elisabeth; Laurat, Julien; Ortalo, Jérémie; Jia, Xiaojun; Villa, Fabrizio; Chuimmo, Antonino


    We report the experimental generation of squeezed light at 852 nm, locked on the Cesium D2 line. 50% of noise reduction down to 50 kHz has been obtained with a doubly resonant optical parametric oscillator operating below threshold, using a periodically-polled KTP crystal. This light is directly utilizable with Cesium atomic ensembles for quantum networking applications

  17. Ionizing mechanisms in a cesium plasma irradiated with a ruby laser (United States)

    Shimada, K.; Robinson, L. B.


    A cesium filled diode--laser plasmadynamic converter was built to investigate the feasibility of converting laser energy to electrical energy at large power levels. Experiments were performed with a pulsed ruby laser to determine the quantity of electrons and cesium ions generated per pulse of laser beam and to determine the output voltage. A current density as high as 200 amp/sq cm from a spot of approximately 1 sq mm area and an open circuit voltage as high as 1.5 volts were recorded. A qualitative theory was developed to explain these results. In the operation of the device, the laser beam evaporates some of the cesium and ionizes the cesium gas. A dense cesium plasma is formed to absorb further the laser energy. Results suggest that the simultaneous absorption of two ruby laser photons by the cesium atoms plays an important role in the initial ionization of cesium. Inverse bremsstrahlung absorption appears to be the dominant mechanism in subsequent processes. Recombinations of electrons and cesium ions appear to compete favorably with the simultaneous absorption of two photons.

  18. Peculiarities of presence of cesium-137 in soil at Azgir test site grounds

    International Nuclear Information System (INIS)

    The granulometric composition of soil and the distribution of cesium-137 by soil fractions at the Azgir test site was determined. The characterization of cesium-137 presence in the layer of the thickness of 1 cm of the surface soil was gave. (author)

  19. Velocity Distribution of Effective Atoms in a Small Optically Pumped Cesium Beam Frequency Standard

    Institute of Scientific and Technical Information of China (English)

    CHEN Jingbiao; WANG Fengzhi; YANG Donghai; WANG YiQiu


    In this paper, the velocity distribution of effective atoms in a small optically pumped cesium beam frequency standard has been achieved from the Fourier transforms of the experimentally recorded Ramsey patterns. The result fits well with the theoretical calculation. The second order Doppler shift correction of the small cesium atomic clock is obtained from the velocity distribution of effective atoms.

  20. 7 CFR 400.117 - Determination of delinquency. (United States)


    ..., DEPARTMENT OF AGRICULTURE GENERAL ADMINISTRATIVE REGULATIONS Debt Management-Regulations for the 1986 and Succeeding Crop Years § 400.117 Determination of delinquency. Prior to disclosing information about a debt...

  1. 117 Standards Admitted in Civil Administration Standardization Plan

    Institute of Scientific and Technical Information of China (English)


    @@ The Ministry of Civil Administration has finalized its Standardization Plan 2007. According to this plan, the Ministry will see that 117 standards, including 8 compulsory national standards, 83 recommended national standards, and 26 professional standards, are prepared by June 2008.

  2. Cesium-134 and cesium-137 in honey bees and cheese samples collected in the U.S. after the Chernobyl accident

    International Nuclear Information System (INIS)

    As a result of the Chernobyl accident on April 25, 1986, possible radioactive contamination of honey bees and cheese sampled in several areas of the United States were measured. Of bees collected in May and June of 1986 in both Oregon and New York, only those from Oregon showed detectable levels of cesium-134 (T1/2 = 2.05 years), a radionuclide which would have originated from the Chernobyl incident. Cheese produced in Oregon and New York before the accident showed only cesium-137 (T1/2 = 30.23 years) but cheese produced afterwards (May and September, 1986) in Oregon contained cesium-134. Cheese produced in Ohio and California at the time of the accident and thereafter contained only cesium-137. In general, the levels of radioactivity were higher in the West coast samples as compared to those taken in the East. The levels of radioactivity detected were considered to be toxicologically of no consequence. (author)

  3. Cesium ion exchange using actual waste: Column size considerations

    International Nuclear Information System (INIS)

    It is presently planned to remove cesium from Hanford tank waste supernates and sludge wash solutions using ion exchange. To support the development of a cesium ion exchange process, laboratory experiments produced column breakthrough curves using wastes simulants in 200 mL columns. To verify the validity of the simulant tests, column runs with actual supernatants are being planned. The purpose of these actual waste tests is two-fold. First, the tests will verify that use of the simulant accurately reflects the equilibrium and rate behavior of the resin compared to actual wastes. Batch tests and column tests will be used to compare equilibrium behaviors and rate behaviors, respectively. Second, the tests will assist in clarifying the negative interactions between the actual waste and the ion exchange resin, which cannot be effectively tested with simulant. Such interactions include organic fouling of the resin and salt precipitation in the column. These effects may affect the shape of the column breakthrough curve. The reduction in column size also may change the shape of the curve, making the individual effects even more difficult to sort out. To simplify the evaluation, the changes due to column size must be either understood or eliminated. This report describes the determination of the column size for actual waste testing that best minimizes the effect of scale-down. This evaluation will provide a theoretical basis for the dimensions of the column. Experimental testing is still required before the final decision can be made. This evaluation will be confined to the study of CS-100 and R-F resins with NCAW simulant and to a limited extent DSSF waste simulant. Only the cesium loading phase has been considered

  4. Sorption of iodine, chlorine, technetium and cesium in soil

    International Nuclear Information System (INIS)

    The safety assessment of final disposal of spent nuclear fuel will include an estimate for the behavior of waste nuclides in the biosphere. As a part of this estimate also the sorption of radioactive iodine, chlorine, technetium and cesium in soil is to be considered. The chemistry and the sorption of these radionuclides in soils are described in this literature survey. Behavior of I-129, Cl-36 and Tc-99 in the environment is of great interest because of their long half-lives and relatively high mobilities. The importance of Cs-135 arises from its high content in spent nuclear fuel and long physical half-life, even though it is considered relatively immobile in soil. Factors affecting the migration and sorption of radionuclides in soils can be divided into elemental and soil specific parameters. The most important elemental factor is the speciation of the element, which is influenced by the soil redox potential, pH and complex forming ligands. Soil micro-organisms can either serve as sorbents for radionuclides or affect their speciation by altering the prevailing soil redox conditions. Soil organic matter content and mineral properties have a marked influence on the retention of radionuclides. The sorption of anionic radionuclides such as I-, Cl- and TcO4 - is pronounced in the presence of organic matter. Clay minerals are known to bound cesium effectively. The effect of speciation of radioactive iodine, chlorine, technetium and cesium in soil is considered in this study, as well as the effect of soil micro-organisms, organic matter and mineral properties. (orig.)

  5. Cesium Eluate Evaporation Solubility and Physical Property Behavior

    International Nuclear Information System (INIS)

    The baseline flowsheet for low activity waste (LAW) in the Hanford River Protection Project (RPP) Waste Treatment Plant (WTP) includes pretreatment of supernatant by removing cesium using ion exchange. When the ion exchange column is loaded, the cesium will be eluted with a 0.5M nitric acid (HNO3) solution to allow the column to be conditioned for re-use. The cesium eluate solution will then be concentrated in a vacuum evaporator to minimize storage volume and recycle HNO3. To prevent the formation of solids during storage of the evaporator bottoms, criteria have been set for limiting the concentration of the evaporator product to 80 percent of saturation at 25 degrees C. A fundamental element of predicting evaporator product solubility is to collect data that can be used to estimate key operating parameters. The data must be able to predict evaporator behavior for a range of eluate concentrations that are evaporated to the point of precipitation. Parameters that were selected for modeling include solubility, density, viscosity, thermal conductivity, and heat capacity. Of central importance is identifying the effect of varying feed components on overall solubility. The point of solubility defines the upper limit for eluate evaporation operations and liquid storage. The solubility point also defines those chemical compounds that have the greatest effects on physical properties. Third, solubility behavior identifies intermediate points where physical property data should be measured for the database. Physical property data (density, viscosity, thermal conductivity, and heat capacity) may be an integral part of tracking evaporator operations as they progress toward their end point. Once the data have been collected, statistical design software can develop mathematical equations that estimate solubility and other physical properties

  6. Dicty_cDB: AFJ117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATTAGTTTAGCAATTTCA TTCGCTCGTAATCTTGT Length of connected seq. 1267 Full length Seq ID AFJ117E Full length Se...TGCTACAAAA CCATTAACAATTGATATTAGTTTAGCAATTTCATTCGCTCGTAATCTTGT Length of 3' end seq. 700 Connected seq. ID AFJ117P Connect...odium falciparum 3D7 chromosome 14 section 2 of 13 of the co...vklcqlliqrvyiif*tqvva*krqritlhltlkrnfqngmdslevyprnin inkrwrimifsftwvmvvvnntlevtvfkswknvvflf*wvvkvvilknkvnlnqlvlys isfwlvvklslvism...) Aspergillus nidulans cell division-ass... 140 1e-31 A35694( A35694 )cut1 protein - fission y

  7. Cesium-137 inventory of the undisturbed soil areas in the Londrina Region, Parana, Brazil

    International Nuclear Information System (INIS)

    Cesium-137 is an artificial radionuclide introduced in the environment through the radioactive fallout of the superficial tests of nuclear weapons. The cesium-137 deposition occurred to middles of the 1980-decade and, due to the Chernobyl accident, great part of Europe had a additional fallout of cesium-137. The contaminations of this accident do not have reached Southern Hemisphere. Cesium-137 is an alkaline metal, high electropositive, that in contact with the soil is strongly adsorbed to the clay in the FES (Frayed Edge Sites) and RES (Regular Edge Sites) positions, and it movement by chemical processes in the soil is insignificant. Because of this, cesium-137 became a good soil marker, and its movement is related to the soil movement particles, so that the cesium-137 have been used in the study of the soil redistribution processes, as a tool of quantifying the rates of soil losses and gain. To use this methodology, it is necessary the knowledge of the reference inventory of cesium-137, that is given as function of the total concentration of cesium-137 deposited in an area by the radioactive fallout. If a sampling point presents less cesium-137 than the reference inventory, this point is considered a point with soil loss; otherwise, the point is considered a point with soil deposition. To evaluate the cesium-137 inventory in the Londrina region, four areas of the undisturbed soil were sampling in grid of 3x3, with a distance of 9 meters among the points. Of these four sampling areas, three areas were of native forest (labeled Mata1, Mata2 and Mata UEL), and one was a pasture area. Cesium-137 inventory was 223 ± 41 Bq m-2, 240 ± 65 Bq m-2 and 305 ± 36 Bq m-2 for Mata UEL, Mata1 and Mata2, respectively, and of 211 ± 28 Bq m-2 for the native pasture. Considering the deviation in each value, it is not possible to conclude that there are differences among the values of cesium-137 inventory, so that the average reference inventory of cesium-137 for the Londrina

  8. Characterization of quantum efficiency and robustness of cesium-based photocathodes (United States)

    Montgomery, Eric J.

    High quantum efficiency, robust photocathodes produce picosecond-pulsed, high-current electron beams for photoinjection applications like free electron lasers. In photoinjectors, a pulsed drive laser incident on the photocathode causes photoemission of short, dense bunches of electrons, which are then accelerated into a relativistic, high quality beam. Future free electron lasers demand reliable photocathodes with long-lived quantum efficiency at suitable drive laser wavelengths to maintain high current density. But faced with contamination, heating, and ion back-bombardment, the highest efficiency photocathodes find their delicate cesium-based coatings inexorably lost. In answer, the work herein presents careful, focused studies on cesium-based photocathodes, particularly motivated by the cesium dispenser photocathode. This is a novel device comprised of an efficiently photoemissive, cesium-based coating deposited onto a porous sintered tungsten substrate, beneath which is a reservoir of elemental cesium. Under controlled heating cesium diffuses from the reservoir through the porous substrate and across the surface to replace cesium lost to harsh conditions---recently shown to significantly extend the lifetime of cesium-coated metal cathodes. This work first reports experiments on coated metals to validate and refine an advanced theory of photoemission already finding application in beam simulation codes. Second, it describes a new theory of photoemission from much higher quantum efficiency cesium-based semiconductors and verifies its predictions with independent experiment. Third, it investigates causes of cesium loss from both coated metal and semiconductor photocathodes and reports remarkable rejuvenation of full quantum efficiency for contaminated cesium-coated surfaces, affirming the dispenser prescription of cesium resupply. And fourth, it details continued advances in cesium dispenser design with much-improved operating characteristics: lower temperature

  9. Characterizing optical dipole trap via fluorescence of trapped cesium atoms

    Institute of Scientific and Technical Information of China (English)

    LIU; Tao; GENG; Tao; YAN; Shubin; LI; Gang; ZHANG; Jing; WANG; Junmin; PENG; Kunchi; ZHANG; Tiancai


    Optical dipole trap (ODT) is becoming an important tool of manipulating neutral atoms. In this paper ODT is realized with a far-off resonant laser beam strongly focused in the magneto-optical trap (MOT) of cesium atoms. The light shift is measured by simply monitoring the fluorescence of the atoms in the magneto-optical trap and the optical dipole trap simultaneously. The advantages of our experimental scheme are discussed, and the effect of the beam waist and power on the potential of dipole trap as well as heating rate is analyzed.

  10. Cesium fallout in Norway after the Chernobyl accident

    International Nuclear Information System (INIS)

    Results of country-wide measurements of 137Cs and 134 Cs in soil samples in Norway after the Chernobyl accident are reported. The results clearly demonstrates that municipalities in the central part of southern Norway, Troendelag and the southern part of Nordland, have been rather heavily contaminated. The total fallout of 137Cs and 134Cs from the Chernobyl accident in Norway is estimated to 2300 TBq and 1200 TBq, respectively. This is approximately 6% of the cesium activity released from the reactor

  11. Sensitive Detection of Cold Cesium Molecules by Radiative Feshbach Spectroscopy


    Chin, Cheng; Kerman, Andrew J.; Vuletić, Vladan; Chu, Steven


    We observe the dynamic formation of $Cs_2$ molecules near Feshbach resonances in a cold sample of atomic cesium using an external probe beam. This method is 300 times more sensitive than previous atomic collision rate methods, and allows us to detect more than 20 weakly-coupled molecular states, with collisional formation cross sections as small as $\\sigma =3\\times 10^{-16}$cm$^2$. We propose a model to describe the atom-molecule coupling, and estimate that more than $2 \\times 10^5$ $Cs_2$ mo...

  12. Specific heat and thermodynamic properties of the cesium perchlorate

    International Nuclear Information System (INIS)

    The cesium perchlorate specific heat has been measured in a vacuum adiabatic microcalorimeter in the 10-365 K range. On the basis of the data obtained the thermodynamic functions are calculated. Csub(p)sup(0) (298.15 K) = 110.4+-0.2 J/Kxmol; S0 (298.15 K)=175.9+-0.5 J/Kxmol; H0 (298.15 K) - H0(0)=22280+-50 J/mol; - [G0 (289.15 K) - H0(0)]/T = 101.2+-0.2 J/Kxmol

  13. Equilibrium and kinetic studies of the sorption of cesium by potassium nickel hexacyanoferrate complex

    International Nuclear Information System (INIS)

    Sorption of cesium from nitric acid medium by potassium nickel hexacyanoferrate, KNiFC, was investigated using the batch technique. The effect of hydrogen ion concentration on the distribution coefficient of cesium has been studied in the pH range 1-5.5. The effect of particle size, the temperature on the sorption equilibrium and rate of uptake of cesium were investigated. The temperature effect on both sorption equilibrium and rate of uptake was found to be limited. The kinetic study shows that the sorption is controlled by particle diffusion mechanism. The diffusivity of cesium ions into different particle sizes of KNiFC, the activation energy, and the entropy change of the sorption process were calculated. The effect of the presence of cobalt ions on the equilibrium and the rate of uptake of cesium is presented. (author)

  14. Rational Design of Cesium-Selective Ionophores and Chemosensors: Dihydrocalix[4]arene Crown-6 Ethers

    Energy Technology Data Exchange (ETDEWEB)

    Sachleben, Richard A.; Bryan, Jeffrey C.; Brown, Gilbert M.; Engle, Nancy L.; Haverlock, Tamara J.; Hay, Benjamin P.; Urvoas, Agathe; Moyer, Bruce A.


    Molecular mechanics calculations performed on calix[4]arene crown-6 ethers predict that the 1,3-dihydro derivatives will exhibit greater complementarity for potassium and cesium ions than the parent 1,3-dialkoxy calix crowns. The X-ray crystal structures of 1,3-alt bis-octyloxycalix[4]arene benzocrown-6 ether, dihydrocalix[4]arene benzocrown-6 ether, and the cesium nitrate complex of dihydrocalix[4]arene benzocrown-6 ether were determined. The cesium complex structure corresponds closely to the structure predicted by molecular mechanics. The dihydrocalix[4]arene crown-6 ethers exhibit enhanced cesium selectivity in the extraction of alkali metal salts and provide a platform for a highly sensitive and selective cesium chemosensor.

  15. Investigation of the behavior during incineration of cesium adsorbed in vegetation waste

    International Nuclear Information System (INIS)

    The decontamination of wood and grass contaminated by radioactive cesium released after a nuclear power plant accident is a significant problem. During this research, the behavior of radioactive cesium during incineration was investigated experimentally. Non-radioactive cesium chloride was adsorbed into sunflower and wood pellet samples, and was burned in a lab-scale fluidized bed combustor. Up to 70% of the cesium was transferred to fly ash, which is captured in the quartz filter of the exhaust line. The concentration of cesium in the fly ash is 10 times greater than in the bottom ash, as the amount of fly ash makes up approximately 20% of the entire ash content. Careful management is vital when handling and disposing of fly ash generated from the incineration of vegetation waste. (author)

  16. Analysis of CD117-negative gastrointestinal stromal tumors

    Institute of Scientific and Technical Information of China (English)

    Chin-Yuan Tzen; Bey-Liing Mau


    AIM: To identify the gastrointestinal stromal tumors(GISTs) that are negative for CD117 expression by immunohistochemistry and to characterize their malignant potential.METHODS: A total of 108 primary mesenchymal tumors of the gastrointestinal tract were screened to select CD117-negative tumors, from which KIT(exons 9, 11, 13, and 17)and PDGFRA (exons 10, 12, 14, and 18) were sequenced to identify GISTs. Tumor recurrence and distant metastasis were used as the criteria of malignancy.RESULTS: The result showed that approximately 25%(29/108) of the gastrointestinal mesenchymal tumors were negative for CD117 and approximately 6% (7/108)of the tumors were CD117-negative GISTs. All these CD117-negative tumors had a mutated KITand a wildtype PDGFRA. All CD117-negative GISTs with mutations at codons 557/558 of KIThad mitotic counts >10/50 high power field, and 75% (3/4) of them showed multiple recurrence or distant metastasis.CONCLUSION: CD1 17-negative KITmutated GISTs account for approximately 6% of the gastrointestinal mesenchymal tumors. Tumor recurrence or distant metastasis correlates to both theKITmutations at codons 557/558 and the mitotic counts, but not to the tumor size.

  17. Photo-association of cold cesium atoms. Formation and characterisation of a cold cloud of diatomic cesium molecules

    International Nuclear Information System (INIS)

    In a photo-association process, two colliding cold cesium atoms absorb one photon to form an ultracold molecule, electronically excited in a well defined ro-vibration level. Because of the small initial kinetic energy of the free atoms, the photo-association is resonant and permits high resolution spectroscopy of long-range states. We report spectra for states correlated to the excited limit 6S+6P. The 1u (6S+6P3/2) state is a pure long-range molecules. It hardly consists in a molecule, but rather in a pair of two atoms linked at 1, 5 nm by the multipolar electrostatic interaction. The intensity modulation of spectral lines for a given vibrational progression reflects the nodal structure of the radial s-wave function of two ground state atoms. The photo-association of the state 0g-(6S +6P3/2) of polarized atoms permits determining the scattering length of the triplet state of cesium (aT = -530 a0) and the Van der Waals parameter of the molecular ground state (C6 = 6510 u.a.). Photo-association of cold cesium atoms also leads to the formation of translationally cold molecules in singlet and triplet fundamental states after spontaneous emission of the excited molecules. Various schemes are characterized. The particular double-well shape of 0g-(6S+6P3/2) and 1u(6S+6P3/2) states creates a Condon point at intermediate distance. These states constitute ideal cases for very efficient formation of cold molecules. The cold molecular cloud is analyzed: temperatures as low as 20 micro-Kelvin are measured and the distribution of the ro-vibrational levels is studied. The efficiencies of the photo-association process and of the formation of cold molecules are measured, and compared with theoretical calculations. (author)

  18. Transportable cesium irradiator (TPCI): Final safety analysis report: Revision 1

    International Nuclear Information System (INIS)

    This Final Safety Analysis Report describes the Transportable Cesium Irradiator (TPCI) and assesses the hazards associated with its operation. The TPCI consists of a mobile, lead-shielded, irradiation unit with support equipment mounted within an enclosed trailer. The irradiation unit has two basic compartments; a source chamber sized to mate with the transportation cask which houses the source capsules, and an irradiation chamber formed as a large shielded cylinder (drum) with a window. The irradiation chamber is mounted on a large diameter support bearing. As this chamber is rotated its window moves from the product access door, where produce is inserted or extracted, to a position in line with a similar window in the source chamber. When the windows are aligned the produce is irradiated, while the back wall of the irradiation chamber shields the product access door. The TPCI is designed to be transported throughout the continental United States. The transportation cask containing the cesium source capsules is transported separately from the irradiation unit and is installed when the TPCI unit has been readied for operation at a particular site. The transportation cask is a separate unit and is documented in a separate FSAR

  19. Morphological and electrical properties of zirconium vanadate doped with cesium

    Directory of Open Access Journals (Sweden)

    Marwa F. Elkady


    Full Text Available Cesium doped zirconium vanadate ZrV2O7 with different Cs dopant content (Cs/Zr varied from 0 to 0.5 in weight ratio were fabricated by hydrothermal technique at 120 °C for 60 min. The synthesized materials are thermally treated using microwave technique. The structural and morphological properties of the synthesized materials and thermally treated samples were investigated using XRD and SEM respectively. It was evident that all synthesized specimens have cubic phase structural without any extra phase but after heat treatment Orthorhombic phase appear with doped samples. However, the morphological structure of the doped synthesized materials has transferred from nanoparticles into rods aspect with heat treatment for the different dopant ratio. Moreover, the electrical properties of both the synthesized and thermally treated materials are studied by AC impedance measurements. The results indicated that the ionic conductivity of Cs-doped ZrV2O7 materials decreased by increasing the dopant ratio while that thermally treated samples the ionic conductivity increase by increasing the dopant ratio. Finally, the concentration of cesium dopants is found to play crucial role in tuning the morphology and electrical properties of nanostructures.

  20. A study of strontium and cesium sorption on granite

    International Nuclear Information System (INIS)

    The diffusion and sorption of cesium and strontium in crushed granite particles is discussed. Sorption experiments have been performed with one granite from Finnsjoen outside Forsmark on the east coast of Sweden and one granite from the Stripa mine in central Sweden. Granite samples have been crushed and screened, and six different particle size fractions from 0.10-0.12 mm to 4-5 mm of each rock have been used in the experiments. The initial concentrations of inactive cesium and strontium were 10-15 ppm. The experimental data indicate that the amount of sorption is dependent not only on the mass of granite particles, but also to some extent on the size of the particles. An attempt has been made to distinguish between sorption on external surfaces and inner surfaces. The amount of external surface adsorption was found to vary from 15-40 % of the total adsorption capacity for the particle size fraction 0.10-0.12 mm to a few percent or less for the largest particles used. (Auth.)

  1. Kelvin probe studies of cesium telluride photocathode for AWA photoinjector

    International Nuclear Information System (INIS)

    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (≈50nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating. -- Highlights: ► The correlation between Quantum Efficiency (QE) and work function. ► How QE and work function evolve together. ► Rejuvenation of the photocathode via heating and the effect on work function. ► The effects on the work function due to exposure to UV light

  2. Radiation doses resulting from incorporated radioactive cesium isotopes

    International Nuclear Information System (INIS)

    Age-dependent dose factors are given for inhaled or ingested cesium isotopes, which have been calculated on the basis of published data on the biokinetics of cesium in the human organism. Tabulated data are presented for Cs-129, Cs-130, Cs-131, Cs-132, Cs-134, Cs-135, Cs-136, Cs-137(+Ba-137m), and Cs-138. Comparison of results obtained for adults with relevant data published by the ICRP (1978), the NCRP (1977), and Schwarz (1982) shows very good agreement. More significant deviations are however found when comparing the results with data given in the Federal German Radiation Protection Ordinance, both with regard to adults and to infants, particularly refering to the lung data and to those for the gastro-intestinal tract and the skeleton. These discrepancies are primarily due to improved models developed since the time the Radiation Protection Ordinance has been issued, (respiratory and gastro-intestinal tracts), and to improvements achieved with the dosimetric concepts (calculation of dose for bone surfaces instead of the whole skeleton). The dose factors for newborn given by the publication in hand are significantly lower than those given in the Ordinance (for infants); this is a result of age-dependent retention functions having been considered for this publication. The reliability of the dose factor calculations for various ages, pregnant women and fetuses is discussed and quantified. (orig./HP)

  3. Kelvin probe studies of cesium telluride photocathode for AWA photoinjector

    Energy Technology Data Exchange (ETDEWEB)

    Wisniewski, Eric E., E-mail: [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Velazquez, Daniel [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Yusof, Zikri, E-mail: [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Spentzouris, Linda; Terry, Jeff [Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Sarkar, Tapash J. [Rice University, 6100 Main, Houston, TX 77005 (United States); Harkay, Katherine [Accelerator Science Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States)


    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (≈50nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating. -- Highlights: ► The correlation between Quantum Efficiency (QE) and work function. ► How QE and work function evolve together. ► Rejuvenation of the photocathode via heating and the effect on work function. ► The effects on the work function due to exposure to UV light.

  4. Studies on cesium sorption in hydrous zirconium and titanium oxides

    International Nuclear Information System (INIS)

    Significant quantities of 137Cs (T1/2 = 30.1 y) and 90Sr (T1/2 = 28.5 y) are produced as fission products in nuclear reactors. These long-lived gamma-emitting radionuclides, regarded as a waste few decades ago, are being termed now as valuables owing to the upsurge in the utilization of these radioisotopes in the area of medicine, food irradiation, and sewage treatment technologies in recent years. For long-term waste management it is necessary to minimize the volume and toxicity of the waste. Selective recovery and utilization of these radionuclides from the waste is the concept of growing interest to many researchers. Inorganic sorbents are proven candidates for the separation and recovery of cesium and strontium from aqueous waste streams. They are chemically durable and stable against ionizing radiation. In addition, these materials can be converted into unleachable ceramic form for final disposal. Hydrous metal oxides belong to a particular class of inorganic ion exchangers extensively investigated for various applications in nuclear waste treatment. The present study deals with the preparation of hydrous zirconium and titanium oxide and the studies aimed at separation of cesium from aqueous wastes

  5. Spectrally selective optical pumping in Doppler-broadened cesium atoms

    Institute of Scientific and Technical Information of China (English)

    Zhang Jun-Hai; Zeng Xian-Jin; Li Qing-Meng; Huang Qiang; Sun Wei-Min


    The D1 line spectrally selective pumping process in Doppler-broadened cesium is analyzed by solving the optical Bloch equations.The process,described by a three-level model with the A scheme,shows that the saturation intensity of broadened atoms is three orders of magnitude larger than that of resting atoms.The |Fg =3> → |Fe-4> resonance pumping can result in the ground state |Fg =4,mF =4> sublevel having a maximum population of 0.157 and the population difference would be about 0.01 in two adjacent magnetic sublevels of the hyperfine (HF) state Fg =4.To enhance the anisotropy in the ground state,we suggest employing dichromatic optical HF pumping by adding a laser to excite D1 line |Fg =4> → |Fe =3>transition,in which the cesium magnetometer sensitivity increases by half a magnitude and is unaffected by the nonlinear Zeeman effect even in Earth's average magnetic field.

  6. Diffusion of strontium, technetium, iodine and cesium in granitic rock

    International Nuclear Information System (INIS)

    The migration of strontium, technetium, iodine and cesium in granitic rock has been studied. Rock samples were taken from drilling cores in granitic and granodioritic rock, and small (2x2x2 cm) rock tablets from the drilling cores were exposed to a groundwater solution containing one of the studied elements at trace levels. The concentration of the element versus penetration depth in the rock tablet was measured radiometrically. The sorption on the mineral faces and the diffusion into the rock were studied by an autoradiographic technique. The cationic strontium and cesium have apparent diffusivities of 10-13 - 10-14 m2/s. The migration is confined to microfissures or filled fractures containing e.g., calcite, epidote or chlorite or in veins with high capacity minerals (e.g. biotite). The anionic iodine and technetium have apparent diffusivities of about 10-14 m2/s. These species migrate along mineral boundaries and in open fractures and to a minor extent in high capacity mineral veins. (orig.)

  7. Mobility of radioactive cesium in soil originated from the Fukushima Daiichi nuclear disaster. Application of extraction experiments

    International Nuclear Information System (INIS)

    Extraction experiments on soil radioactively contaminated by the Fukushima Daiichi Nuclear Power Plant accident were conducted by using a variety of extractants to acquire knowledge on the mobility of radioactive cesium in soil. The experimental results revealed that cesium is tightly bound with soil particles and that radioactive cesium newly deposited on soil due to the accident had apparently a higher mobility than stable cesium commonly existing in soil. The results suggested that radioactive cesium deposited on soil hardly migrates via aqueous processes, although chemical and mineralogical conditions of soil affect their mobility. (author)

  8. Thermoemission and adsorption properties of diborides of transition metals of IV-V groups in cesium vapours

    International Nuclear Information System (INIS)

    Emission and adsorption properties of titanium, zirconium, hafnium, vanadium diborides were studied in vacuum and cesium vapours. Some regularities were established in changes of thermoemission properties in transition from one boride to another. Under pressures p0K interaction of these diborides with cesium plasma is of adsorption character. Evaluation of absorption properties for the diborides in cesium vapours showed for oprimal surface coating with cesium the adsorption energy for cesium ions is qsub(a)=(1.1/1.3) eV and work function is phi sub(min)=(1.25/1.45) eV

  9. Uroradiology in 117 year history of radiology

    International Nuclear Information System (INIS)

    contrast ultrasound, angioplasty, as the title is an expression of respect and reverence for explorers and those expanding on this momentous discoveries. As a natural continuation is the fourth stage, from 1980 to the present day, entitled ‘Fathers and Children’. Like the clash of different generations, are also clash with modern conventional radiology imaging (radiology). Precisely massive introduction and improvement of ultrasound, computed tomography and magnetic resonance lead to a fundamentally different approach in the current generation of radiologists, which in many cases is at the expense of a conventional radiology. Discussion: On the development of uroradiology in Bulgaria affect two factors - an institution and a person. The institution is ISUL (now University Hospital ‘Tsaritsa Yoanna – ISUL’) , founded in 1949 and disbanded in the early 80s, and person is his first rector and head of the Department of Radiology Professor Gotze Tenchov, the founder of Modern Radiology in Bulgaria. Thanks to enthusiasm and aspirations of its employees and their followers over the years, although some delay we can now report that uroradiology in Bulgaria corresponds to a satisfactory advanced level. Conclusion: Uroradiology, running forward, shows 117 years of development, passing through three centuries. Looking back, we ask the question - where is the boundary, is there a limit in development? The answer is in the future

  10. Fast concentration of dissolved forms of cesium radioisotopes from large seawater samples

    International Nuclear Information System (INIS)

    The method developed for cesium concentration from large freshwater samples was tested and adapted for analysis of cesium radionuclides in seawater. Concentration of dissolved forms of cesium in large seawater samples (about 100 L) was performed using composite absorbers AMP-PAN and KNiFC-PAN with ammonium molybdophosphate and potassium–nickel hexacyanoferrate(II) as active components, respectively, and polyacrylonitrile as a binding polymer. A specially designed chromatography column with bed volume (BV) 25 mL allowed fast flow rates of seawater (up to 1,200 BV h-1). The recovery yields were determined by ICP-MS analysis of stable cesium added to seawater sample. Both absorbers proved usability for cesium concentration from large seawater samples. KNiFC-PAN material was slightly more effective in cesium concentration from acidified seawater (recovery yield around 93 % for 700 BV h-1). This material showed similar efficiency in cesium concentration also from natural seawater. The activity concentrations of 137Cs determined in seawater from the central Pacific Ocean were 1.5 ± 0.1 and 1.4 ± 0.1 Bq m-3 for an offshore (January 2012) and a coastal (February 2012) locality, respectively, 134Cs activities were below detection limit (-3). (author)

  11. Development of cesium trapper and single-gas-bubble injector into sodium pool

    International Nuclear Information System (INIS)

    On the core disruptive accident in the sodium cooled fast breeder reactor, in fuel pins the cesium fission product with a high hazard is transferred to the sodium coolant together with noble gas including fission product, and the cesium accumulates on the cover gas area because of its low migration rate to sodium. The high temperature and high pressure in the cover gas due to the decay heat of fission products including cesium cause the leakage of cesium to the outside of reactor vessel. However the exact migration rate of cesium to sodium has not been reported because of difficulty on the evaluation of the interfacial area of large gas bubble (Minges et al., 1986). In this study, we developed a cesium trapper composed of β”-alumina cylindrical container and a single-gas-bubble injector without wettability. We confirmed that a single argon gas bubble was steadily produced in our injector. Bhaga proposed the bubble shape region map, which correlates the bubble shape with Reynolds number, Eotvos number and Morton number of the bubble ejected into sodium pool. The bubble shapes were estimated to be always ellipsoidal. We could successfully confirmed that the liquid sodium can be separated from liquid sodium cesium mixture by using β”-alumina, whose separation rate was found to be calculated by the Faraday's law of electrolysis. (author)

  12. Cesium-plasma-conductivity enhancement in the advanced thermionic energy converter. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Manikopoulos, C.N.

    Two methods of plasma conductivity enhancement in a cesium vapor thermionic energy converter have been studied. The first involved resonance photoabsorption of several cesium lines and the second utilized cesium plasma sustenance by application of microwave power. An extensive study of ionization processes in a cesium discharge in the presence of resonance ionization was made. Calculations were made of expected percentage excitation levels for several cesium resonance transitions for different values of neutral density and temperature as well as incident radiation power levels. The results of some of these computations were tabulated. Several ionization schemes were considered. A number of cesium transitions were investigated in the range of 799 to 870 nanometers for four different cesium reservoir temperatures, 467, 511, 550 and 591 K. The related absorption coefficients of the radiation lines in the plasma were deduced and tabulated. The resulting plasma conductivity increase was recorded and the associated ionization enhancement was deduced. A microwave cavity was built where the emitter and collector of a simple thermionic converter made up two of the cavity walls and resonant microwave power was externally applied. The I-V characteristics of the thermionic converter were studied under several microwave power levels in the range of 0 to 2 watts. Significant shifts to higher currents were observed as the microwave power levels were raised. In conclusion, both methods show promise as auxiliary ionization mechanisms for the thermionic energy converter, especially at low emitter temperatures.

  13. Cesium-plasma-conductivity enhancement in the advanced thermionic energy converter. Final report

    International Nuclear Information System (INIS)

    Two methods of plasma conductivity enhancement in a cesium vapor thermionic energy converter have been studied. The first involved resonance photoabsorption of several cesium lines and the second utilized cesium plasma sustenance by application of microwave power. An extensive study of ionization processes in a cesium discharge in the presence of resonance ionization was made. Calculations were made of expected percentage excitation levels for several cesium resonance transitions for different values of neutral density and temperature as well as incident radiation power levels. The results of some of these computations were tabulated. Several ionization schemes were considered. A number of cesium transitions were investigated in the range of 799 to 870 nanometers for four different cesium reservoir temperatures, 467, 511, 550 and 591 K. The related absorption coefficients of the radiation lines in the plasma were deduced and tabulated. The resulting plasma conductivity increase was recorded and the associated ionization enhancement was deduced. A microwave cavity was built where the emitter and collector of a simple thermionic converter made up two of the cavity walls and resonant microwave power was externally applied. The I-V characteristics of the thermionic converter were studied under several microwave power levels in the range of 0 to 2 watts. Significant shifts to higher currents were observed as the microwave power levels were raised. In conclusion, both methods show promise as auxiliary ionization mechanisms for the thermionic energy converter, especially at low emitter temperatures

  14. Equilibrium, kinetic and thermodynamic study of cesium adsorption onto nanocrystalline mordenite from high-salt solution. (United States)

    Lee, Keun-Young; Park, Minsung; Kim, Jimin; Oh, Maengkyo; Lee, Eil-Hee; Kim, Kwang-Wook; Chung, Dong-Yong; Moon, Jei-Kwon


    In this study, the equilibrium, kinetics and thermodynamics of cesium adsorption by nanocrystalline mordenite were investigated under cesium contamination with high-salt solution, simulating the case of an operation and decommissioning of nuclear facilities or an accident during the processes. The adsorption rate constants were determined using a pseudo second-order kinetic model. The kinetic results strongly demonstrated that the cesium adsorption rate of nano mordenite is extremely fast, even in a high-salt solution, and much faster than that of micro mordenite. In the equilibrium study, the Langmuir isotherm model fit the cesium adsorption data of nano mordenite better than the Freundlich model, which suggests that cesium adsorption onto nano mordenite is a monolayer homogeneous adsorption process. The obtained thermodynamic parameters indicated that the adsorption involved a very stable chemical reaction. In particular, the combination of rapid particle dispersion and rapid cesium adsorption of the nano mordenite in the solution resulted in a rapid and effective process for cesium removal without stirring, which may offer great advantages for low energy consumption and simple operation. PMID:26683820

  15. Vitrification of spent organic ion exchange resins- 137Cesium volatility during oxidation

    International Nuclear Information System (INIS)

    Organic ion exchange (IX) resins are used to purify coolant water in nuclear power plants. The spent IX resins contain 137Cesium as major long-lived radioisotope. Their vitrification requires complete combustion of organic matter. 137Cesium volatility during their oxidation is most important factor for selection of oxidation procedure. Based on TGA studies, copper and vanadate catalysts were selected respectively for cationic and anionic IX resins to oxidise them at 500-700 degC. Experiments were conducted with 137Cesium and catalyst loaded cationic and anionic resins. About 56 to 60% 137Cesium was released from cationic resins in 3 hours. 137Cesium release from cationic resins could be brought down to 19 to 22% by addition of glass formers. The 137Cesium releases from anionic resins were nearly same for 2 hours heating. In absence of glass formers, the catalyst on anionic resins formed molten mass, which was difficult to remove. Experiment with one litre of 137Cesiuin loaded mixed cationic and anionic resins released 16.8% 137Cesium to off gases and formed a slag having specific gravity of 1.73 due to difficulty in oxidising last traces of carbon. The volume reduction factor achieved was 18.2 as against 68 expected for complete oxidation of IX resins. The higher volume reduction factor can be achieved by using improved oxidation procedure in scaling up studies. (author)

  16. possibilities of isotope separation of radioactive cesium by ion cyclotron resonance

    International Nuclear Information System (INIS)

    The transmutation of radioactive wastes is of high interest in order to reduce as much as possible the difficulties induced by their storage. In the case of radioactive cesium waste, cesium 137 which presents a short life time (30 years) is difficult to handle due to its high thermal load and and radiation level; cesium 135 is a long life time isotope with high mobility in storage glasses. As the processes of transmutation are different for cesium 135 and cesium 137 and as the neutron consumption is very high, it would be necessary to proceed to a preliminary isotope separation and it would not be worth to transmute the stable 133 isotope of cesium. Peculiar problems linked with cesium physico-chemical properties such as ionisation rat, vapour pressure, cooling of the components of the separation elements, especially the collector part, are discussed. It is shown that a high density plasma (1012 cm -3), with low ionic temperature (1 eV), good for isotope separation, can be achieved easily. It must be noticed that the cooling with water has to be avoided due to chemical reactions. After having defined the unitary separative element, different enrichment strategies and arrangements of the separative elements are proposed. An economic estimation with our code RICAN is given. (author)

  17. A New Pumping-Probing Scheme for the Optically Pumped Cesium Beam Frequency Standard

    Institute of Scientific and Technical Information of China (English)

    陈景标; 朱程锦; 王凤芝; 杨东海


    A new pumping-probing scheme for the optically pumped cesium beam frequency standard has been experimentally tested in our laboratory. The stability of the optically pumped cesium beam frequency standard was measured by comparing its 10 MHz output with an HP5071A commercial cesium atomic clock. The result shows that the frequency stability for the 1 s and 30000s sample times are 1.2 × 10-11 and 3.7 × 10-13, respectively. It was proved that the new pumping scheme works well.

  18. A new ion exchanger for the removal of cesium from aqueous solutions

    International Nuclear Information System (INIS)

    A new exchange potassium copper nickel hexacyanoferrates(II) was prepared. It was characterized by chemical composition and surface area measurements. The removal of cesium from aqueous solution by ion exchange was studied as function of shaking time. pH and concentration of acids, salts and cesium. The data indicates high value of distribution coefficient over a wide range of pH, nitric and hydrochloric acids concentration and in the presence of higher concentration of Na and K ions. A potassium copper nickel hexacyanoferrate(II) column was also tested for elution of cesium using 8 M ammonium nitrate solution. (author)

  19. Application of Cesium isotopes in daily life; Aplicacoes dos isotopos do Cesio no cotidiano

    Energy Technology Data Exchange (ETDEWEB)

    Jordao, B.O.; Quaresma, D.S.; Carvalho, R.J., E-mail:, E-mail:, E-mail: [Observatorio Nacional (ON/LPTF), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Tempo e Frequencia; Peixoto, J.G.P., E-mail: [Instituto de Radioprotecao e Dosimetria, (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. de Metrologia das Radiacoes Ionizantes


    In the world of science, the desire of the scientific community to discover new chemical elements is crucial for the development of new technologies in various fields of knowledge. And the main chemical element addressed by this article is Cesium, but specifically {sup 133}Cesium isotope and radioisotope {sup 137}Cesium, exemplifying their physical and chemical characteristics, and their applications. This article will also show how these isotopes have provided researchers a breakthrough in the field of radiological medicine and in time and frequency metrology. (author)

  20. Cesium leaching from {gamma}-irradiated CsA and CsX zeolites

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Enrique [Universidad Autonoma Metropolitana, Iztapalapa, A. P. 55-532, Av. San Rafael Atlixco No. 186 Col. Vicentina, 09340 Mexico, D.F. (Mexico)], E-mail:; Ibarra, Ilich A.; Lara, Victor [Universidad Autonoma Metropolitana, Iztapalapa, A. P. 55-532, Av. San Rafael Atlixco No. 186 Col. Vicentina, 09340 Mexico, D.F. (Mexico); Bosch, Pedro [Instituto de Investigaciones en Materiales, A. P. 70-360, Universidad Nacional Autonoma de Mexico, Circuito Exterior, Ciudad Universitaria, 04510 Mexico, D.F. (Mexico); Bulbulian, Silvia [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, Col. Escandon, Delegacion Miguel Hidalgo, 11801 Mexico, D.F. (Mexico)


    The present study discusses the effect of {gamma}-irradiation on Cs{sup +}-exchanged X and A zeolites. The incorporation of Cs{sup +} ions into A and X zeolites was performed using three different cesium salts (chloride, nitrate or acetate). Cs{sup +} ions immobilized into the vitrified zeolites by thermal treatment are located in different sites of the zeolite networks. It is found that {gamma}-irradiation favors cesium retention depending on the cesium precursor salt used in the cationic exchange step.

  1. Specific interaction of cesium with the surface of calcium silicate hydrates

    International Nuclear Information System (INIS)

    The sorption of cesium at the calcium silicate hydrates (CSH) surface was investigated, both through sorption isotherm data and by solid-state NMR experiments. The sorption ability of CSH towards cesium is favored for low solid Ca/Si molar ratios, in agreement with the negative surface charge they develop then. A significant proportion of these sorbed cesium cations remains tightly bound to the surface sites forming, in dehydrated CSH, inner-sphere complexes, which can not be removed by alcohol washing. Chloride seems to present a lower affinity for CSH, even for high Ca/Si molar ratios, where the surface charge becomes positive. (orig.)

  2. First-principles study of cesium adsorption to weathered micaceous clay minerals (United States)

    Okumura, Masahiko; Nakamura, Hiroki; Machida, Masahiko


    A large amount of radioactive nuclides was produced into environment due to the Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident. Residents near FDNPP were suffering from radioactive cesium and then evacuated, because which has long half-life and is retained by surface soil for long time. The Japanese government has been decontaminating the cesium by removing the surface soil in order to return them to their home. This decontamination method is very effective, but which produces huge amount of waste soil. This becomes another big problem in Fukushima, because it is not easy to find large storage sites. Then effective and economical methods to reduce the volume of the waste soil are needed. However, it has not been invented yet. One of the reasons is lack of knowledge about microscopic process of adsorption/desorption of cesium to/from soil. It is known that weathered micaceous clay minerals play crucial role on adsorption and retention of cesium. They are expected to have special sorption sites, called frayed edge sites (FESs), which adsorb cesium selectively and irreversibly. Properties of FES have been intensely investigated by experiments. But microscopic details of the adsorption process on FES are still unclear. Because direct observation of the process with current experimental techniques is quite difficult. We investigated the adsorption of cesium to FES in muscovite, which is a typical micaceous clay mineral, via first-principles calculations (density functional theory). We made a minimal model of FES and evaluate the energy difference before and after cesium adsorption to FES. This is the first numerical modeling of FES. It was shown that FES does adsorb cesium if the weathering of muscovite has been weathered. In addition, we revealed the mechanism of cesium adsorption to FES, which is competition between ion radius of cesium and the degree of weathering. I plan to discuss volume reduction of the waste soil based on our result. Reference M. Okumura

  3. High voltage holding in the negative ion sources with cesium deposition

    Energy Technology Data Exchange (ETDEWEB)

    Belchenko, Yu.; Abdrashitov, G.; Ivanov, A.; Sanin, A.; Sotnikov, O., E-mail: [Budker Institute of Nuclear Physics, Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation)


    High voltage holding of the large surface-plasma negative ion source with cesium deposition was studied. It was found that heating of ion-optical system electrodes to temperature >100 °C facilitates the source conditioning by high voltage pulses in vacuum and by beam shots. The procedure of electrode conditioning and the data on high-voltage holding in the negative ion source with small cesium seed are described. The mechanism of high voltage holding improvement by depletion of cesium coverage is discussed.

  4. Test procedures and instructions for single shell tank saltcake cesium removal with crystalline silicotitanate

    Energy Technology Data Exchange (ETDEWEB)

    Duncan, J.B.


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Single Shell Tank Saltcake from tanks 24 t -BY- I 10, 24 1 -U- 108, 24 1 -U- 109, 24 1 -A- I 0 1, and 24 t - S-102, in a bench-scale column. The cesium sorbent to be tested is crystalline siticotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-024, Hanford Single Shell Tank Saltcake Cesium Removal Test Plan.

  5. Increasing the Space Charge Limit and Other Effects of Cesium Seeding in Hydrogen Negative Ion Sources

    International Nuclear Information System (INIS)

    The role of cesium seeding in increasing the negative ion current in volume sources is described. By a reduction in the local plasma potential the current of extracted electrons is vastly reduced. As a result, cesium increases the fraction of the transverse space charge limit available to the ions by as much as a factor of three. In addition, cesium can increase the total space charge limit by injection of Cs+ into the presheath-a newly recognized phenomenon consistent with experimental measurements and determined from application of a Double-Vlasov model for negative ion extraction

  6. Investigation of adsorption and wetting of 3He on cesium and cesiated glass

    International Nuclear Information System (INIS)

    Experiments have been carried out to investigate the binding of 3He on cesium substrates, using optical pumping to spin-polarize the atoms. The behavior of 3He on the walls at low temperature can be analyzed through the evolution of the nuclear magnetization of the sample. Preliminary results are presented, including: (1) adsorption studies of gaseous 3He on cesiated glass; (2) magnetic relaxation time of polarized liquid 3He on cesium and cesiated glass; (3) evidence for wetting of liquid 3He on cesium. 8 refs., 2 figs

  7. Preparation and characteristics of 117mSn-HEDTMP

    Institute of Scientific and Technical Information of China (English)


    Tin-117m(t1/2 14d; γ 159keV, 86%) is an ideal tracer for studyingbiological behavior of tin compounds as well as for developing clinically-useful radio-pharmaceuticals. It had been reported that Sn-117m[4+] DTPA has unexpectedlyhigh bone uptake and bone-to-blood ratio, and is potentially useful as an agent forskeletal scintigraphy and radiotherapy of bone tumors. In this work, HEDTMP [N-(2-hydroxyethyl) ethlenediamine-1,1,2-tri (methylene phosphonic acid)] was synthesized.Let it form complex with 117mSn. The formation conditions, stability and distributioncoefficient between oil and water of the complex were investigated.``

  8. Determinations of cesium-134, cesium-137 and potassium-40 as a measure of intrauterine exposure to rays and contamination of human milk after the Chernobyl reactor accident

    International Nuclear Information System (INIS)

    In order to gain better insights into the degree of intrauterine exposure to rays after the Chernobyl reactor accident, placental measurements of the activity levels of cesium-134 and cesium-137 were carried out in 125 expectant mothers from the Munich area using four thallium-activated sodium iodine crystal detectors. The lower limit of detection determined for this technique was 1-2 bq/kg. Parallel tests were performed on human milk samples to establish their contents of cesium-137 and potassium-40. The ultrapure germanium detector used for this purpose measured levels down to a detection threshold of 1 bq/l. In a total of 13 placentae (10 %) and 56 milk samples (57%) the activity of cesium-137 was found to be so low as to preclude detection. The highest values measured were 18.6 bq/kg for the placentae and 10.6 bq/l for the milk samples. The activity concentrations of potassium-40 were frequently seen to exceed those of cesium-137, the highest value determined here being 73.6 bq/l. The author has come to the conclusion that the alleged increases in radiation levels remain within the range of variations generally expected to occur with natural radiation. Mothers are not discouraged from breast-feeding, even though their attention must be drawn to the fact that the rates of malignant diseases and genetic damage tend to rise on a global scale. (KST)

  9. Diffusion of water, cesium and neptunium in pores of rocks

    International Nuclear Information System (INIS)

    Teollisuuden Voima Oy (TVO) is investigating the feasibility to dispose of spent nuclear fuel within Finland. The present plan calls for the repository to be located in crystalline rock at a depth of several hundred meters. The safety assessment of the repository includes calculations of migration of waste nuclides. The flow of waste elements in groundwater will be retarded through sorption interaction with minerals and through diffusion into rock. Diffusion is the only mechanism retarding the migration of non-sorbing species and, it is expected to be the dominating retardation mechanism of many of the sorbing elements. In the investigation the simultaneous diffusion of tritiated water (HTO), cesium and neptunium in rocks of TVO investigation sites at Kivetty, Olkiluoto and Romuvaara were studied. (11 refs., 33 figs., 9 tabs.)

  10. Cesium-137 accident lessons in Goiania, Goias State, Brazil

    International Nuclear Information System (INIS)

    This document relates the experience obtained by several professionals which had an important role in the cesium-137 accident occurred in Goiania, Goias State, Brazil in September, 1987. It's divided into chapters, according to the action area - medical, nursing, social assistance, odontological and psychological. At first, some notions of radioprotection are explained, followed by the accident history and by the doctors and nurses action during the emergency phase and the medical, odontological, social and psychological assistance to the victims. The social assistance report shows some statistical data about the economic, occupational and social conditions of the accident victims. It is shown some information about the health institutions and the sanitary care in the ionizing radiation and about the occupational radiological protection in Goiania

  11. Coherence properties of nanofiber-trapped cesium atoms

    CERN Document Server

    Reitz, D; Mitsch, R; Schneeweiss, P; Rauschenbeutel, A


    We experimentally study the ground state coherence properties of cesium atoms in a nanofiber-based two-color dipole trap, localized 200 nm away from the fiber surface. Using microwave radiation to coherently drive the clock transition, we record Ramsey fringes as well as spin echo signals and infer a reversible dephasing time $T_2^\\ast=0.6$ ms and an irreversible dephasing time $T_2^\\prime=3.7$ ms. By theoretically modelling the signals, we find that, for our experimental parameters, $T_2^\\ast$ and $T_2^\\prime$ are limited by the finite initial temperature of the atomic ensemble and the heating rate, respectively. Our results represent a fundamental step towards establishing nanofiber-based traps for cold atoms as a building block in an optical fiber quantum network.

  12. Coherence Properties of Nanofiber-Trapped Cesium Atoms (United States)

    Reitz, D.; Sayrin, C.; Mitsch, R.; Schneeweiss, P.; Rauschenbeutel, A.


    We experimentally study the ground state coherence properties of cesium atoms in a nanofiber-based two-color dipole trap, localized ˜200nm away from the fiber surface. Using microwave radiation to coherently drive the clock transition, we record Ramsey fringes as well as spin echo signals and infer a reversible dephasing time of T2*=0.6ms and an irreversible dephasing time of T2'=3.7ms. By modeling the signals, we find that, for our experimental parameters, T2* and T2' are limited by the finite initial temperature of the atomic ensemble and the heating rate, respectively. Our results represent a fundamental step towards establishing nanofiber-based traps for cold atoms as a building block in an optical fiber quantum network.

  13. Trade study for the disposition of cesium and strontium capsules

    International Nuclear Information System (INIS)

    This trade study analyzes alternatives for the eventual disposal of cesium and strontium capsules currently stored at the Waste Encapsulation and Storage Facility as by-product. However, for purposes of this study, it is assumed that at some time in the future, the capsules will be declared high-level waste and therefore will require disposal at an offsite geologic repository. The study considered numerous alternatives and selected three for detailed analysis: (1) overpack and storage at high-level waste canister storage building, (2) overpack at the high-level waste vitrification facility followed by storage at a high-level waste canister storage building, and (3) blend capsule contents with other high-level waste feed streams and vitrify at the high-level waste vitrification facility

  14. Norbadione A: synthetic approach and cesium complexation studies

    International Nuclear Information System (INIS)

    This work was dedicated to the study of the synthesis and complexation studies of norbadione A: a pigment originating from a mushroom. A synthetic approach, based on a double Suzuki-Miyaura coupling, was developed. This strategy was applied with high yields to the synthesis of various norbadione A analogues, as well as to the synthesis of simple pulvinic acids. Access to functionalized precursors of the molecule was also studied and the final coupling remains to be done. Besides, a speciation study based on electro-spray ionization mass spectrometry was conducted with norbadione A and one of the analogues. This study allowed the assessment of the cesium complexation abilities of each molecule. Structural data was also obtained and complexation constants were calculated. Finally, norbadione A and various synthetic products have been tested via high-throughput screening methods and strong antioxidant properties were observed. Other biological results are also reported. (author)

  15. Comparative study of cesium adsorption on dioctahedral and trioctahedral smectites

    International Nuclear Information System (INIS)

    Bentonites which are characterized by good rheological, mineralogical and chemical stability is considered used as sealing barriers in multibarrier Slovak system of deep geological repository for high-level radioactive waste and spent nuclear fuel. In Slovak Republic there are several significant deposits of bentonite, which are characterized by appropriate adsorption properties and meet the geotechnical requirements for this type of barriers. Study of adsorption properties of bentonites and other smectites is an essential step for developing the migration model long-lived corrosion and activation products, and fission products of uranium. Nuclear wastes contain the most important nuclear fission products, radioisotopes 134Cs and 137Cs. The present paper investigates and compares the cesium adsorption properties of Slovak and North America bentonites composed mainly of dioctahedral smectite montmorillonite (J, L, SAz-1 and STx-1) and trioctahedral smectites saponite (SapCa-2) and hectorite (SHCa-1). (author)

  16. Quality assurance program plan for cesium legacy project

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides information on how the Quality Assurance Program is implemented for the Cesium Legacy Project. It applies to those items and tasks which affect the completion of activities identified in the work breakdown structure of the Project Management Plan (PMP). These activities include all aspects of cask transportation, project related operations within the 324 Building, and waste management as it relates to the specific activities of this project. General facility activities (i.e. 324 Building Operations, Central Waste Complex Operations, etc.) are covered in other appropriate QAPPs. The 324 Building is currently transitioning from being a Pacific Northwest National Laboratory (PNNL) managed facility to a B and W Hanford Company (BWHC) managed facility. During this transition process existing PNNL procedures and documents will be utilized until replaced by BWHC procedures and documents

  17. Quantitative analysis of cesium in synthetic lithium molten salts

    International Nuclear Information System (INIS)

    An analytical technique for fission products in lithium molten salts of spent PWR (Pressurized Water Reactor) fuels has been studied for the establishment of optimum chemical engineering process and the evaluation of process material balance in developing Direct Oxide Reduction Process with lithium metal. As part of the basic research, synthetic dissolver solutions of lithium chloride containing trace amounts of fission product elements (La, Ce, Pr, Nd, Sm, Eu, Gd, Y, Cs, Ru, Rh, Pd, Mo, Zr, Cd, Ba, Sr, Te and Se) was prepared and used in establishing the selective separation technique of cesium from lithium chloride matrix using cation exchange chromatography. Its recovery was measured by flame atomic absorption spectrometry and the reliability of this technique was evaluate

  18. Vector Cesium Magnetometer for the nEDM Experiment

    International Nuclear Information System (INIS)

    Full text: We use optical pumping combined with magnetic resonance in a Cesium vapor cell in order to measure the magnetic field. A Vector Cs Magnetometer uses multiple laser beams to follow the dynamics of the spin in 3D. The 3D signal is used to extract the Larmor frequency of the spins, and to extract the direction of the magnetic field through the path of the spins. The magnetometer was successfully tested in a proof of principle experiment. Its measured performance is ∼50 pT/Hz1/2 for the directions perpendicular to the magnetic field, and ∼500 fT/Hz1/2 for the direction parallel to the magnetic field. (author)

  19. Cesium and strontium sorption behavior in amended agricultural soils (United States)

    Mehmood, Khalid; Hofmann, Diana; Burauel, Peter; Vereecken, Harry; Berns, Anne E.


    Biogas digestates and biochar are emerging soil amendments. Biochar is a byproduct of pyrolysis process which is thermal decomposition of biomass to produce syngas and bio-oil. The use of biochar for soil amendment is being promoted for higher crop yields and carbon sequestration. Currently, the numbers of biogas plants in Germany are increasing to meet the new energy scenarios. The sustainability of biogas industry requires proper disposal options for digestate. Biogas digestates being rich in nutrients are beneficial to enhance agricultural productions. Contrary to the agronomical benefits of these organic amendments, their use can influence the mobility and bioavailability of soil contaminants due to nutrients competition and high organic matter content. So far, the impact of such amendments on highly problematic contaminants like radionuclides is not truly accounted for. In the present study, sorption-desorption behavior of cesium and strontium was investigated in three soils of different origin and texture. Two agricultural soils, a loamy sand and a silty soil, were amended with biochar and digestate in separate experiments, with field application rates of 25 Mg/ha and 34 Mg/ha, respectively. For comparison a third soil, a forest soil, was incubated without any amendment. The amendments were mixed into the top 20 cm of the field soils, resulting in final concentrations of 8-9 g biochar/Kg soil and 11-12 g digestate/Kg soil. The soils were incubated for about six months at room temperature. Sorption-desorption experiments were performed with CsCl and SrCl2 after pre-equilibrating the soils with CaCl2 solutions. The amendments with field application rates did not have a significant effect on the relevant soil parameters responsible for the sorption behavior of the two radionuclides. Comparatively, the soil type lead to distinctive differences in sorption-desorption dynamics of the two radionuclides. Cesium showed a higher affinity for silty soil followed by

  20. Elastic scattering of sodium and cesium atoms at ultracold temperatures

    Institute of Scientific and Technical Information of China (English)

    Zhang Ji-Cai; Wang Ke-Dong; Liu Yu-Fang; Sun Jin-Feng


    The elastic scattering properties in a mixture of sodium and cesium atoms are investigated at cold and ultracold temperatures. Based on the accurate interatomic potential for the NaCs mixture,the interspecies s-wave scattering lengths,the effective ranges and the p-wave scattering lengths are calculated by the quantal method and the semiclassical method,respectively. The s-wave scattering lengths are 512.7ao for the singlet state and 33.4ao for the triplet state. In addition,the spin-change and elastic cross sections are also calculated,and the g-wave shape resonance is found in the total elastic cross sections.

  1. Hot demonstration of proposed commercial cesium removal technology: Progress report

    International Nuclear Information System (INIS)

    Cesium, strontium, and technetium radionuclides constitute a small fraction of the primarily sodium and potassium salts present in supernatants that are being stored in tanks at Hanford, Oak Ridge, Savannah River, and Idaho and must be remediated. Nuclide removal technologies supplied by the US Department of Energy Office of Science and Technology's Efficient Separations and Processing (ESP) Cross-Cutting Program have been previously proposed and tested in small batch and column tests using both simulated and actual supernatants. These technologies must now be tested and the most appropriate ones selected using a flow system of a scale suitable to obtain engineering data that can be applied to the design of pilot-scale equipment. This report describes the operation of the experimental test unit that is located in Building 4501 (ORNL) and the results using the sorbent materials that were tested

  2. Relativistic Mean Field Study of the Z = 117 Isotopic Chain

    International Nuclear Information System (INIS)

    The properties of the Z = 117 isotopic chain are studied within the framework of the axially deformed relativistic mean field theory (RMFT) in the blocked BCS approximation. The ground-state properties, such as binging energies, deformations as well as the possible α decay energies and lifetimes are calculated with the parameter set of NL-Z2 and compared with results from the finite range droplet model. The analysis by RMFT shows that the isotopes in the range of mass number A = 291 ∼ 300 exhibit higher stability, which suggests that they may be promising nuclei to be hopefully synthesized in the lab among the nuclei Z = 117. (nuclear physics)

  3. Relativistic mean field study of the Z=117 isotopic chain

    International Nuclear Information System (INIS)

    The properties of the Z=117 isotopic chain are studied within the framework of the axially deformed relativistic mean field theory (RMFT) in the blocked BCS approximation. The ground-state properties, such as binding energies, deformations as well as the possible α decay energies and lifetimes are calculated with the parameter set of NL-Z2 and compared with results from the finite range droplet model. The analysis by RMFT shows that the isotopes in the range of mass number A=291-300 exhibit higher stability, which suggests that they may be promising nuclei to be hopefully synthesized in the lab among the nuclei Z-117. (authors)

  4. Sorption of cesium on bentonite: The role of calcite

    International Nuclear Information System (INIS)

    Full text: Since bentonite is investigated for its use in Engineered Barriers Systems as backfill material, many studies of their surfaces properties have been performed in the past years to qualify and quantify adsorption on their surfaces, which can be one of the major processes limiting migration of radionuclides away from a disposal site. Nevertheless, most of these studies concerned simplified systems, such as Na-montmorillonite in mono-electrolyte solution. As ion-exchange processes are of importance in water-clays interactions, adsorption of natural major ions has also to be taken into account for natural systems. The aim of this work is (i) to quantify the sorption of the natural major cations on the montmorillonite surface, (ii) to compare the sorption of cesium, in two different systems, a simple one (Na-montmorillonite in NaNO3 0.05 Mol.L-1) and a complex one (natural bentonite in a synthetic natural water) and then (iii) to assess the influence of the natural major ions on this sorption, and to identify the role of the calcite phase present in bentonite. The methodology used consists in several batch experiments, first considering a very simple solution (NaNO3), then using mixtures of two different electrolytes, and lastly using a synthetic natural water. A surface complexation model, describing the surface of clays as a mixture of ion-exchange and complexation surface sites, is used to provide interpretations and quantifications of the sorption processes. Observed results indicate that affinity for the montmorillonite surface is greatest for Ca, then Mg and then K. The sorption of cesium is strongly affected by the presence in solution of Ca, witch can come from the partial dissolution of calcite. (author)

  5. Sorption of cesium on bentonite: The role of calcite

    International Nuclear Information System (INIS)

    Full text: Since bentonite is investigated for its use in Engineered Barriers Systems as backfill material, many studies of their surfaces properties have been performed in the past years to qualify and quantify adsorption on their surfaces, which can be one of the major processes limiting migration of radionuclides away from a disposal site. Nevertheless, most of these studies concerned simplified systems, such as Na-montmorillonite in mono-electrolyte solution. As ion-exchange processes are of importance in water-clays interactions, adsorption of natural major ions has also to be taken into account for natural systems. The aim of this work is (i) to quantify the sorption of the natural major cations on the montmorillonite surface; (ii) to compare the sorption of cesium, in two different systems, a simple one ( Na-montmorillonite in NaNO3 0.05 Mol.L-1) and a complex one (natural bentonite in a synthetic natural water) and then; (iii) to assess the influence of the natural major ions on this sorption, and to identify the role of the calcite phase present in bentonite. The methodology used consists in several batch experiments, first considering a very simple solution (NaNO3), then using mixtures of two different electrolytes, and lastly using a synthetic natural water. A surface complexation model, describing the surface of clays as a mixture of ion-exchange and complexation surface sites, is used to provide interpretations and quantifications of the sorption processes. Observed results indicate that affinity for the montmorillonite surface is greatest for Ca, then Mg and then K. The sorption of cesium is strongly affected by the presence in solution of Ca, witch can come from the partial dissolution of calcite. This study is one part of a work supported by ANDRA on the retention properties of bentonite materials. (author)

  6. Vitrification of cesium-contaminated organic ion exchange resin

    Energy Technology Data Exchange (ETDEWEB)

    Sargent, T.N. Jr. [Clemson Univ., SC (United States)


    Vitrification has been declared by the Environmental Protection Agency (USEPA) as the Best Demonstrated Available Technology (BDAT) for the permanent disposal of high-level radioactive waste. Savannah River Site currently uses a sodium tetraphenylborate (NaTPB) precipitation process to remove Cs-137 from a wastewater solution created from the processing of nuclear fuel. This process has several disadvantages such as the formation of a benzene waste stream. It has been proposed to replace the precipitation process with an ion exchange process using a new resorcinol-formaldehyde resin developed by Savannah River Technical Center (SRTC). Preliminary tests, however, showed that problems such as crust formation and a reduced final glass wasteform exist when the resin is placed in the melter environment. The newly developed stirred melter could be capable of overcoming these problems. This research explored the operational feasibility of using the stirred tank melter to vitrify an organic ion exchange resin. Preliminary tests included crucible studies to determine the reducing potential of the resin and the extent of oxygen consuming reactions and oxygen transfer tests to approximate the extent of oxygen transfer into the molten glass using an impeller and a combination of the impeller and an external oxygen transfer system. These preliminary studies were used as a basis for the final test which was using the stirred tank melter to vitrify nonradioactive cesium loaded organic ion exchange resin. Results from this test included a cesium mass balance, a characterization of the semi-volatile organic compounds present in the off gas as products of incomplete combustion (PIC), a qualitative analysis of other volatile metals, and observations relating to the effect the resin had on the final redox state of the glass.

  7. Vitrification of cesium-contaminated organic ion exchange resin

    International Nuclear Information System (INIS)

    Vitrification has been declared by the Environmental Protection Agency (USEPA) as the Best Demonstrated Available Technology (BDAT) for the permanent disposal of high-level radioactive waste. Savannah River Site currently uses a sodium tetraphenylborate (NaTPB) precipitation process to remove Cs-137 from a wastewater solution created from the processing of nuclear fuel. This process has several disadvantages such as the formation of a benzene waste stream. It has been proposed to replace the precipitation process with an ion exchange process using a new resorcinol-formaldehyde resin developed by Savannah River Technical Center (SRTC). Preliminary tests, however, showed that problems such as crust formation and a reduced final glass wasteform exist when the resin is placed in the melter environment. The newly developed stirred melter could be capable of overcoming these problems. This research explored the operational feasibility of using the stirred tank melter to vitrify an organic ion exchange resin. Preliminary tests included crucible studies to determine the reducing potential of the resin and the extent of oxygen consuming reactions and oxygen transfer tests to approximate the extent of oxygen transfer into the molten glass using an impeller and a combination of the impeller and an external oxygen transfer system. These preliminary studies were used as a basis for the final test which was using the stirred tank melter to vitrify nonradioactive cesium loaded organic ion exchange resin. Results from this test included a cesium mass balance, a characterization of the semi-volatile organic compounds present in the off gas as products of incomplete combustion (PIC), a qualitative analysis of other volatile metals, and observations relating to the effect the resin had on the final redox state of the glass

  8. Removal and adsorption of radioactive cesium from contaminated soil caused by the Fukushima Daiichi Nuclear Power Station accident

    International Nuclear Information System (INIS)

    The removal and adsorption of radioactive cesium, 137Cs or 134Cs, from contaminated soil was investigated using various extractants: sodium hydroxide, hydrochloric acid, and sulfuric acid. In this experiment, a sand sample was used as contaminated soil. Although the radioactive cesium could not be removed from the soil by using sodium hydroxide, 64% of the removal efficiency was provided at room temperature when 10 M hydrochloric acid was used. Eighty percent of the radioactive cesium was removed by using 1 M sulfuric acid containing 0.1 M thiourea at 90℃. A more than 90% removal efficiency was obtained by increasing of the volume of sulfuric acid containing thiourea. The same result was obtained using custom-made radioactive cesium removal equipment. The adsorption of the radioactive cesium was also investigated. In an experiment of concerning adsorption, contaminated water containing radioactive cesium was prepared from a contaminated sand sample. More than 96% adsorption was obtained using zeolite (clinoptilolite). However, when commercial activated carbon was used, most the radioactive cesium was hardly removed. The influence of shaking time on the adsorption of radioactive cesium was investigated by a batch-system using zeolite. As a result, a shaking time of at least 5 min showed that the radioactive cesium was quantitatively adsorbed to zeolite. The adsorptive behavior of the radioactive cesium by a flow-system was also examined using zeolite. (author)

  9. Separation of radio cesium from acid-Purex solutions by sorption on granulated AMP

    International Nuclear Information System (INIS)

    An organic polymer, poly vinylbutyral was used for the preparation of the composite exchanger containing ammonium molybdo phosphate (AMP) as the active component. The resultant granulated product (AMP-GR) has excellent column properties and stands high flow rates without generating fines. The method of preparation of the granulated sorbent, the batch and breakthrough capacities of the granules for cesium ions, their hydraulic properties and the results of column tests for cesium separation from acidic cesium solutions and simulated high level wastes (HLW) solutions is described. The process can be adapted to remove cesium from HLW solutions and could thus be incorporated in a waste management scheme. (author). 16 refs., 3 figs., 3 tabs

  10. New separation techniques of cesium by redox type ion exchange materials

    International Nuclear Information System (INIS)

    RIECS method, new cesium separation method, was developed in which a porous strong base anionic exchanger with copper ferrocyanide (CuFC) and inhibitor were used. Cesium could be separated from the high concentration nitric solution. By developing new impregnation method, large amount of CuFC was impregnated into the micropolar porous resin and silica gel pores. KFC adhered to outside of pores was recovered. Good complex with CuFC was prepared by use of copper chloride in ethyl alcohol solution. The adsorption ratio of cesium increased radically to 80% level in the very small range of hydrazine concentration 1.7 to 2.4x10-4M. The adsorption-desorption ratio of cesium did not decrease by repeating it seven times. The glassificated materials decreased large amount of γ-ray unless increase of volume could be produced by built RIECS method in the high level waste processing system. (S.Y.)

  11. Preparation, structure and application of a new ecomaterials cesium ion-sieve

    Institute of Scientific and Technical Information of China (English)


    A new ecomaterials cesium ion-sieve (Cs-IS), which has high selectivity to cesium and excellent acid resistance, is prepared with zirconyl molybdopyrophosphate as its matrix by specific chemical sieve-making means. Cs-IS has large exchange capacity ( 1.83mmol@g-1) and high distribution coefficient (4.09 x 104 mL@ L-1) in the medium of 3 mol@ L- 1 HNO3. In the static exchange with strongly acidic high-level radioactive liquid waste (HLLW) (3 mol@ L-1 HNO3), Cs-IS exhibits high exchange rate for cesium (above 96.53 % ) and large separation factor (greater than 958.41). These indicate the possible use of Cs-IS in cesium-137 selective removal and recovery from highly saline acidic HLLW system.

  12. Cesium-137 in Lake Michigan sediments: areal distribution and correlation with other man-made materials

    International Nuclear Information System (INIS)

    Grab samples of sediment were collected at 530 locations in Lake Michigan, primarily in the southeastern quarter of the lake. Each sample was analysed in the field and in the laboratory for fallout cesium-137. Twenty-five of the samples collected near the mouth of the St. Joseph River, were also analysed in the laboratory for 11 other man-made materials known to be discharged into the river. Two statistical methods were used to determine if cesium-137 can be used as an environmental tracer to predict the areal distributions of other man-made materials. The results show fallout cesium-137 to be a moderate to good tracer for locating areas of accumulation of plutonium-238, plutonium-239, zinc, copper, chromium, lead, dieldrin, DDT and PCB in sediment. Little or no correlation is found between fallout cesium-137 and strontium-90 or nickel. (author)

  13. Candlestick oven with a silica wick provides an intense collimated cesium atomic beam (United States)

    Pailloux, A.; Alpettaz, T.; Lizon, E.


    This article shows that readily available glass and silica fibers and braids are suitable capillary structure for recirculating ovens, such as candlestick ovens, becoming then an alternative wick material to conventional metal based capillary structures. In order to study wettability and capillarity of metallic liquid cesium on borosilicate and silica microstructures, samples were selected, prepared, and tested experimentally. The contact angle of cesium on silica glass was roughly measured: θ =35°±10°. A commercially available silica braid was then introduced inside a candlestick oven to transfer the metallic liquid cesium from the cold reservoir to the hot emission point of the candlestick. A collimated cesium atomic beam of intensity of 2×1016at./ssr was obtained, stable and reproducible. Furthermore, this modified oven is easy to handle daily.

  14. Fission of Multiply Charged Cesium and Potassium Clusters in Helium Droplets - Approaching the Rayleigh Limit

    CERN Document Server

    Renzler, Michael; Daxner, Matthias; Kranabetter, Lorenz; Kuhn, Martin; Scheier, Paul; Echt, Olof


    Electron ionization of helium droplets doped with cesium or potassium results in doubly and, for cesium, triply charged cluster ions. The smallest observable doubly charged clusters are $Cs_{9}^{2+}$ and $K_{11}^{2+}$; they are a factor two smaller than reported previously. The size of potassium dications approaches the Rayleigh limit nRay for which the fission barrier is calculated to vanish, i.e. their fissilities are close to 1. Cesium dications are even smaller than nRay, implying that their fissilities have been significantly overestimated. Triply charged cesium clusters as small as $Cs_{19}^{3+}$ are observed; they are a factor 2.6 smaller than previously reported. Mechanisms that may be responsible for enhanced formation of clusters with high fissilities are discussed.

  15. Assessment of food calcium radioprotection effectiveness against cesium-137, added alone and with iodine-131

    International Nuclear Information System (INIS)

    New fish product with addition of food calcium had radioprotective properties, resulted in decreased cesium-137 content in organs and tissues of animals by 40-60% and lesser changes in differential blood count and biochemical indexes of blood serum

  16. Cold cesium molecules produced directly in a magneto-optical trap

    Institute of Scientific and Technical Information of China (English)

    Zhang Hong-Shan; Ji Zhong-Hua; Yuan Jin-Peng; Zhao Yan-Ting; Ma Jie; Wang Li-Rong; Xiao Lian-Tuan; Jia Suo-Tang


    We report on the observation of ultracold ground electric-state cesium molecules produced directly in a magnetooptical trap with a good signal-to-noise ratio.These molecules arise from the photoassociation of magneto-optical trap lasers and they are detected by resonantly enhanced multiphoton ionization technology.The production rate of ultracold cesium molecules is up to 4× 104 s-1.We measure the characteristic time of the ground electric-state cesium molecules generated in the experiment and investigate the Cs2+ molecular ion intensity as a function of the trapping laser intensity and the ionization pulse laser energy.We conclude that the production of cold cesium molecules may be enhanced by using appropriate experimental parameters,which is useful for future experiments involving the production and trapping of ultracold ground electric-state molecules.

  17. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium. (United States)

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru


    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent. PMID:22464752

  18. Removal of cesium from low level waste solutions by copper hexacyanoferrate loaded resins

    International Nuclear Information System (INIS)

    Sorbents for the separation of radio cesium from aqueous solutions were synthesized by incorporating copper hexacyanoferrate (II) in the matrix of anion exchange resins of Indian origin, viz. Indion-810 and Tulsion-A27MP. Their efficiency for the cesium removal was tested under both static and dynamic conditions. The resins were found to be highly selective for radio cesium from a variety of salt and acid solutions. In general, Tulsion-based resins showed more tolerance towards chemical load in the solutions than the other. Pilot column run with Indion-based loaded resin showed that it effectively removed all the cesium activity from few thousands of litres of mixed low level waste streams from reactors, fuel reprocessing plant and nuclear laboratories. (author). 24 refs., 2 figs., 3 tabs

  19. Biological effects of cesium-137 injected in beagle dogs of different ages

    Energy Technology Data Exchange (ETDEWEB)

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others


    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.

  20. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Energy Technology Data Exchange (ETDEWEB)

    Geer, L.E. De; Vintersved, I.; Arntsing, R. [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)


    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  1. Cs2 ‘diffuse bands’ emission from superheated cesium vapor (United States)

    Pichler, G.; Makdisi, Y.; Kokaj, J.; Thomas, N.; Mathew, J.; Beuc, R.


    Thermal emission from superheated cesium vapor was studied to very high temperatures from 700 °C to 1000 °C. This was performed in the vapor condition only and with no liquid cesium present in the all-sapphire cell. We observed a number of atomic and molecular spectral features simultaneously in emission and absorption, especially peculiar thermal emission of cesium dimer diffuse bands (2 3Πg → a 3∑u + transitions) around 710 nm coexisting with absorption bands around first resonance lines at 852 and 894 nm. We performed appropriate calculations of the diffuse band emission profiles and compared them with measured profiles. We also performed absorption measurements and compared observed diffuse band profiles with calculated ones. Possible applications of the observed phenomena will be discussed in terms of the solar energy conversion using dense cesium vapor.

  2. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    International Nuclear Information System (INIS)

    This report contains the results from a study requested by High Level Waste Division on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na+] increased the rate at which cesium tetraphenylborate (KTPB) in the presence of high [Na+] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice

  3. Distribution of cesium 137 between different sorption sites of soils contaminated by Chernobyl catastrophe products

    International Nuclear Information System (INIS)

    The results of investigation of distribution of cesium 137 ions between different sorption sites of soils contaminated by Chernobyl catastrophe products are received. Using NH42 and Sr2+ as ousted cations the portion of radionuclide adsorbed by specific (FES) and regular (RES) exchangeable sites have been determined. The distribution of cesium 137 ions and its exchangeable form between soils and liquid phases of water saturated soils have been established. The distribution coefficients have been evaluated. The behavior of cesium 137 in a system 'soil - solution' with different contribution of FES and RES sites into radionuclide adsorption were considered. Effect of solution acidity and cation concentration compete for exchangeable adsorption have been analyzed. Higher cesium 137 mobility during its transfer from solid phase into solution in soils, where content of specific adsorption sites is limited, was revealed

  4. [Value of radioactive cesium content in selected food products. I. Content of radioactive cesium in dried milk (1987-1988)]. (United States)

    Skibniewska, K A; Smoczyński, S S; Werner, B


    The content of radioactive cesium in dried and dried skimmed milk from selected dairies was double determined. The highest content was found in samples from milk from OSM Siedlce (98 Bq/kg) and skimmed milk from Radzyń Podlaski and Ostrołeka, (the former 90, the latter 62 Bq/kg). The lowest level of radioactive caesium was observed in samples from dried milk from Sieradz, Słupsk, Września, Olecko and Elblag (about or below 10 Bq/kg). Although those levels of contamination with radiocesium didn't exceed values recommended by FAO they were determined as high for year 1987/88 as compared milk data from previous 1985 year. PMID:8016538

  5. Fabrication and performance of fl y ash granule filter for trapping gaseous cesium

    Directory of Open Access Journals (Sweden)

    Park Jang Jin


    Full Text Available Although a disk-type fly ash filter has shown a good performance in trapping gaseous cesium, it has difficulty in charging filters into a filter container and discharging waste filters containing radioactive cesium from a container by remote action. To solve the difficulty of the disk-type fly ash filter, five types of granule filters, including a ball type, tube type, and sponge-structure type have been made. Among them, the best filter type was chosen through simple crucible tests. The five types of granule filters packed into containers were loaded into five alumina crucibles of 50 cc. Five grams of CsNO3 was used as a gaseous cesium source. They were then placed in a muffle furnace and heated to 900°C and maintained for 2 hours. After the experiment, the weights of the cesium trapped filters were measured. Among the five types of granule filters, the sponge-structure type granule filter was the best, which has the highest trapping capacity of cesium. Its capacity is 0.42 g-Cs/g-filter. The chosen sponge-structure type granule filters and disk-type filters have been tested using a two-zone tube furnace. Cs volatilization and Cs trapping zones were maintained at 900 and 1000°C, respectively. Sixteen grams of CsNO3 was used as a gaseous cesium source. The cesium trapping profile of the sponge-structure type granule filters was almost similar to that of the disk-type fly ash filters. For both cases, cesium was successfully trapped within the third filter.

  6. Calculations of neutron and proton radii of cesium isotopes. Final report, April 23--September 30, 1993

    International Nuclear Information System (INIS)

    This task involved the calculation of neutron and proton radii of cesium isotopes. The author has written a computer code that calculates radii according to two models: Myers 1983 and FRDM 1992. Results of calculations in both these models for both cesium and francium isotopes are attached as figures. He is currently interpreting these results in collaboration with D. Vieira and J.R. Nix, and they expect to use the computer code for further studies of nuclear radii

  7. Thermoemission and adsorption properties of tungsten alloy with osmium in cesium atoms flow

    International Nuclear Information System (INIS)

    Thermoemission and absorption properties of (110) and (100) planes of monocrystal of W+0.5%Os melt in a flux of cesium atoms are studied. Despite the fact that the electron work function from planes (100) and (110) was only 0.05 eV different it turned out during adsorption of Cs atoms that plane (110) adsorbes cesium atoms much better and reduces the work function to a greater extent

  8. Dosage of cesium 137 in radioactive wastes by the application of sodium tetraphenylborate

    International Nuclear Information System (INIS)

    A simple technique of the dosage of 137Cs has been developed. The technique consists in the formation of cesium tetraphenyl borate, followed by a double extraction with isoamyl acetate, and washing of the organic phase. The counting of known parts of the cesium solution assaying of its purity by γ spectrometry enable the determination of the 137Cs. The yield is about 98 per cent. (authors)

  9. Contribution of the pectin in the cesium elimination in organism. results of analysis on Belarus children

    International Nuclear Information System (INIS)

    The results make appear that the cesium 137 would be eliminated less quick than what the ICRP considered for its models. Pectin would accelerate the cesium elimination but less quick than what is announced by its promotors. Politically speaking, the pectin is ignored by the officials of medicine and radiation protection at the pretext that its efficiency is not proved but no study is made. (N.C.)

  10. Iodine and cesium behavior during the first PBF Severe Fuel Damage Test

    International Nuclear Information System (INIS)

    The results of iodine and cesium measurements made during the Severe Fuel Damage Scoping Test at the Power Burst Facility are presented. On-line gamma spectroscopy and grab samples of the test effluent were used to measure the isotopic release histories at four locations in the effluent sampling system. Total release fractions, release rates, analysis of filter debris, and sample line deposition characteristics are discussed. Iodine and cesium release rate constants measured during the experiment are compared with published NRC data

  11. Iodine and cesium behavior during the first PBF severe fuel damage test

    International Nuclear Information System (INIS)

    The results of iodine and cesium measurements made during the Severe Fuel Damage Scoping Test at the Power Burst Facility are presented. On-line gamma spectroscopy and grab samples of the test effluent were used to measure the isotopic release histories at four locations in the effluent sampling system. Total release fractions, release rates, analysis of filter debris, and sample line deposition characteristics are discussed. Iodine and cesium release rate constants measured during the experiment are compared with published NRC data

  12. Iodine and cesium behavior during the first PBF Severe Fuel Damage test: Chapter 4

    International Nuclear Information System (INIS)

    The results of iodine and cesium measurements made during the Severe Fuel Damage Scoping Test at the Power Burst Facility are presented. On-line gamma spectroscopy and grab samples of the test effluent were used to measure the isotopic release histories at four locations in the effluent sampling system. Total release fractions, release rates, analysis of filter debris, and sample line deposition characteristics are discussed. Iodine and cesium release rate constants measured during the experiment are compared with published NRC data

  13. 40 CFR 51.117 - Additional provisions for lead. (United States)


    ... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Additional provisions for lead. 51.117... Additional provisions for lead. In addition to other requirements in §§ 51.100 through 51.116 the following requirements apply to lead. To the extent they conflict, there requirements are controlling over those of...

  14. 27 CFR 26.117 - Action by carrier. (United States)


    ... OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Taxpayment of Liquors and Articles in Puerto Rico Procedure at Port of Arrival § 26.117 Action by carrier. The carrier of the merchandise specified on the Form 487B shall, at the time of unlading at the port of...

  15. 14 CFR 135.117 - Briefing of passengers before flight. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Briefing of passengers before flight. 135... Flight Operations § 135.117 Briefing of passengers before flight. (a) Before each takeoff each pilot in... briefing shall include a statement that the Federal Aviation Regulations require passenger compliance...

  16. 33 CFR 117.734 - Navesink River (Swimming River). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navesink River (Swimming River... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.734 Navesink River (Swimming River). The Oceanic Bridge, mile 4.5, shall open on signal; except that, from December 1...

  17. 27 CFR 478.117 - Function outside a customs territory. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Function outside a customs... Importation § 478.117 Function outside a customs territory. In the insular possessions of the United States outside customs territory, the functions performed by U.S. Customs officers under this subpart within...

  18. Enhanced electronic injection in organic light-emitting diodes by incorporating silver nanoclusters and cesium carbonate

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Ying-Chung; Gao, Chia-Yuan [Department of Electrical Engineering, National Sun Yat-Sen University, Kaohsiung, Taiwan (China); Chen, Kan-Lin [Department of Electronic Engineering, Fortune Institute of Technology, Kaohsiung, Taiwan (China); Sze, Po-Wen [Department of Electro-Optical Science and Engineering, Kao Yuan University, Kaohsiung, Taiwan (China); Huang, Chien-Jung, E-mail: [Department of Applied Physics, National University of Kaohsiung, Kaohsiung, Taiwan (China)


    Highlights: • The localized electric field around SNCs is enhanced. • When the cesium carbonate/silver nanoclusters/cesium carbonate electron-injection structure replaces the cesium carbonate electron-injection structure, higher electron-injection ability is obtained. • The structure for efficient electron injection is critical to characteristics of the device. - Abstract: The influence of the cesium carbonate/silver nanoclusters/cesium carbonate electron-injection structure (CSC-EIS) on the performance of organic light-emitting diodes is investigated in this study. The silver nanoclusters (SNCs) are introduced between the electron-injection layers by means of thermal evaporation. When the CSC-EIS replaces the cesium carbonate electron-injection structure, higher electron-injection ability is obtained because the electron-injection barrier between the cathode and the electron-transport layer is remarkably reduced from 1.2 to 0 eV. In addition, surface plasmon resonance effect will cause the enhanced localized electric field around the SNCs, resulting that electron-injection ability is further enhanced from the cathode to the emitting layer.

  19. Cesium absorption from acidic solutions using ammonium molybdophosphate on a polyacrylonitrile support (AMP-PAN)

    International Nuclear Information System (INIS)

    Recent efforts at the Idaho Chemical Processing Plant (ICPP) have included evaluation of cesium removal technologies as applied to ICPP acidic radioactive waste streams. Ammonium molybdophosphate (AMP) immobilized on a polyacrylonitrile support (AMP-PAN) has been studied as an ion exchange agent for cesium removal from acidic waste solutions. Capacities, distribution coefficients, elutability, and kinetics of cesium-extraction have been evaluated. Exchange breakthrough curves using small columns have been determined from 1M HNO3 and simulated waste solutions. The theoretical capacity of AMP is 213 g Cs/kg AMP. The average experimental capacity in batch contacts with various acidic solutions was 150 g Cs/kg AMP. The measured cesium distribution coefficients from actual waste solutions were 3287 mL/g for dissolved zirconia calcines, and 2679 mL/g for sodium-bearing waste. The cesium in the dissolved alumina calcines was analyzed for; however, the concentration was below analytical detectable limits resulting in inconclusive results. The reaction kinetics are very rapid (2-10 minutes). Cesium absorption appears to be independent of acid concentration over the range tested (0.1 M to 5 M HNO3)

  20. Measurement of cesium emissions during the vitrification of simulated high level radioactive waste

    International Nuclear Information System (INIS)

    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to eliminate a startup test that would involve adding small amounts of radioactive cesium-137 to simulated high-level waste. In order to eliminate this test, a reliable method for measuring non-radioactive cesium in the offgas system from the glass melter is required. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICPMS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. Typical particulate loadings ranged from 800 μg of cesium. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. The decontamination factors measured experimentally compared favorably with the process design basis values

  1. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    International Nuclear Information System (INIS)

    Highlights: ► Prussian blue was sealed in cavities of diatomite using carbon nanotubes. ► The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. ► Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  2. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Baiyang [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Fugetsu, Bunshi, E-mail: [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Yu, Hongwen [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Abe, Yoshiteru [Kyoei Engineering Corporation, Niigata 959-1961 (Japan)


    Highlights: Black-Right-Pointing-Pointer Prussian blue was sealed in cavities of diatomite using carbon nanotubes. Black-Right-Pointing-Pointer The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. Black-Right-Pointing-Pointer Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  3. Test evaluation of a cesium vapor source and regulator for thermionic space power systems

    International Nuclear Information System (INIS)

    This paper presents the results of nearly 8000 hours of testing of a fully developed cesium vapor source on the integrated TOPAZ II Ya-21U thermionic space power system. The test period included 4000 hours of system thermal vacuum operation and evaluation by Russian specialists at the Central Design Bureau for Machine Building (CDBMB), St. Petersburg, Russia; nearly 4000 hours of thermal vacuum tests at the Thermionic Systems Evaluation Test (TSET) laboratory; and mechanical tests at the Sandia National Laboratories (SNL), Albuquerque, NM. Testing of the non-nuclear Ya-21U system provided significant information for evaluation and characterization of the cesium vapor source that could not be obtained by development and qualification testing of only components. The Ya-21U system and cesium vapor source were subjected to excessive, unplanned stress levels during the system evaluation tests which resulted in leakage of oxygen into the cesium subsystem and cesium vapor from the TFEs. The information and experience gained during the thermionic system evaluation test are useful for improvement of future cesium vapor subsystem designs, test support equipment, and system test procedures. copyright 1996 American Institute of Physics

  4. Review and assessment of technologies for the separation of cesium from acidic media

    International Nuclear Information System (INIS)

    A preliminary literature survey has been conducted to identify and evaluate methods for the separation of cesium from acidic waste. The most promising solvent extraction, precipitation, and ion exchange methods, along with some of the attributes for each method, are listed. The main criteria used in evaluating the separation methods were as follows: (1) good potential for cesium separation must be demonstrated (i.e., cesium decontamination factors on the order of 50 to 100). (2) Good selectivity for cesium over bulk components must be demonstrated. (3) The method must show promise for evolving into a practical and fairly simple process. (4) The process should be safe to operate. (5) The method must be robust (i.e., capable of separating cesium from various acidic waste types). (6) Secondary waste generation must be minimized. (7) The method must show resistance to radiation damage. The most promising separation methods did not necessarily satisfy all of the above criteria, thus key areas requiring further development are suggested for each method. The report discusses in detail these and other areas requiring further development, as well as alternative solvent extraction, precipitation, ion exchange, and open-quote other close-quote technologies that, based on current information, show less promise for the separation of cesium from acidic wastes because of significant process limitations. When appropriate, the report recommends areas of future development

  5. Individual difference of concentration of radio cesium on olive flounder (Paralichthys olivaceus)

    International Nuclear Information System (INIS)

    Marine organisms were contaminated with radio cesium released from TEPCO Fukushima Nuclear Power Plants and coastal fisheries are still restricted. Olive flounder is one of the most important fishery species in Japan and live in coastal area. About one hundred of olive flounder were caught in northern and southern part of Fukushima prefecture and the concentrations of radio cesium in muscle of them were measured individually. The averages of concentration (with standard deviations) of total radio cesium in the muscle of the fish were 87.0 (72.3) Bq/kg-wet and 101 (104) Bq/kg-wet in the northern and southern coasts, respectively. Seventy percent of the results were distributed between 50 and 150 Bq/kg-wet but some of them were much higher (and much lower) than the average. According to the individuals with under 200 Bq/kg-wet of radio cesium collected in northern part of Fukushima, the concentrations of radio cesium were correlated to the amounts of 15N in the muscles. It suggests that the concentration of radio cesium in olive flounder might be influenced by the species of prey organisms that individual flounder predated a certain period before catch. (author)

  6. Modeling Ion-Exchange Processing With Spherical Resins For Cesium Removal

    Energy Technology Data Exchange (ETDEWEB)

    Hang, T.; Nash, C. A.; Aleman, S. E.


    The spherical Resorcinol-Formaldehyde and hypothetical spherical SuperLig(r) 644 ion-exchange resins are evaluated for cesium removal from radioactive waste solutions. Modeling results show that spherical SuperLig(r) 644 reduces column cycling by 50% for high-potassium solutions. Spherical Resorcinol Formaldehyde performs equally well for the lowest-potassium wastes. Less cycling reduces nitric acid usage during resin elution and sodium addition during resin regeneration, therefore, significantly decreasing life-cycle operational costs. A model assessment of the mechanism behind ''cesium bleed'' is also conducted. When a resin bed is eluted, a relatively small amount of cesium remains within resin particles. Cesium can bleed into otherwise decontaminated product in the next loading cycle. The bleed mechanism is shown to be fully isotherm-controlled vs. mass transfer controlled. Knowledge of residual post-elution cesium level and resin isotherm can be utilized to predict rate of cesium bleed in a mostly non-loaded column. Overall, this work demonstrates the versatility of the ion-exchange modeling to study the effects of resin characteristics on processing cycles, rates, and cold chemical consumption. This evaluation justifies further development of a spherical form of the SL644 resin.

  7. Production of 117mSn with high specific activity

    International Nuclear Information System (INIS)

    Complete text of publication follows. Introduction. The production of 117mSn is commonly carried out by the 116Sn(n,γ)117mSn or 117Sn(n,n')117mSn nuclear reaction in nuclear reactor. However this method is unable produce 117mSn in high level of the specific activity, which is the basic requirement for application in nuclear medicine. An alternative way for the production would be the 116Cd(α,3n)117mSn nuclear reaction using a cyclotron. According to the literature the cross section of this reaction is acceptably high, as can be seen in the following picture. The thick target yield is 6MBq/μ Ah and the activities of potential contaminating radioisotopes produced by side reaction are negligible, if the energy of the irradiating beam will be chosen precisely. The natural abundance of 116Cd is 7,5%, it means that the price of the enriched material is reasonable. A potential cyclotron facility with α-beam was found at JINR, Dubna, Russia where the radiochemical background also exist. This cyclotron facility is able to do routine irradiation with the necessary energy range (38-25 MeV) and beam intensity (at least 50 μA). Experimental. The Cd-target was prepared as follows: the Cd-metal (22 mg) was dissolved in concentrated nitric acid and then evaporated to dryness producing Cd(NO3)2 salt. The Cd(NO3)2 salt was then re-dissolved in water, followed by the addition of a spatula tip of sugar and a few drops of methanol. The sugar allowed for adhesion of the salt to the target plate, and the methanol facilitated even wetting and hence homogeneous application of the Cd to the target surface. The target holder/plate comprised of a block of aluminium metal.The cadmium salt was then applied to the target holder painted across the surface. Results and discussion. After irradiation the Cd-target material and the 117mSn product was stripped from the aluminium backing by washing with concentrated nitric acid. The solution was slightly evaporated, after that the salt was

  8. Monitoring of radionuclides in the environment. Part. 4. Factors influencing depth profiles of radioactive cesium in soils

    International Nuclear Information System (INIS)

    In order to evaluate the vertical migration behavior of radioactive cesium, which contaminated by the Fukushima Dai-ichi NPP accident, the distribution of radioactive cesium in different type of soils, e.g., bare ground, grass land, conifer forest floor were measured on October 2011, 2012, 2013, in Abiko, Chiba, Japan. Even three years after the deposition, most of radioactive cesium were deposited in the depths of within 5 cm at anywhere in this area. Depth profiles of radioactive cesium in soil was significantly correlated with organic matter content in soils (r=0.82; p<0.0001), whereas the factors such as potassium ion and ammonium ion in soil, stable cesium content, and clay mineral content were not correlated clearly. This indicates that the vertical migration rate of radioactive cesium is very slow and it would be influenced by organic matter in soil, not just clay. (author)

  9. Engineered Materials for Cesium and Strontium Storage Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Sean M. McDeavitt


    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at

  10. Engineered Materials for Cesium and Strontium Storage. Final Technical Report

    International Nuclear Information System (INIS)

    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at Purdue

  11. Effect of electrolytes concentration on recovery of cesium from AMP-PAN by Electrodialysis-Ion Exchange (EDIX)

    International Nuclear Information System (INIS)

    Cesium from the simulated acidic waste solution was separated using Ammonium Molybdophosphate (AMP) - Polyacrylonitrile (PAN) ion exchange resin in column operations. Electrodialysis - Ion exchange (EDIX) has been tried for the recovery of cesium from the AMP-PAN which was saturated with cesium. The electrodialysis setup consists of three compartments; cesium loaded AMP-PAN is placed in the middle compartment and is separated from the anode and cathode compartments by cation exchange membranes. Ammonium sulphate was used as anolyte and HNO3 as catholyte. 0.1N HNO3 was circulated in the middle compartment containing AMP-PAN to keep the resin in acidic form. On application of potential, the ammonium ions from the anode compartment migrate towards cathode through the middle compartment where they exchange with cesium ions on the resin and the exchanged cesium ions migrate towards cathode to get concentrated. Some part of cesium is recovered in the middle compartment due to convection. Cesium recovery from the AMP-PAN in the electrodialysis setup was studied at different anolyte and catholyte concentrations. All the experiments were carried out at constant current density of 40 mA/cm2 for 15h. It was found that more than 50% of cesium recovery was observed for all the experiments studied and recovery percentage increased with increasing the anolyte concentration. It was observed that the electrolytes concentration affects the voltage drop across the cell

  12. Gamma-ray spectroscopic determination of iodine-131 and cesium-137 in foods: Two collaborative studies

    International Nuclear Information System (INIS)

    The AOAC method for iodine-131, cesium-137, and barium-140 in milk by gamma-ray spectroscopy (48.025-48.029) was extended to include other foods for the radionuclides iodine-131 and cesium-137. Two collaborative studies were performed to validate this extension. In the first study, a food sample containing 119 pCi 131I/kg and 53 pCi 137Cs/kg was sent to each of 45 laboratories for triplicate analyses. For 25 responses, the mean of the reported values was 123.8 pCi/kg for iodine-131, and for 27 responses, the mean was 53.4 pCi/kg for cesium-137. Repeatability (within-laboratory) standard deviations (Sr) for iodine-131 and cesium-137 were 4.6 and 3.7 pCi/kg, respectively. Reproducibility (among-laboratories) standard deviations (SR) for iodine-131 and cesium-137 were 12.1 and 6.0 pCi/kg, respectively. In the second study, a food sample containing 25 pCi 131I/kg and 27 pCi 137Cs/kg was sent to each of 54 laboratories for triplicate analyses. For 21 responses, the mean of the reported values was 25.0 pCi/kg for iodine-131, and for 19 responses, the mean was 28.9 pCi/kg for cesium-137. Sr Values were 4.0 and 1.6 pCi/kg for iodine-131 and cesium-137, respectively, and SR values were 5.0 and 2.8 pCi/kg, respectively. The method extension was adopted official first action

  13. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    International Nuclear Information System (INIS)

    Twenty-seven fully loaded 137Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 15000C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of 137Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded 137Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10-10 kg m-2s-1, while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10-12 kg m-2s-1. The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level 137Cs aluminosilicate pellets were 1.29 x 10-16m2s-1, 6.88 x 10-17m2s-1, and 1.35 x 10-17m2s-1, respectively

  14. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    International Nuclear Information System (INIS)

    This report contains the results from a study requested by High Level Waste on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na+] increased the rate at which cesium tetraphenylborate (CsTPB) precipitates also increases. Serkiz also demonstrated that the precipitation of potassium tetraphenylborate (KTPB) in the presence of high [Na+] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice. In the crystallographic structure of these three tetraphenylborate salts (Cs,K,NaTPB), the tetraphenylborate ion dominates the size of the crystals. Also, note that the three crystals have nearly identical structures with the exception of two additional peaks in the cesium pattern. Given these similarities, TPB precipitation in the presence of Na+, Cs+ and K+ likely produces an impure isomorphic crystalline mixture of CsTPB, KTPB and NaTPB. The authors speculate that the primary crystalline structure resembles that of KTPB with NaTPB and CsTPB mixed throughout the crystal structure. The precipitation of NaTPB makes some of the anticipated excess tetraphenylborate relatively unavailable for precipitation of cesium. Thus, the amount of excess tetraphenylborate required to completely precipitate all of the potassium and cesium may increase significantly

  15. 21 CFR 111.117 - What quality control operations are required for equipment, instruments, and controls? (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for equipment, instruments, and controls? 111.117 Section 111.117 Food and Drugs FOOD AND DRUG ADMINISTRATION... and Process Control System: Requirements for Quality Control § 111.117 What quality control...

  16. 21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing. (United States)


    ... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Standardized Cacao Products § 163.117 Cocoa with dioctyl sodium sulfosuccinate for manufacturing. (a) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying...

  17. 41 CFR 102-117.220 - What choices do I have to ship HHG? (United States)


    ... Management Program (CHAMP); (3) Contracting directly with a TSP, (including a relocation company that offers... to ship HHG? 102-117.220 Section 102-117.220 Public Contracts and Property Management Federal...-TRANSPORTATION MANAGEMENT Shipping Household Goods § 102-117.220 What choices do I have to ship HHG? (a) You...

  18. 29 CFR 780.117 - “Production, cultivation, growing.” (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false âProduction, cultivation, growing.â 780.117 Section 780.117... General Scope of Agriculture âproduction, Cultivation, Growing, and Harvestingâ of Commodities § 780.117 “Production, cultivation, growing.” (a) The words “production, cultivation, growing” describe actual...

  19. 41 CFR 102-117.235 - How do I get a cost comparison? (United States)


    ... MANAGEMENT Shipping Household Goods § 102-117.235 How do I get a cost comparison? (a) You may calculate a cost comparison internally according to 41 CFR 302-8.3. (b) You may request GSA to perform the cost... comparison? 102-117.235 Section 102-117.235 Public Contracts and Property Management Federal...

  20. Relativistic mean field study of the properties of Z=117 nucleus and the decay chains of $^{293,294}$117 isotopes

    CERN Document Server

    Bhuyan, M


    We have calculated the binding energy, root-mean-square radius and quadrupole deformation parameter for the recently synthesized superheavy element Z=117, using the axially deformed relativistic mean field (RMF) model. The calculation is extended to various isotopes of Z=117 element, strarting from A=286 till A=310. We predict almost spherical structures in the ground state for almost all the isotopes. A shape transition appears at about A=292 from prolate to a oblate shape structures of Z=117 nucleus in our mean field approach. The most stable isotope (largest binding energy per nucleon) is found to be the $^{288}$117 nucleus. Also, the Q-value of $\\alpha$-decay $Q_\\alpha$ and the half-lives $T_{\\alpha}$ are calculated for the $\\alpha$-decay chains of $^{293}$117 and $^{294}$117, supporting the magic numbers at N=172 and/ or 184.

  1. Improvement of cesium retention in uranium dioxide by additional phases; Amelioration de la retention du cesium dans le dioxyde d`uranium au moyen de phases exogenes

    Energy Technology Data Exchange (ETDEWEB)

    Gamaury Dubois, S.


    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs{sub 2}O-Al{sub 2}O{sub 3}-SiO{sub 2} et Cs{sub 2}O-ZrO{sub 2}-SO{sub 2}. The compounds CsAISi{sub 2}O{sub 6} and Cs{sub 2}ZrSi{sub 6}O{sub 15} were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al{sub 2}O{sub 3} + SiO{sub 2}) or (ZrO{sub 2} + SiO{sub 2}) and the intergranular phase was characterized. In the presence of (Al{sub 2}O{sub 3} + SiO{sub 2}), the sintering is realized at 1610 deg C in H{sub 2}. It is a liquid phase sintering. On the other end, with (ZrO{sub 2} + SiO{sub 2}), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO{sub 2+x}. We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs.

  2. Ion exchange performance of commercial crystalline silicotitanates for cesium removal

    International Nuclear Information System (INIS)

    A new class of inorganic ion exchangers called crystalline silicotitanates (CST), invented by researchers at Sandia National Laboratories and Texas A ampersand M University, has been commercialized in a joint Sandia-UOP effort. The original developmental materials exhibited high selectivity for the ion exchange of cesium, strontium, and several other radionuclides from highly alkaline solutions containing molar concentrations of Na+. The materials also showed excellent chemical and radiation stability. Together, the high selectivity and stability of the CSTs made them excellent candidates for treatment of solutions such as the Hanford tank supernates and other DOE radwastes. Sandia National Laboratories and UOP have teamed under a Cooperative Research and Development Agreement (CRADA) to develop CSTs in the powdered form and in an engineered form suitable for column ion exchange use. A continuous-flow, column ion exchange process is expected to be used to remove Cs and other radionuclides from the Hanford supernatant. The powder material invented by the Sandia and Texas A ampersand M team consists of submicron-size particles. It is not designed for column ion exchange but may be used in other applications

  3. Ion exchange performance of commercial crystalline silicotitanates for cesium removal

    Energy Technology Data Exchange (ETDEWEB)

    Braun, R.; Dangieri, T.J.; Fennelly, D.J. [and others


    A new class of inorganic ion exchangers called crystalline silicotitanates (CST), invented by researchers at Sandia National Laboratories and Texas A&M University, has been commercialized in a joint Sandia-UOP effort. The original developmental materials exhibited high selectivity for the ion exchange of cesium, strontium, and several other radionuclides from highly alkaline solutions containing molar concentrations of Na{sup +}. The materials also showed excellent chemical and radiation stability. Together, the high selectivity and stability of the CSTs made them excellent candidates for treatment of solutions such as the Hanford tank supernates and other DOE radwastes. Sandia National Laboratories and UOP have teamed under a Cooperative Research and Development Agreement (CRADA) to develop CSTs in the powdered form and in an engineered form suitable for column ion exchange use. A continuous-flow, column ion exchange process is expected to be used to remove Cs and other radionuclides from the Hanford supernatant. The powder material invented by the Sandia and Texas A&M team consists of submicron-size particles. It is not designed for column ion exchange but may be used in other applications.

  4. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  5. Biogeochemistry of Cesium in a Sagebrush Steppe Ecosystem (United States)

    Palmer, C. D.; Hess, J. R.; Hamilton, M. A.; Cook, L. L.; Siegel, L. S.; Yancey, N. A.


    The nature of radiocesium sources is such that they often have resulted in the contamination of shallow (SL-1 reactor show changes in concentrations and transfer factors with the stage of plant growth. The samples included both rhizosphere and bulk soils as well as roots and shoots from the crested wheatgrass. The ranges of total cesium in rhizosphere and bulk soils are similar, are fairly narrow (1.7 to 5.2 mg kg-1), and do not appear to vary seasonally. In contrast, 137Cs activities in rhizosphere and bulk soils are significantly different, vary over orders of magnitude (10-180 pCi g-1), and show seasonal differences. Shoot and root 137Cs activities decrease between April and May. Total Cs shoot-to-root ratios are greater than the corresponding ratios for radiocesium. Total Cs root-to-rhizosphere soil ratios are lower than the corresponding ratios for 137Cs. These results are being used to enhance our understanding of phytoremediation scenarios and issues associated with long-term stewardship of 137Cs-contaminated lands.

  6. Cesium sorption and desorption behavior of clay minerals

    International Nuclear Information System (INIS)

    Cesium sorption and desorption of clay minerals (montmorillonite, beidellite, nontronite, weathered biotite, rectorite and illite) were investigated by consecutive sorption-desorption (CSD) experiments. In batch sorption experiment, two solutions with different Cs concentration 10-3 and 10-7 mol/L) were used. In batch desorption experiments, Cs sorbed samples in sorption experiments were treated 5 times with 1 mol/L ammonium acetate solution. In the case of CSD experiments using 10-3 mol/L Cs solution, the exchangeable cations (Na, Ca, and K) in the clay samples affected to the sorption ratio of Cs, and this effect depended on the type of clay mineral. The desorption ratios of untreated, Na-exchanged and Ca-exchanged weathered biotite ranged from 23 to 33%, while that of other samples was over 80%. In the case of CSD experiments using 10-7 mol/L Cs solution, the sorption ratio of montmorillonite was smaller than that of the other clay samples. In desorption experiments, more than 10-9 mol sorbed Cs remained in 1.0 g of the sample after 5 extraction times. These results indicate that all examined clay samples are able to strongly adsorb Cs with a capacity of more than 10-9 mol/g. (author)

  7. ATLAS tile calorimeter cesium calibration control and analysis software

    International Nuclear Information System (INIS)

    An online control system to calibrate and monitor ATLAS Barrel hadronic calorimeter (TileCal) with a movable radioactive source, driven by liquid flow, is described. To read out and control the system an online software has been developed, using ATLAS TDAQ components like DVS (Diagnostic and Verification System) to verify the hardware before running, IS (Information Server) for data and status exchange between networked computers, and other components like DDC (DCS to DAQ Connection), to connect to PVSS-based slow control systems of Tile Calorimeter, high voltage and low voltage. A system of scripting facilities, based on Python language, is used to handle all the calibration and monitoring processes from hardware perspective to final data storage, including various abnormal situations. A QT based graphical user interface to display the status of the calibration system during the cesium source scan is described. The software for analysis of the detector response, using online data, is discussed. Performance of the system and first experience from the ATLAS pit are presented

  8. Broadband Vibrational Cooling of Cold Cesium Molecules: Theory and Experiments

    Institute of Scientific and Technical Information of China (English)

    D. Sofikitis; A. Fioretti; S. Weber; M. Viteau; A. Chotia; R. Horchani; M. Allegrini; B. Chatel; D. Comparat; P. Pillet


    The use of a broadband, frequency shaped femtosecond laser on translationally cold cesium molecules has recently demonstrated to be a very efficient method of cooling also the vibrational degree of freedom. A sample of cold molecules, initially distributed over several vibrational levels, has thus been transfered into a single selected vibrational level of the singlet X1∑g ground electronic state. Our method is based on repeated optical pumping by laser light with a spectrum broad enough to excite all populated vibrational levels but limited in its frequency bandwidth with a spatial light modulator. In such a way we are able to eliminate transitions from the selected level, in which molecules accumulate. In this paper we briefly report the main experimental results and then address, in a detailed way by computer simulations, the perspectives for a "complete" cooling of the molecules, including also the rotational degree of freedom. Since the pumping process strongly depends on the rclative shape of the ground and excited potential curves, ro-vibrational cooling through different excited states is theoretically compared.

  9. Evaluation of a cesium adsorbent grafted with ammonium 12-molybdophosphate (United States)

    Shibata, Takuya; Seko, Noriaki; Amada, Haruyo; Kasai, Noboru; Saiki, Seiichi; Hoshina, Hiroyuki; Ueki, Yuji


    A fibrous cesium (Cs) adsorbent was developed using radiation-induced graft polymerization with a cross-linked structure containing a highly stable adsorption ligand. The ligand, ammonium 12-molybdophosphate (AMP), was successfully introduced onto the fibrous polyethylene trunk material. The resulting Cs adsorbent contained 36% nonwoven fabric polyethylene (NFPE), 1% AMP, 2% triallyl isocyanurate (TAIC) and 61% glycidyl methacrylate (GMA). The adsorbent's Cs adsorption capacity was evaluated using batch and column tests. It was determined that the adsorbent could be used in a wide pH range. The amount of desorbed molybdenum, which can be used as an estimate for AMP stability on the Cs adsorbent, was minimized at the standard drinking water pH range of 5.8-8.6. Based from the inspection on the adherence of these results to the requirements set forth by the Food Sanitation Act by a third party organization, it can be concluded that the developed Cs adsorbent can be safely utilized for drinking water.

  10. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    International Nuclear Information System (INIS)

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department's mission as stated in that document. ''The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.''

  11. Proton tunneling in low dimensional cesium silicate LDS-1

    International Nuclear Information System (INIS)

    In low dimensional cesium silicate LDS-1 (monoclinic phase of CsHSi2O5), anomalous infrared absorption bands observed at 93, 155, 1210, and 1220 cm−1 are assigned to the vibrational mode of protons, which contribute to the strong hydrogen bonding between terminal oxygen atoms of silicate chain (O–O distance = 2.45 Å). The integrated absorbance (oscillator strength) for those modes is drastically enhanced at low temperatures. The analysis of integrated absorbance employing two different anharmonic double-minimum potentials makes clear that proton tunneling through the potential barrier yields an energy splitting of the ground state. The absorption bands at 93 and 155 cm−1, which correspond to the different vibrational modes of protons, are attributed to the optical transition between the splitting levels (excitation from the ground state (n = 0) to the first excited state (n = 1)). Moreover, the absorption bands at 1210 and 1220 cm−1 are identified as the optical transition from the ground state (n = 0) to the third excited state (n = 3). Weak Coulomb interactions in between the adjacent protons generate two types of vibrational modes: symmetric mode (93 and 1210 cm−1) and asymmetric mode (155 and 1220 cm−1). The broad absorption at 100–600 cm−1 reveals an emergence of collective mode due to the vibration of silicate chain coupled not only with the local oscillation of Cs+ but also with the proton oscillation relevant to the second excited state (n = 2)

  12. Cesium 137 redistribution by horizontal migration in soil

    International Nuclear Information System (INIS)

    During radiation monitoring the local nonuniformities of contamination density were noticed which can not be explained by meteorologic conditions at the moment of fallout. The mathematical model of redistribution of cesium 137 radionuclides of Chernobyl origin for the post accidental period on account of migration with horizontal outflow in the upper layer of soils was developed. It has been shown that for nonuniform landscapes (borders of fields, forests, roads etc.) redistribution of radionuclides with increasing of their concentration at the places, where the objects with different migration characteristics are connected, will take place. In Belarus the typical size of such 'spots' will increase with the time up to 1 m/year. It is possible the increasing of contamination density of territories on account of the process of shifting of radioactive 'spots', caused by horizontal flow. The speed of replacement of such 'spots' along the direction of underground water is about 1 m/year; increasing of their typical size is going on with the speed up to 0.3 m/year. 4 refs., 1 fig

  13. Desorption of cesium from granite under various aqueous conditions

    Energy Technology Data Exchange (ETDEWEB)

    Wang, T.-H. [Institute of Nuclear Engineering and Science, National Tsing Hua University, Hsinchu 300, Taiwan (China); Li, M.-H. [Institute of Hydrological and Oceanic Sciences, National Central University, Jungli 320, Taiwan (China); Wei, Y.-Y. [Nuclear Science and Technology Development Center, National Tsing Hua University, Hsinchu 300, Taiwan (China); Teng, S.-P., E-mail: [Institute of Nuclear Engineering and Science, National Tsing Hua University, Hsinchu 300, Taiwan (China)


    In this work the desorption of cesium ions from crushed granite in synthetic groundwater (GW) and seawater (SW) was investigated. Results were compared with those obtained in deionized water (DW) and in two kinds of extraction solutions, namely: MgCl{sub 2} and NaOAc (sodium acetate). In general, the desorption rate of Cs from crushed granite increased proportionally with initial Cs loadings. Also, amounts of desorbed Cs ions followed the tendency in the order SW>GW>NaOAc{approx}MgCl{sub 2}>DW solutions. This indicated that the utilization of extraction reagents for ion exchange will underestimate the Cs desorption behavior. Fitting these experimental data by Langmuir model showed that these extraction reagents have reduced Cs uptake by more than 90%, while only less than 1% of adsorbed Cs ions are still observed in GW and SW solutions in comparison to those in DW. Further SEM/EDS mapping studies clearly demonstrate that these remaining adsorbed Cs ions are at the fracture areas of biotite.

  14. The crystal structures of potassium and cesium trivanadates (United States)

    Evans, H.T., Jr.; Block, S.


    Potassium and cesium trivanadates are monoclinic and isomorphous, space group P21/m, with the following dimensions (Z = 2): KV3O8, a = 7.640 A, b = 8.380 A, c = 4.979 A, ??= 96?? 57???; CsV3O8, a = 8.176 A, b = 8.519 A, c = 4.988 A, ?? = 95?? 32???. The crystal structure of KV3O8 has been determined from hk0, 0kl, and h0l Weissenberg data with an R factor of 0.15. The structure of CsV3O8 has been refined with 1273 hkl Weissenberg data to an R factor of 0.089. The structures consist of corrugated sheets based on a linkage of distorted VO6, octahedra. Two of the vanadium atoms lie in double, square-pyramid groups V2O8, which are linked through opposite basal corners into chains along the b axis. The chains are joined laterally along the c axis into sheets by the third vanadium atom in VO groups, also forming part of a square-pyramid coordination. Various aspects of these structures are compared with other known oxovanadate structures.

  15. International Space Station (ISS) Configuration Post STS-117 Mission (United States)


    Eight days of construction resumed on the International Space Station (ISS), as STS-117 astronauts and mission specialists and the Expedition 15 crew completed installation of the second and third starboard truss segments (S3 and S4). Back dropped by the blackness of space, its newly expanded configuration is revealed as pilot Lee Archambault conducts a fly around upon departure from the station on June 19, 2007.

  16. 40 CFR 117.3 - Determination of reportable quantities. (United States)


    ... Determination of reportable quantities. Each substance in Table 117.3 that is listed in Table 302.4, 40 CFR part... 10 (4.54) Potassium cyanide A 10 (4.54) Potassium hydroxide C 1,000 (454) Potassium permanganate B... 5,000 (2,270) Aniline D 5,000 (2,270) Antimony pentachloride C 1,000 (454) Antimony...

  17. 6^Li in the atmosphere of GJ 117 Revisited

    CERN Document Server

    Christian, D J; Jevremovic, D


    Detection of 6^Li has been shown for energetic solar events, one chromospherically active binary, and several dwarf halo stars. We had previously found a 6^Li/7^Li = 0.03+/-0.01 for active K dwarf GJ 117 using VLT UVES observations. Here we present high signal-to-noise (>1000) high spectral resolution observations taken with the McDonald Observatory's 2.7m and echelle spectrometer of GJ 117. We have used the solar spectrum and template stars to eliminate possible blends, such as Ti I, in the 6^Li spectral region. Our new analysis, using an updated PHOENIX model atmosphere finds 6^Li/7^Li = 0.05+/-0.02. Additionally, bisector analysis showed no significant red asymmetries that would affect the lithium line profile. No changes above the statistical uncertainties are found between the VLT and McDonald data. The amount of 6^Li derived for GJ 117 is consistent with creation in spallation reactions on the stellar surface, but we caution that uncertainties in the continuum level may cause additional uncertainty in t...

  18. Interactions between cesium and dispersed kaolinite powders at high temperatures for the treatment of mixed wastes

    International Nuclear Information System (INIS)

    The potential use of sorbents to manage emissions of trace radiological metals during mixed waste incineration was investigated using a down-fired 82-k W-rated laboratory-scale refractory-lined combustor. Non-radioactive aqueous cesium acetate was sprayed down the center of a natural gas flame supported on a variable swirl burner. Kaolinite powder was injected at a post-flame location in the combustor. Cesium sorption was determined by differences in the particle size distributions (PSDs) as measured by micro-orifice uniform deposition impactor (MOUDI) samples and x-ray fluorescence (XRF) analysis. Without kaolinite injection, the cesium readily vaporizes within the combustor to form difficult to collect ultrafine particles with a mean diameter of approximately 0.09μm. With kaolinite injection rates representing 8:1 molar stoichiometry (A12O3-2SiO2:Cs), up to 85% of the cesium reported to collectable supermicron particle sizes representative of the kaolinite (mean diameter - 1.4μm). However, this capture was dependent on the kaolinite injection temperature with a maximum seen between 1400 and 1500 K. The data suggest that kaolinite powders are effective at capturing vapor phase cesium. However, mechanisms and rates still remain to be quantified

  19. Development program for magnetically assisted chemical separation: Evaluation of cesium removal from Hanford tank supernatant

    International Nuclear Information System (INIS)

    Magnetic particles (MAG*SEPSM) coated with various absorbents were evaluated for the separation and recovery of low concentrations of cesium from nuclear waste solutions. The MAG*SEPSM particles were coated with (1) clinoptilolite, (2) transylvanian volcanic tuff, (3) resorcinol formaldehyde, and (4) crystalline silico-titanate, and then were contacted with a Hanford supernatant simulant. Particles coated with the crystalline silico-titanate were identified by Bradtec as having the highest capacity for cesium removal under the conditions tested (variation of pH, ionic strength, cesium concentration, and absorbent/solution ratio). The MAG*SEPSM particles coated with resorcinol formaldehyde had high distribution ratios values and could also be used to remove cesium from Hanford supernant simulant. Gamma irradiation studies were performed on the MAG*SEPSM particles with a gamma dose equivalent to 100 cycles of use. This irradiation decreased the loading capacity and distribution ratios for the particles by greater than 75%. The particles demonstrated high sensitivity to radiolytic damage due to the degradation of the polymeric regions. These results were supported by optical microscopy measurements. Overall, use of magnetic particles for cesium separation under nuclear waste conditions was found to be marginally effective

  20. Efficiency of fly ash belite cement and zeolite matrices for immobilizing cesium. (United States)

    Goñi, S; Guerrero, A; Lorenzo, M P


    The efficiency of innovative matrices for immobilizing cesium is presented in this work. The matrix formulation included the use of fly ash belite cement (FABC-2-W) and gismondine-type Na-P1 zeolite, both of which are synthesized from fly ash of coal combustion. The efficiency for immobilizing cesium is evaluated from the leaching test ANSI/ANS 16.1-1986 at the temperature of 40 degrees C, from which the apparent diffusion coefficient of cesium is obtained. Matrices with 100% of FABC-2-W are used as a reference. The integrity of matrices is evaluated by porosity and pore-size distribution from mercury intrusion porosimetry, X-ray diffraction and nitrogen adsorption analyses. Both matrices can be classified as good solidify systems for cesium, specially the FABC-2-W/zeolite matrix in which the replacement of 50% of belite cement by the gismondine-type Na-P1 zeolite caused a decrease of two orders of magnitude of cesium mean Effective Diffusion Coefficient (D(e)) (2.8e-09 cm(2)/s versus 2.2e-07 cm(2)/s, for FABC-2-W/zeolite and FABC-2-W matrices, respectively). PMID:16759800

  1. Improvement of cesium leaching resistance of solidified borate wastes with copper-ferrocyanide-vermiculite adsorbent

    International Nuclear Information System (INIS)

    Removal of cesium from deionized water, sea water, and lime water with copper ferrocyanide (CFC) and porous media including silica gel, bentonite, vermiculite, and zeolite were investigated; CFC and vermiculite were incorporated to prepare a compound adsorbent which was used to improve the Cs-leaching resistance of solidified borate wastes. It was shown that the Cs-removal efficiency by CFC is largely affected by pHs of the solutions, good cesium removal occurs in pHs ranged from 3 to 12 and the best from 7 to 10; the effect of Cs concentration is significantly only from lime water for Cs > 10-6 M at high pH and is insignificant from other solutions. Vermiculite and zeolite were shown to have better removal efficiency than silica gel and bentonite, and vermiculite was chosen to incorporate with CFC to make compound adsorbents because of its good compatibility with CFC. Compound adsorbents with different CFC contents were used as additives in the solidification of borate radwaste for improving the cesium leaching resistance of waste forms. Experimental results showed that the measured, cesium leaching index following ANSI/ANS 16.1, was increased from 7.96 to 9.76 by adding 0.25% of a compound adsorbent containing 20% CFC and 80% vermiculite, which indicated that the CFC-vermiculite compound adsorbent is very useful for improving cesium leaching resistance of the solidified borate radwastes

  2. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    Directory of Open Access Journals (Sweden)

    Houssni El-Saied


    Full Text Available In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+ on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the kaolin. Paper handsheets were prepared containing various percentages of the modified kaolin. The mechanical and optical properties of paper handsheets were studied. The prepared paper handsheets were irradiated by gamma irradiation using different doses. Fourier transform infrared (FTIR spectroscopy was used to study the effect of kaolin modification by cesium and gamma irradiation on paper handsheets properties. The results indicated that modified kaolin enhanced the mechanical and optical properties of paper handsheets. Electron spin resonance (ESR spectroscopy and laser-induced breakdown spectroscopy (LIBS were also used. They provided rapid, sensitive and nondestructive techniques in differentiating between different questioned documents. This study presents a new concept in manufacturing security papers and anticounterfeiting applications.

  3. Misinterpretation on the risk of radioactive cesium contained in the disaster wastes

    International Nuclear Information System (INIS)

    Osaka Prefectural Government accepted the disaster wastes contained radioactive cesium after investigation them during one year. I explained the process and discussed about the risk management by people and the self-government body. The environmental pollution by radioactive cesium and Act on Special Measures concerning the Handling of Pollution by Radioactive Materials, the progress of treatment of debris, the concentration of radioactive cesium in debris, the acceptance conditions of debris contained small amount of radioactive cesium, evaluation of effects of radioactive materials in debris on the environment, and citizen's opinion of Osaka prefecture are described. The important investigation area of radioactive contamination on the basis of Act on Special Measures concerning the Handling of Pollution by Radioactive Materials, total amount of waste from Fukushima nuclear accident and debris in Miyagi, Iwate and Fukushima prefecture, the concentration of radioactive cesium in debris in Rikuzentakata and Miyako city as of September, 2011, and cumulative number of citizen's opinion to Osaka are illustrated. (S.Y.)

  4. Local mat-forming cyanobacteria effectively facilitate decontamination of radioactive cesium in rice fields

    International Nuclear Information System (INIS)

    The most effective and widespread method to decontaminate radioactive cesium from the Fukushima Daiichi Nuclear Power Plant Disaster was peeling topsoil. But the method had problems, such as large amounts of discarded soil and large-scale work. In nature, cyanobacteria formed biomats on the ground surface and facilitated peeling topsoil when the biomats dried. The cyanobacteria-facilitating peeling decontamination method utilized these cyanobacterial properties. Cyanobacteria are located all over Japan and 'local' cyanobacteria could be used for decontamination without introducing new species. Utilizing cyanobacteria could decrease the amount of discarded soil to about 30% and downsize the execution-scale to individual locations. Cyanobacterial biomats were easily cultivated, especially in rice fields, by maintaining wet conditions and exposure to 100 - 83% solar radiation. Shading by a thin net was helpful in maintaining an environment suitable for cyanobacteria. Nowadays, to prevent uptake of radioactive cesium into rice, K+ is usually added to fertilizer in rice fields. The K+ fertilization in rice fields might also enhance cyanobacterial capture of radioactive cesium, because high concentrations of K+ enhanced cyanobacterial uptake of Cs+. Cyanobacteria could also mitigate the risk of radioactive cesium moving away from a decontaminating rice field. Therefore, the cyanobacteria-facilitating peeling decontamination method was proposed as an easy and safe 'D.I.Y.' method for both farmers and the environment. Besides, plowing rice fields with water before peeling improved the efficiency of this method, because plowing increased the radioactive cesium concentration in the topsoil. (author)

  5. Cesium-137 in soil texture fractions and its impact on Cesium-137 soil-to-plant transfer

    International Nuclear Information System (INIS)

    Field studies at two sites contaminated by the Chernobyl fallout showed 137Cesium (Cs) soil-to-plant transfer factors in wheat, rye and potato. Transfer values ranged from 0.0017 (potato tuber) to 0.07 (wheat straw). Generally transfer coefficients in cereal grains and potato tubers were significantly below the values of the shoots. A comparison of the two sites led to the conclusion that for all plants investigated 137Cs transfer factors were higher in Lower Austria (Calcic Chernozem) than in Upper Austria (Eutric Cambisol). The specific activities of the texture fractions of the two soil types increased from sand to silt and clay. In the Calcic Chernozem the ratio of the 137Cs activity in the silt fraction to the total activity in the soil was considerably higher than in the Eutric Cambisol. At the same time extractability of 137Cs from the silt fraction of the latter soil was clearly lower. Both results mainly were attributed to the differences between the soils according to the organic matter content of the silt fractions, the Calcic Chernozem being seven times higher. Therefore, the differences in the 137Cs-soil-to-plant transfer can be attributed partly to these soil characteristics. (authors)

  6. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms; Sympathetisches Kuehlen in einer Rubidium-Caesium-Mischung: Erzeugung ultrakalter Caesiumatome

    Energy Technology Data Exchange (ETDEWEB)

    Haas, M.


    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m{sub f}=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m{sub f}=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m{sub f}=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The

  7. Cesium-137 concentration of soils in Pest County, Hungary

    International Nuclear Information System (INIS)

    diffusion coefficient and migration velocity) than predicted in a previous study for brown forest soils in the same area of Hungary. - Highlights: ► We have constructed the first detailed cesium map for Pest County of Hungary. ► Demonstrative indication of well known cesium fixation on illite and kaolinite. ► 78% of the total detected 137Cs concentration was found in the top 3 cm of a vertical soil profile. ► Vertical distribution suggests slower migration speed than expected previously for this type of soil. ► Our fitted parameters are at the lower end of the range for migration parameters for loamy soils.

  8. Comparison of organic and inorganic ion exchange materials for removal of cesium and strontium from tank waste

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G. [Pacific Northwest National Lab., Richland, WA (United States)


    This work is part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. Pacific Northwest National Laboratory (PNNL) staff are investigating novel ion exchangers for use in nuclear waste remediation (groundwater, high-level waste (HLW), and low-level waste (LLW)). Waste components targeted for remediation include cesium, strontium, and technetium.

  9. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    International Nuclear Information System (INIS)

    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103Ru, 134Cs and 124Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10-3 to 5.10-5% of the Ru fed, for Cs the corresponding release fraction ranges between 3.10-3 to 10-4% and for Sb the release fraction ranges between 1.7 10-4 to 1.7 10-5%. The same experiments were performed at a throughput of 1 to 2 1 h-1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103Ru and 134Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  10. Development of an adsorbent for both cesium and strontium

    International Nuclear Information System (INIS)

    Described is the development of the adsorbent in the title at the process of developing the agent to adsorb each element. For cooling the reactors injured by the Fukushima Nuclear Power Plant Accident by the earthquake and tsunami on the day before (Mar. 11, 2011), fresh/ sea water is supplied in the reactor and flows out contaminated with radioactive elements in the turbine building and then in the treatment plant to remove oil and cesium for re-circulation to the reactor. Water from the plant still contains radioisotopes derived from fission, like 90Sr/90Y at 1.2 x 108 Bq/L and 137Cs/137mBa at 6.1 x 103 Bq/L, and from activation of reactor materials. Before the plant, the water contains 137Cs at the level as high as 4.1 x 107 Bq/L. Authors have examined various agents to adsorb 90Sr and 137Cs with a measure of partition coefficient Kd (L of the artificial sea water/kg) and have come to find out the adsorbent in the title: it is derived from the Cs-adsorbing crystalized silico-titanate (CST). The adsorbent is obtainable by surface treatment of CST with NaOH and has high Kds of >1 x 103 and >1 x 104 L/kg for Sr and Cs, respectively, while other ordinary adsorbents' Kds are: artificial zeolite 1-10 x 102/1-10 x 101 for Sr/Cs, respectively; natural one 0.1-10 x 101/1-10 x 102; ferrocyanide 0.1-10 x 101/1-10 x 104, and CST 1 x 101/>1 x 104. When 1 m3 of the present adsorbent is used, >99% of Cs and Sr can be removable in >3,000 m3 of contaminated water, suggesting its usefulness for dealing with water after the Accident. (T.T.)

  11. Cesium and Strontium Specific Exchangers for Nuclear Waste Effluent Remediation

    International Nuclear Information System (INIS)

    During the past 50 years, nuclear defense activities have produced large quantities of nuclear waste that now require safe and permanent disposal. The general procedure to be implemented involves the removal of cesium and strontium from the waste solutions for disposal in permanently vitrified media. This requires highly selective sorbents or ion exchangers. Further, at the high radiation doses present in the solution, organic exchangers or sequestrants are likely to decompose over time. Inorganic ion exchangers are resistant to radiation damage and can exhibit remarkably high selectivities. We have synthesized three families of tunnel-type ion exchangers. The crystal structures of these compounds as well as their protonated phases, coupled with ion exchange titrations, were determined and this information was used to develop an understanding of their ion exchange behavior. The ion exchange selectivities of these phases could be regulated by isomorphous replacement of the framework metals by larger or smaller radius metals. In the realm of layered compounds, we prepared alumina, silica, and zirconia pillared clays and sodium micas. The pillared clays yielded very high Kd values for Cs+ and were very effective in removing Cs+ from groundwaters. The sodium micas also had a high affinity for Cs+ but an even greater attraction for S42+. They also possess the property of trapping these ions permanently as the layers slowly decrease their interlayer distance as loading occurs. Sodium nonatitanate exhibited extremely high Kd values for Sr2+ in alkaline tank wastes and should be considered for removal of Sr2+ in such cases. For tank wastes containing complexing agents, we have found that adding Ca2+ to the solution releases the complexed Sr2+ which may then be removed with the CST exchanger

  12. Pillared montmorillonites: Cesium-selective ion-exchange materials

    Energy Technology Data Exchange (ETDEWEB)

    Sylvester, P.; Clearfield, A.; Diaz, R.J. [Texas A and M Univ., College Station, TX (United States). Dept. of Chemistry


    A zirconia-pillared and an alumina-pillared montmorillonite clay were found to exhibit high K{sub d}S for trace levels of cesium (2.5 ppb) in the presence of high concentrations of Ca{sup 2+}, Mg{sup 2+}, and Na{sup +} ions with distribution coefficients (K{sub d}S) for {sup 137}Cs exceeding 1 {times} 10{sup 5} mL/g over a wide range of competing ion concentrations. An excess of K{sup +} ions, however, caused a dramatic reduction in the Cs K{sub d}S for both of the materials. These results were in contrast to the parent montmorillonite which exhibited far lower K{sub d}S for {sup 137}Cs, particularly in the presence of high concentrations of Mg{sup 2+} and Ca{sup 2+}. Batch tests in simulated groundwaters showed that both pillared clays efficiently removed {sup 137}Cs from solution, with the best K{sub d}S being approximately 8.5 {times} 10{sup 5} mL/g in a potassium-free groundwater. The materials performed less well in a groundwater with a high potassium concentration, but still gave K{sub d}S similar to commercially available zeolites. The rate of {sup 137}Cs uptake was found to be rapid with both the alumina- and zirconia-pillared clays extracting >90% of the {sup 137}Cs from a 0.1 M NaNO{sub 3} solution within 5 minutes.

  13. Cesium Chloride Compatibility Testing Program. Annual report, fiscal year 1984

    Energy Technology Data Exchange (ETDEWEB)

    Bryan, G.H.; Divine, J.R.


    During the course of a prior examination, it was found that one of the aged test capsules exhibited discoloration and pitting on the outer surface of the inner capsule. The damage was attributed to problems encountered in the electropolishing operation, which is used to decontaminate the inner capsule after it is loaded with the CsCl and welded shut. A study was carried out in FY 1984 to: determine if the pitting was associated with the electropolishing operation; identify acceptable solution(s) to the problem; and establish the effect, if any, on the long-term integrity of the capsule. Another special study performed in FY 1984 was that of examining two capsules from the Waste Encapsulation and Storage Facility (WESF) storage pool. The objective was to establish the extent of the capsule corrosion while in storage. The study of cause and long-term consequences of the pitting on the WESF cesium chloride capsules has found: The pitting is caused by a nonuniform current distribution at the rack/capsule contact, which forms localized hot spots. The high temperature causes the acid to become more concentrated through boiling of the acid. The concentrated boiling phosphoric acid causes a high rate of corrosion which forms the crevice. The lack of intergranular attack at the base of the crevices and the favorable results of the mechanical testing leads to the conclusion that there will be no long-term failure mechanism accentuated by the pitting, beyond that of having a small hole in the capsule wall with a consequential thinner wall. An attempt to penetrate the capsule wall by electropolishing failed after 30 min with the loss of electrical contact. Consequently, the maximum wall penetration is 40 mils, out of a total thickness of 136 mil. No justification was found to require examination and repack of the existing capsules. A modification of the rack design is recommended for future work, however, to eliminate the pitting.

  14. The effectiveness of radioactive cesium removal countermeasure due to the Prussian blue nonwoven-textile fabrics proposed by International Research Institute for Nuclear Decommissioning

    International Nuclear Information System (INIS)

    The effectiveness of radioactive-cesium removal countermeasure by using Prussian blue is described: The verified technique for practical use to countermeasure of cesium-contaminated water by using nonwoven textile fabrics; the evaluation of effectiveness of cesium adsorbent, Prussian blue, by using model ecosystem of aquatic animals and plants. (M.H.)

  15. Physical Property Modeling of Concentrated Cesium Eluate Solutions, Part I - Derivation of Models

    Energy Technology Data Exchange (ETDEWEB)

    Choi, A.S.; Pierce, R. A.; Edwards, T. B.; Calloway, T. B.


    Major analytes projected to be present in the Hanford Waste Treatment Plant cesium ion-exchange eluate solutions were identified from the available analytical data collected during radioactive bench-scale runs, and a test matrix of cesium eluate solutions was designed within the bounding concentrations of those analytes. A computer model simulating the semi-batch evaporation of cesium eluate solutions was run in conjunction with a multi-electrolyte aqueous system database to calculate the physical properties of each test matrix solution concentrated to the target endpoints of 80% and 100% saturation. The calculated physical properties were analyzed statistically and fitted into mathematical expressions for the bulk solubility, density, viscosity, heat capacity and volume reduction factor as a function of temperature and concentration of each major analyte in the eluate feed. The R{sup 2} of the resulting physical property models ranged from 0.89 to 0.99.

  16. Characterization of pollucite as a material for long-term storage of cesium-137

    International Nuclear Information System (INIS)

    Pollucite (Cs2O.Al2O3.4SiO2) may be an acceptable material for the long-term storage of purified 137CsCl. Pollucite is made at near theoretical yields when CsCl (or any cesium salt) reacts at approx. = 9700K with a montmorillonite-containing clay. Pollucite dissolves in deionized water at rates -7 kg/(m2 d) based on cesium. Microstructural analyses showed that cesium reacts with montmorillonite clay to form ill-defined pollucite crystals containing low concentrations of the impurities found in the clay. Although further work needs to be done, pollucite is considered to be an excellent materials for the long-term storage of 137Cs

  17. Characterization of pollucite as a material for the long term storage of cesium-137

    International Nuclear Information System (INIS)

    Storage of nuclear waste requires materials which are thermodynamically stable. Pollucite (Cs2O . Al2O3 . 4SiO2) may be an acceptable material for the long-term storage of the purified 137CsCl. Pollucite is made at near theoretical yields when CsCl (or any cesium salt) reacts at about 9700K with a montmorillonite-containing clay. Pollucite dissolves in deionized water at rates which are less than 2 x 10-9 kg/(m2 . s) based on cesium. Microstructural analyses show that cesium reacts with the montmorillonite clay to form ill-defined pollucite crystals which contain low concentrations of the impurities found in the clay. Although further work needs to be done, pollucite is considered to be an excellent material for the long-term storage of 137Cs

  18. The effects of using Cesium-137 teletherapy sources as a radiological weapon (dirty bomb)

    CERN Document Server

    Liolios, Theodore


    While radioactive sources used in medical diagnosis do not pose a great security risk due to their low level of radioactivity, therapeutic sources are extremely radioactive and can presumably be used as a radiological weapon. Cobalt-60 and Cesium-137 sources are the most common ones used in radiotherapy with over 10,000 of such sources currently in use worldwide, especially in the developing world, which cannot afford modern accelerators. The present study uses computer simulations to investigate the effects of using Cesium-137 sources from teletherapy devices as a radiological weapon. Assuming a worst-case terrorist attack scenario, we estimate the ensuing cancer mortality, land contamination, evacuation area, as well as the relevant evacuation, decontamination, and health costs in the framework of the linear risk model. The results indicate that an attack with a Cesium-137 dirty bomb in a large metropolitan city (especially one that would involve several teletherapy sources) although would not cause any sta...

  19. Immobilisation and solidification of cesium on 11 A calcium silicate hydroxy hydrate column

    International Nuclear Information System (INIS)

    Calcium silicate hydrate closely resembling silicate mineral 11 A tobermorite has been synthesised by hydrothermal treatment of lime and silica at 175 degC. The synthetic mineral exhibits selectivity for Cs+ in the presence of strong solutions of alkali and alkaline earth cations, viz, Na+, K+, Mg2+, Ca2+, Sr2+, etc. The Al-substituted form of this mineral effectively separates cesium ion when used as an exchanger in column of size 35x5 mm (hxr). It is possible to remove 98.65±0.5%Cs+ from a mixed solution of cesium and sodium (0.0001N Cs+ + 0.5N Na+). Column separation of cesium from simulated intermediate level waste solution shows that from the first run ∼ 76% Cs+ can be immobilised on a small column, 18x10mm (hxr), having 2.0 g of exchanger. (author)

  20. Phosphate ceramic solidification and stabilization of cesium-containing crystalline silicotitanate resins

    International Nuclear Information System (INIS)

    This paper reports on the fabrication and testing of magnesium potassium phosphate (MKP)-bonded cesium-loaded crystalline silicotitanate (CST) resins. Typical waste loading of CST resins in the final waste forms was 50 wt.%. Physical and chemical characterization of the MKP materials has shown them to be physically, chemically, and mineralogically stable. Long-term durability studies (using the AN 16.1 standard test) showed a leachability index of ∼18 for cesium in the phosphate matrix when exposed to deionized water under ambient and elevated temperatures. Leaching of cesium was somewhat higher than in glass waste forms as per PCT and MCC-1 tests. MKP-based final waste forms showed no significant weight changes after exposure to aqueous media for ∼90 days, indicating the highly insoluble nature of the phosphate matrix. In addition, durability of the CST-MKP waste forms was further established by freeze-thaw cycling tests

  1. A study of radioactive cesium in relation to soil properties in Greece

    International Nuclear Information System (INIS)

    Regions of Greece with a high degree of contamination were selected for sampling the main soil types in various depths and determining their physicochemical characteristics and radiocesium content. Data from 62 sites used and results indicate an existing contamination of the surface 0-20 cm layer of soils ranging from approximately 3 to over 160 Bq/kg soil. In certain cases a contamination of the 20-50 cm layer is determined which is kept rather low on the average. In correlating various soil characteristics to cesium-137 content it is indicated that smaller amounts of 137Cs are determined in the second soil layer with increasing pH values from 3.5 to 6.0 in the surface layer. No correlation of organic matter content to the translocation of cesium has been established while the clay percentage and the cation exchange capacity seem to affect the amount of cesium-137 in the examined soils. (author)

  2. Equilibrium data for cesium ion exchange of Hanford CC and NCAW tank waste

    International Nuclear Information System (INIS)

    Hanford alkaline waste storage-tank contents will be processed to remove the soluble salts. A major fraction of these solutions will require cesium recovery to produce a low-level waste (LLW). The technology for decontamination of high-level alkaline waste and sludge wash waters is being developed. At the request of Westinghouse Hanford Company (WHC), the Pacific Northwest Laboratory (PNL) has studied several ion exchange materials for the recovery of cesium from Hanford waste tanks. The WHC program was divided into tow main tasks, (1) to obtain equilibrium data for cesium ion exchange, and (2) to evaluate ion exchange column performance. The subject of this letter report is the measurement of batch distribution coefficients for several ion exchange media for a range of operating conditions for two types of waste; complexant concentrate (CC) and neutralized current acid waste (NCAW)

  3. Studies of cesium and strontium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    Distribution coefficients (Ksub(d)) were measured for cesium and strontium in 16 samples of Canadian unconsolidated geological materials. The samples were collected to cover a wide range of grain size, clay-mineral composition, cation exchange capacity and carbonate mineral content. Distribution coefficients ranged between 102 and 2.0 x 104 ml/g for cesium and between 2.5 and 102 ml/g for strontium, indicating that most unconsolidated geological materials have a substantial ability to retard the migration of cesium, while strontium could generally be expected to be somewhat more mobile. The measured K values were not significantly correlated with the measured soil properties, but appeared to be significantly affected by the background concentration of stable isotopes of the respective radionuclides

  4. Reduction of cesium levels in the diet through management of food

    International Nuclear Information System (INIS)

    Several processes influence the radionuclide concentration of food products during processing: dilution, losses, concentration. Boiling of leaf vegetables yields a decontamination effect of up to 80% in the case of radioiodine. Peeling of potato tubers results in a reduction of the cesium concentration of 30%. The cesium and strontium concentration of flour is a factor of two lower as compared to the corresponding cereal grain due to the milling process. Significant discrimination occurs during the milk processing. The skimmed milk is significantly richer in cesium, iodine and especially in strontium than the cream. It follows that butter is depleted in its radionuclide contents as compared to other milk produce. Strontium is concentrated in the casein. Pressurized cooking in combination with salting or a treatment with acetic acid results in an Cs-activity loss of beef, veal and lamb meat of 50 to 90%. (Author) 3 figs., 7 tabs., 13 refs

  5. Decontamination of Radioactive Cesium Released from Fukushima Daiichi Nuclear Power Plant - 13277

    International Nuclear Information System (INIS)

    Peculiar binding of Cesium to the soil clay minerals remained the major obstacle for the immediate Cs-decontamination of soil and materials containing clay minerals like sludge. Experiments for the removal of Cesium from soil and ash samples from different materials were performed in the lab scale. For soil and sludge ash formed by the incineration of municipal sewage sludge, acid treatment at high temperature is effective while washing with water removed Cesium from ashes of plants or burnable garbage. Though total removal seems a difficult task, water-washing of wood-ash or garbage-ash at 40 deg. C removes >90% radiocesium, while >60% activity can be removed from soil and sludge-ash by acid washing at 95 deg. C. (authors)

  6. Determination of the cesium distribution coefficient in Goiania and Abadia de Goias cities soils

    International Nuclear Information System (INIS)

    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficent for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author)

  7. Specific features of cesium chemistry and physics affecting reactor accident source term predictions

    International Nuclear Information System (INIS)

    In the process of assessing remaining uncertainties in predicting the source term of severe reactor accidents, a special investigation is devoted in this report to the case of cesium. The cesium isotopes, especially Cs137 and Cs134, are among those nuclides which could have a major impact on the environment in the event of a release. The processes for release from fuel and retention in the reactor coolant system and the containment are presented. Releases to the atmosphere are also discussed. The intention is to identify and discuss those specific features of cesium chemistry and physics that strongly affect source term predictions. The report has been prepared on contract from the Swedish Nuclear Power Inspectorate as a contribution to the cooperative work within international experts groups of OECD/NEA

  8. Metabolism of 137cesium, 137barium in the rat. Therapeutics of the contamination

    International Nuclear Information System (INIS)

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of 137Cs - 137Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors)

  9. Alternate Methods for Eluting Cesium from Spherical Resorcinol-Formaldehyde Resin

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, Paul Allen [ORNL; Johnson, Heather Lauren [University of Tennessee, Knoxville (UTK)


    A small-column ion exchange (SCIX) system has been proposed for removing cesium from the supernate and dissolved salt solutions in the high-level-waste tanks at the Savannah River Site (SRS). The SCIX system could use either crystalline silicotitanate (CST), an inorganic, non-regenerable sorbent, or spherical resorcinol-formaldehyde (RF), a new regenerable resin, to remove cesium from the waste solutions. The baseline method for eluting the cesium from the RF resin uses 15 bed volumes (BV) of 0.5 M nitric acid (HNO{sub 3}). The nitric acid eluate, containing the radioactive cesium, would be combined with the sludge from the waste tanks and would be converted into glass at the Defense Waste Processing Facility (DWPF) at SRS. The amount of nitric acid that would be used to elute the RF resin, using the current elution protocol, exceeds the capacity of DWPF to destroy the nitrate ions and maintain the required chemical reducing environment in the glass melt. Installing a denitration evaporator at SRS is technically feasible but would add considerable cost to the project. Alternate methods for eluting the resin have been tested, including using lower concentrations of nitric acid, other acids, and changing the flow regimes. About 4 BV of 0.5 M HNO{sub 3} are required to remove the sodium (titrate the resin) and most of the cesium from the resin, so the bulk of the acid used for the baseline elution method removes a very small quantity of cesium from the resin. A summary of the elution methods that have been tested are listed.

  10. Caustic-Side Solvent Extraction: Extended Equilibrium Modeling of Cesium and Potassium Distribution Behavior

    Energy Technology Data Exchange (ETDEWEB)

    Delmau, L.H.


    An extension of the model developed in FY01 for predicting equilibrium distribution ratios in the Caustic-Side Solvent Extraction (CSSX) process is presented here. Motivation for extending the model arose from the need to predict extraction performance of the recently optimized solvent composition and the desire to include additional waste components. This model involves the extraction of cesium and potassium from different cesium, potassium, and sodium media over a large range of concentrations. Those different media include a large variety of anions such as nitrate, hydroxide, nitrite, chloride, fluoride, sulfate, and carbonate. The model was defined based on several hundreds of experimental data points and predicted satisfactorily the cesium extraction from five different SRS waste simulants. This process model encompassed almost exclusively 1:1:1 metal:anion:ligand species. Fluoride, sulfate, and carbonate species were found to be very little extractable, and their main impact is reflected through their activity effects. This model gave a very good cesium and potassium extraction prediction from sodium salts, which is what is needed when trying to predict the behavior from actual waste. However, the extraction from potassium or cesium salts, and the extraction of sodium could be improved, and some additional effort was devoted to improve the thermodynamic rigor of the model. Toward this end, more detailed anion-specific models were developed based on the cesium, potassium, and sodium distribution ratios obtained with simple systems containing single anions, but it has not yet proven possible to combine those models to obtain better predictions than provided by the process model.

  11. Small-Column Cesium Ion Exchange Elution Testing of Spherical Resorcinol-Formaldehyde

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Garrett N.; Russell, Renee L.; Peterson, Reid A.


    This report summarizes the work performed to evaluate multiple, cesium loading, and elution cycles for small columns containing SRF resin using a simple, high-level waste (HLW) simulant. Cesium ion exchange loading and elution curves were generated for a nominal 5 M Na, 2.4E-05 M Cs, 0.115 M Al loading solution traced with 134Cs followed by elution with variable HNO3 (0.02, 0.07, 0.15, 0.23, and 0.28 M) containing variable CsNO3 (5.0E-09, 5.0E-08, and 5.0E-07 M) and traced with 137Cs. The ion exchange system consisted of a pump, tubing, process solutions, and a single, small ({approx}15.7 mL) bed of SRF resin with a water-jacketed column for temperature-control. The columns were loaded with approximately 250 bed volumes (BVs) of feed solution at 45 C and at 1.5 to 12 BV per hour (0.15 to 1.2 cm/min). The columns were then eluted with 29+ BVs of HNO3 processed at 25 C and at 1.4 BV/h. The two independent tracers allowed analysis of the on-column cesium interaction between the loading and elution solutions. The objective of these tests was to improve the correlation between the spent resin cesium content and cesium leached out of the resin in subsequent loading cycles (cesium leakage) to help establish acid strength and purity requirements.

  12. Results of removing radioactive cesium from the shallow rice fields by planting sunflower

    International Nuclear Information System (INIS)

    Hoping that revival of agriculture in the disaster area by Fukushima nuclear plant accident, the author and others cultivated shallow fields by planting sunflower and measured the cesium concentration absorbed in root, steam and the surrounding soil and also absorptive situation at fixed intervals as the plant grows. They could obtain the results that the sunflower has its maximum ability for cesium absorption and adsorption just before going into bloom. They conclude that the Cs 137-contaminated shallow fields (<15 cm) may be decontaminated with the efficiency of 30%/year assuming the root contamination is 8,000 Bq/kg and twice harvesting per year. (S. Ohno)

  13. Measurement of Ionization Threshold of Ultracold Cesium Rydberg Atoms in Static Electric Field

    Institute of Scientific and Technical Information of China (English)

    FENG Zhi-Gang; ZHANG Lin-Jie; ZHAO Jian-Ming; LI Chang-Yong; LI An-Ling; JIA Suo-Tang


    We investigate the field ionization spectra of ultracold cesium Rydberg atoms in dc electric field. The ionization thresholds of different electric fields are measured and shift of the ionization threshold relative to field-free ionization threshold is accurately described by (6.06±0.14) F1/2, which is in good agreement with the classical saddle-point model for field ionization. We obtain the field-free ionization threshold of cesium (6P,3/2) as 19674.89士2.99cm-1 by fitting experimental data.

  14. Psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

    International Nuclear Information System (INIS)

    The presented work had as objective the accomplishment of a comparative study of cesium-137 radioactive element effects in the psychological and motor development of children which were going submitted the intra-uterus irradiation during the chronological age of three years. The comparison of the results of study is done through a group-control composed for five children without any involvement with the cesium-137 accident - occurred in 1987 in Goiania, Brazil - of same social, economic and cultural level and with the same age of the reached

  15. Heat Transfer During Evaporation of Cesium From Graphite Surface in an Argon Environment

    Directory of Open Access Journals (Sweden)

    Bespala Evgeny


    Full Text Available The article focuses on discussion of problem of graphite radioactive waste formation and accumulation. It is shown that irradiated nuclear graphite being inalienable part of uranium-graphite reactor may contain fission and activation products. Much attention is given to the process of formation of radioactive cesium on the graphite element surface. It is described a process of plasma decontamination of irradiated graphite in inert argon atmosphere. Quasi-one mathematical model is offered, it describes heat transfer process in graphite-cesium-argon system. Article shows results of calculation of temperature field inside the unit cell. Authors determined the factors which influence on temperature change.

  16. Removal of cesium from aqueous solutions and radioactive waste stimulants by coprecipitated flotation

    International Nuclear Information System (INIS)

    Coprecipitated flotation (CPF) investigations show that cesium can be efficiently separated from aqueous solutions by coprecipitation with zinc hexacyanoferrate (ZnHCF) and subsequent flotation of the precipitate. Collectors of different types were tested but pyridinium chloride showed the best performance before undertaking the flotation investigations coprecipitation of Cs with ZnHCF was studied to determine the optimal coprecipitation conditions. The developed CPF process was applied successfully for 137Cs removal from process wastewater and low level liquid radioactive waste stimulants . The obtained results compare favorably with data published for cesium removal by coprecipitation or adsorption processes. Besides, CPF seems to be more advantageous

  17. On specific features of thermoemission of cesium-implanted molybdenum monocrystals

    International Nuclear Information System (INIS)

    The influence of keeping in an electric field of the anode on the emission current of cesium ion doped molybdenum single crystal has been observed. An X-ray diffractometer has been used to show the formation of a new phase in the near-surface region of crystals after doping that is not identified with none of the known molybdenum compounds. The observed specific features of the thermoemission are attributed to a change of the work function of the crystal surface as a result of cesium ions migration in the lattice of the formed ternary chemical compound

  18. Behaviour of cesium in contaminated soils with and without agricultural practices

    International Nuclear Information System (INIS)

    The migration of cesium into affected agricultural soils, five years after the Chernobyl accident, is examined in this study. Samples of soil were taken from an undisturbed non-cultivated rural area in the north of Greece, where an important contamination has been detected. The migration of 137Cs into these soils was measured by γ spectrometry. Slight movement of 137Cs was observed during the five year period following the accident. The agricultural practices, used in this area from 1986 up to now, have diluted the contamination into the 0-40 cm horizon and thus only low concentration of cesium in the cultivated soils was detected. (orig.)

  19. Photoemission and optical constant measurements of a Cesium Iodide thin film photocathode

    International Nuclear Information System (INIS)

    The performance of cesium iodide as a reflective photocathode is presented. The absolute quantum efficiency of a 500 nm thick film of cesium iodide has been measured in the wavelength range 150 nm–200 nm. The optical absorbance has been analyzed in the wavelength range 190 nm–900 nm and the optical band gap energy has been calculated. The dispersion properties were determined from the refractive index using an envelope plot of the transmittance data. The morphological and elemental film composition have been investigated by atomic force microscopy and X-ray photo-electron spectroscopy techniques

  20. A direct frequency comb for two-photon transition spectroscopy in a cesium vapor

    Institute of Scientific and Technical Information of China (English)

    Zhang Yi-Chi; Wu Ji-Zhou; Li Yu-Qing; Jin Li; Ma Jie; Wang Li-Rong; Zhao Yan-Ting; Xiao Lian-Tuan; Jia Suo-Tang


    A phase-stabilized femtosecond frequency comb is used to measure high-resolution spectra of two-photon transition 62S1/2-62P1/2,3/2-82S1/2 in a cesium vapor.The broadband laser output from a femtosecond frequency comb is split into counter-propagating parts,shaped in an original way,and focused into a room-temperature cesium vapor.We obtain high-resolution two-photon spectroscopy by scanning the repetition rate of femtosecond frequency comb,and through absolute frequency measurements.