
Sample records for cesium 113

  1. Process for recovering cesium from cesium alum

    Mein, P.G.


    Cesium is recovered from cesium alum, CsAl(SO 4 ) 2 , by a two-reaction sequence in which the cesium alum is first dissolved in an aqueous hydroxide solution to form cesium alum hydroxide, CsAl(OH) 3 , and potassium sulfate, K 2 SO 4 . Part of the K 2 SO 4 precipitates and is separated from the supernatant solution. In the second reaction, a water-soluble permanganate, such as potassium permanganate, KMnO 4 , is added to the supernatant. This reaction forms a precipitate of cesium permanganate, CsMnO 4 . This precipitate may be separated from the residual solution to obtain cesium permanganate of high purity, which can be sold as a product or converted into other cesium compounds

  2. Cesium-137

    Ammerich, Marc; Frot, Patricia; Gambini, Denis-Jean; Gauron, Christine; Moureaux, Patrick; Herbelet, Gilbert; Lahaye, Thierry; Pihet, Pascal; Rannou, Alain


    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  3. Process for recovering cesium from cesium alum

    Mein, P.G.


    Cesium is recovered from cesium alum, CsAl(SO 4 ) 2 , by an aqueous conversion and precipitation reaction using a critical stoichiometric excess of a water-soluble permanganate to form solid cesium permanganate (CsMnO 4 ) free from cesium alum. The other metal salts remain in solution, providing the final pH does not cause hydroxides of aluminium or iron to form. The precipitate is separated from the residual solution to obtain CsMnO 4 of high purity

  4. Decorporation of cesium-137

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C.


    Cesium radio-isotopes, especially cesium-137 ( 137 Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137 Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137 Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137 Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  5. Methods of producing cesium-131

    Meikrantz, David H; Snyder, John R


    Methods of producing cesium-131. The method comprises dissolving at least one non-irradiated barium source in water or a nitric acid solution to produce a barium target solution. The barium target solution is irradiated with neutron radiation to produce cesium-131, which is removed from the barium target solution. The cesium-131 is complexed with a calixarene compound to separate the cesium-131 from the barium target solution. A liquid:liquid extraction device or extraction column is used to separate the cesium-131 from the barium target solution.

  6. Cesium glass irradiation sources

    Plodinec, M.J.


    The precipitation process for the decontamination of soluble SRP wastes produces a material whose radioactivity is dominated by 137 Cs. Potentially, this material could be vitrified to produce irradiation sources similar to the Hanford CsCl sources. In this report, process steps necessary for the production of cesium glass irradiation sources (CGS), and the nature of the sources produced, are examined. Three options are considered in detail: direct vitrification of precipitation process waste; direct vitrification of this waste after organic destruction; and vitrification of cesium separated from the precipitation process waste. Direct vitrification is compatible with DWPF equipment, but process rates may be limited by high levels of combustible materials in the off-gas. Organic destruction would allow more rapid processing. In both cases, the source produced has a dose rate of 2 x 10 4 rads/hr at the surface. Cesium separation produces a source with a dose rate of 4 x 10 5 at the surface, which is nearer that of the Hanford sources (2 x 10 6 rads/hr). Additional processing steps would be required, as well as R and D to demonstrate that DWPF equipment is compatible with this intensely radioactive material

  7. Recovery of cesium

    Izatt, Reed M.; Christensen, James J.; Hawkins, Richard T.


    A process of recovering cesium ions from mixtures of ions containing them and other ions, e.g., a solution of nuclear waste materials, which comprises establishing a separate source phase containing such a mixture of ions, establishing a separate recipient phase, establishing a liquid membrane phase in interfacial contact with said source and recipient phases, said membrane phase containing a ligand, preferably a selected calixarene as depicted in the drawing, maintaining said interfacial contact for a period of time long enough to transport by said ligand a substantial portion of the cesium ion from the source phase to the recipient phase, and recovering the cesium ion from the recipient phase. The separation of the source and recipient phases may be by the membrane phase only, e.g., where these aqueous phases are emulsified as dispersed phases in a continuous membrane phase, or may include a physical barrier as well, e.g., an open-top outer container with an inner open-ended container of smaller cross-section mounted in the outer container with its open bottom end spaced from and above the closed bottom of the outer container so that the membrane phase may fill the outer container to a level above the bottom of the inner container and have floating on its upper surface a source phase and a recipient phase separated by the wall of the inner container as a physical barrier. A preferred solvent for the ligand is a mixture of methylene chloride and carbon tetrachloride.

  8. Cesium reservoir and interconnective components


    The program objective is to demonstrate the technology readiness of a TFE (thermionic fuel element) suitable for use as the basic element in a thermionic reactor with electric power output in the 0.5 to 5.0 MW range. A thermionic converter must be supplied with cesium vapor for two reasons. Cesium atoms adsorbed on the surface of the emitter cause a reduction of the emitter work function to permit high current densities without excessive heating of the emitter. The second purpose of the cesium vapor is to provide space-charge neutralization in the emitter-collector gap so that the high current densities may flow across the gap unattenuated. The function of the cesium reservoir is to provide a source of cesium atoms, and to provide a reserve in the event that cesium is lost from the plasma by any mechanism. This can be done with a liquid cesium metal reservoir in which case it is heated to the desired temperature with auxiliary heaters. In a TFE, however, it is desirable to have the reservoir passively heated by the nuclear fuel. In this case, the reservoir must operate at a temperature intermediate between the emitter and the collector, ruling out the use of liquid reservoirs. Integral reservoirs contained within the TFE will produce cesium vapor pressures in the desired range at typical electrode temperatures. The reservoir material that appears to be the best able to meet requirements is graphite. Cesium intercalates easily into graphite, and the cesium pressure is insensitive to loading for a given intercalation stage. The goals of the cesium reservoir test program were to verify the performance of Cs-graphite reservoirs in the temperature-pressure range of interest to TFE operation, and to test the operation of these reservoirs after exposure to a fast neutron fluence corresponding to seven year mission lifetime. In addition, other materials were evaluated for possible use in the integral reservoir

  9. Cesium-137. Environment. Man

    Moiseev, A.A.


    Analysis of all main sourses of cerium-137 formation and intake into the external medium is given. Special attention is paid to the estimation of possible influence of rapidly developing nuclear power industry on contamination of the external medium by the radionuclide. Levels of contamination of the external medium by cerium-137, main regularities of its migration through food chains, levels of its intake and accumulation in population's organisms in USSR and its separate regions, are considered. Great attention is paid to the control methods of external environmental contamination by cesium-137 and to its measurements in human body

  10. Mineral resource of the month: cesium

    Angulo, Marc A.


    The article offers information on cesium, a golden alkali metal derived from the Latin word caesium which means bluish gray. It mentions that cesium is the first element discovered with the use of spectroscopy. It adds that the leading producer and supplier of cesium is Canada and there are 50,000 kilograms of cesium consumed of the world in a year. Moreover, it states that only 85% of the cesium formate can be retrieved and recycled.

  11. ''Crown molecules'' for separating cesium

    Dozol, J.F.; Lamare, V.


    After the minor actinides, the second category of radionuclides that must be isolated to optimize nuclear waste management concerns fission products, especially two cesium isotopes. If the cesium-135 isotope could be extracted, it could subsequently be transmuted or conditioned using a tailor-made process. Eliminating the 137 isotope from reprocessing and nuclear facility-dismantling waste would allow to dispose of most of this waste in near-surface facilities, and simply process the small remaining quantity containing long-lived elements. CEA research teams and their international partners have thought up crown molecules that could be used to pick out the cesium and meet these objectives. (authors)

  12. Cesium diffusion in graphite

    Evans, R.B. III; Davis, W. Jr.; Sutton, A.L. Jr.


    Experiments on diffusion of 137 Cs in five types of graphite were performed. The document provides a completion of the report that was started and includes a presentation of all of the diffusion data, previously unpublished. Except for data on mass transfer of 137 Cs in the Hawker-Siddeley graphite, analyses of experimental results were initiated but not completed. The mass transfer process of cesium in HS-1-1 graphite at 600 to 1000 0 C in a helium atmosphere is essentially pure diffusion wherein values of (E/epsilon) and ΔE of the equation D/epsilon = (D/epsilon) 0 exp [-ΔE/RT] are about 4 x 10 -2 cm 2 /s and 30 kcal/mole, respectively

  13. Process for recovering cesium from pollucite

    Mein, P.G.


    Cesium is recovered from a cesium-bearing mineral such as pollucite by extraction with hydrochloric acid to obtain an extract of cesium chloride and other alkali metal and polyvalent metal chlorides. The iron and aluminum chlorides can be precipitated as the hydroxides and separated from the solution of the alkali metal chlorides to which is added potassium permanganate or other water-soluble permanganate to selectively precipitate cesium permanganate. The cesium precipitate is then separated from the residual solution containing the metal chlorides. The cesium permanganate, which is in a very pure form, can be converted to other cesium compounds by reaction with a reducing agent to obtain cesium carbonate and cesium delta manganese dioxide

  14. Cesium Concentration in MCU Solvent

    Walker, D


    During Modular Caustic-Side Solvent Extraction (CSSX) Unit (MCU) operations, Cs-137 concentrations in product streams will vary depending on the location in the process and on the recent process conditions. Calculations of cesium concentrations under a variety of operating conditions reveal the following: (1) Under nominal operations with salt solution feed containing 1.1 Ci Cs-137 per gallon, the maximum Cs-137 concentration in the process will occur in the strip effluent (SE) and equal 15-16.5 Ci/gal. (2) Under these conditions, the majority of the solvent will contain 0.005 to 0.01 Ci/gal, with a limited portion of the solvent in the contactor stages containing ∼4 Ci/gal. (3) When operating conditions yield product near 0.1 Ci Cs-137/gal in the decontaminated salt solution (DSS), the SE cesium concentration will be the same or lower than in nominal operations, but majority of the stripped solvent will increase to ∼2-3 Ci/gal. (4) Deviations in strip and waste stream flow rates cause the largest variations in cesium content: (a) If strip flow rates deviate by -30% of nominal, the SE will contain ∼23 Ci/gal, although the cesium content of the solvent will increase to only 0.03 Ci/gal; (b) If strip flow rate deviates by -77% (i.e., 23% of nominal), the SE will contain 54 Ci/gal and solvent will contain 1.65 Ci/gal. At this point, the product DSS will just reach the limit of 0.1 Ci/gal, causing the DSS gamma monitors to alarm; and (c) Moderate (+10 to +30%) deviations in waste flow rate cause approximately proportional increases in the SE and solvent cesium concentrations. Recovery from a process failure due to poor cesium stripping can achieve any low cesium concentration required. Passing the solvent back through the contactors while recycling DSS product will produce a ∼70% reduction during one pass through the contactors (assuming the stripping D value is no worse than 0.36). If the solvent is returned to the solvent hold tank (containing additional

  15. Cesium removal and kinetics equilibrium: Precipitation kinetics

    Barnes, M.J.


    This task consisted of both non-radioactive and radioactive (tracer) tests examining the influence of potentially significant variables on cesium tetraphenylborate precipitation kinetics. The work investigated the time required to reach cesium decontamination and the conditions that affect the cesium precipitation kinetics

  16. Process for cesium decontamination and immobilization

    Komarneni, Sridhar; Roy, Rustum


    Cesium can be selectively recovered from a nuclear waste solution containing cesium together with other metal ions by contact with a modified phlogopite which is a hydrated, sodium phlogopite mica. Once the cesium has entered the modified phlogopite it is fixed and can be safely stored for long periods of time.

  17. Process for cesium decontamination and immobilization

    Komarneni, S.; Roy, R.


    Cesium can be selectively recovered from a nuclear waste solution containing cesium together with other metal ions by contact with a modified phlogopite which is a hydrated, sodium phlogopite mica. Once the cesium has entered the modified phlogopite it is fixed and can be safely stored for long periods of time. 6 figs., 2 tabs.

  18. Cesium in the nutrient cycle

    Rantavaara, A.


    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland

  19. Cesium transport data for HTGR systems

    Myers, B.F.; Bell, W.E.


    Cesium transport data on the release of cesium from HTGR fuel elements are reviewed and discussed. The data available through 1976 are treated. Equations, parameters, and associated variances describing the data are presented. The equations and parameters are in forms suitable for use in computer codes used to calculate the release of metallic fission products from HTGR fuel elements into the primary circuit. The data cover the following processes: (1) diffusion of cesium in fuel kernels and pyrocarbon, (2) sorption of cesium on fuel rod matrix material and on graphite, and (3) migration of cesium in graphite. The data are being confirmed and extended through work in progress

  20. Cesium in the nutrient cycle. Cesium metsaen ravinnekierrossa marjojen ja sienten cesium ei vaehene

    Rantavaara, A


    Most radioactive cesium in forests is deposited in soil, from which it passes into berries and mushrooms, and further to game. The cesium contents of Finnish berries and mushrooms vary depending on the intensity of Chernobyl fallout. Northern Haeme, Pirkanmaa and parts of central Finland received the most fallout. Weather conditions and the environmental factors, and other circumstances during the growth period, also affect the contents. However, consumption of wild berries, mushrooms and game need not be restricted because of radioactivity anywhere in Finland.

  1. Decorporation of cesium-137; Decorporation du cesium-137

    Le Fleche, Ph; Destombe, C; Grasseau, A; Mathieu, J; Chancerelle, Y; Mestries, J C [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)


    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  2. Decorporation of cesium-137; Decorporation du cesium-137

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)


    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  3. Method for primary containment of cesium wastes

    Angelini, P.; Arnold, W.D.; Blanco, R.E.; Bond, W.D.; Lackey, W.J.; Stinton, D.P.


    A method for producing a cesium-retentive waste form, characterized by a high degree of compositional stability and mechanical integrity, is provided by subjecting a cesium-loaded zeolite to heat under conditions suitable for stabilizing the zeolite and immobilizing the cesium, and coating said zeolite for sufficient duration within a suitable environment with at least one dense layer of pyrolytic carbon to seal therein said cesium to produce a final, cesium-bearing waste form. Typically, the zeolite is stabilized and the cesium immobilized in less than four hours by confinement within an air environment maintained at about 600 0 C. Coatings are thereafter applied by confining the calcined zeolite within a coating environment comprising inert fluidizing and carbon donor gases maintained at 1,000* C. For a suitable duration

  4. Cesium-137, a drama recounted

    Vieira, Suzane de Alencar


    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  5. Myocardial imaging with cesium-130

    Harper, P.V.; Resnekov, L.; Stark, V.; Odeh, N.


    Recently comparative studies using nitrogen-13 ammonia and cesium-130 have shown strikingly different myocardial localization patterns in the same subjects with ischemic heart disease. Initial localization of ammonia, an avidly extracted agent, reflects the perfusion pattern in viable myocardial tissue. The myocardial localization of cesium ion, taking place more slowly over 15 to 20 minutes, is apparently much less flow dependent, causing uptake defects shown with ammonia to be largely filled in. Cesium thus appears to provide information on the extent of the viable myocardial mass, apart from perfusion. Cesium-130 (t1/2 30 m) decays by positron emission and electron capture. The whole body radiation absorbed dose, assuming uniform distribution, is 24 mrad/mCi. While abundant production of Cs-130 results from proton bombardment of natural xenon [Xe-130(rho,n)Cs-130] at 15 MeV, small amounts of Cs-129, -131, and -132 are also produced, and enriched Xe-130 is not available. Alternatively almost completely uncontaminated Cs-130 is available by alpha bombardment of natural I-127. Anhydrous sodium iodide is dissolved in acetone and a thin layer (≅20 mg per centimeter squared) is evaporated onto the gold plated tip of the internal target backing which is oscillated vertically to spread out the area upon which the beam is incident. The target surface is inclined 2.5 degrees to the beam giving a power density of about 400 watts per centimeter squared at 100μA which is adequately handled by water cooling. A 30-minute bombardment yields 4 to 5 mCi of Cs-130 which is dissolved directly from the target. This approach appears to offer a new and helpful method for evaluating ischemic heart disease by permitting evaluation of viable myocardial mass

  6. Cesium migration in LMFBR fuel pins

    Karnesky, R.A.; Jost, J.W.; Stone, I.Z.


    The factors affecting the axial migration of cesium in mixed oxide fuel pins and the effects of cesium migration on fuel pin performance are examined. The development and application of a correlated model which will predict the occurrence of cesium migration in a mixed oxide (75 w/o UO 2 + 25 w/o PuO 2 ) fuel pins over a wide range of fabrication and irradiation conditions are described

  7. Electrically switched cesium ion exchange

    Lilga, M.A.; Orth, R.J.; Sukamto, J.P.H.; Schwartz, D.T.; Haight, S.M.; Genders, J.D.


    Electrically Switched Ion Exchange (ESIX) is a separation technology being developed as an alternative to conventional ion exchange for removing radionuclides from high-level waste. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution are controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. A case study for the KE Basin on the Hanford Site was conducted based on the results of the development testing. Engineering design baseline parameters for film deposition, film regeneration, cesium loading, and cesium elution were used for developing a conceptual system. Order of magnitude cost estimates were developed to compare with conventional ion exchange. This case study demonstrated that KE Basin wastewater could be processed continuously with minimal secondary waste and reduced associated disposal costs, as well as lower capital and labor expenditures

  8. Cesium heat-pipe thermostat

    Wu, F.; Song, D.; Sheng, K.; Wu, J. [Changcheng Institute of Metrology and Measurement, 100095, Beijing (China); Yi, X. [China National South Aviation industry CO., LTD., 412002, Hunan (China); Yu, Z. [Dalian Jinzhou Institute of Measurement and Testing, 116100, Liaoning (China)


    In this paper the authors report a newly developed Cesium Heat-Pipe Thermostat (Cs HPT) with the operation range of 400 °C to 800 °C. The working medium is cesium (Cs) of 99.98% purity and contains no radioisotope. A Cs filing device is developed which can prevent Cs being in contact with air. The structural material is stainless steel. A 5000 h test has been made to confirm the compatibility between cesium and stainless steel. The Cs HPT has several thermometer wells of 220mm depth with different diameters for different sizes of thermometers. The temperature uniformity of the Cs HPT is 0.06 °C to 0.20 °C. A precise temperature controller is used to ensure the temperature fluctuation within ±0.03 °C. The size of Cs HPT is 380mm×320mm×280mm with foot wheels for easy moving. The thermostat has been successfully used for the calibration of industrial platinum resistance thermometers and thermocouples.

  9. Extraction of radioactive cesium from tea leaves

    Yano, Yukiko; Kubo, M. Kenya; Higaki, Shogo; Hirota, Masahiro; Nomura, Kiyoshi


    Radioactive contamination of foodstuffs attributed to the Fukushima Daiichi nuclear disaster has become a social problem. This study investigated the extraction of radioactive cesium from the contaminated leaves to the tea. The green tea was brewed twice reusing the same leaves to study the difference in extraction of cesium between the first and second brew. Moreover, the extraction of cesium was studied in correlation to brewing time. The concentration of radioactive cesium was determined with gamma spectrometry, and the concentration of caffeine was determined with absorption spectrometry. About 40% of cesium was extracted from leaves in the first brew, and about 80% was extracted in the second brew. The extraction of cesium increased over time, and it reached about 80% after 10 minutes brew. The ratio of radioactive cesium to caffeine decreased linearly over time. This study revealed that the extraction of cesium was higher for the second brew, and a rapid increase in extraction was seen as the tea was brewed for 6 minutes and more. Therefore, the first brew of green tea, which was brewed within 5 minutes, contained the least extraction of radioactive cesium from the contaminated leaves. (author)

  10. Separation of cesium and strontium with zeolites

    Kanno, T; Hashimoto, H [Tohoku Univ., Sendai (Japan). Research Inst. of Mineral Dressing and Metallurgy


    The basic studies of separation of cesium and strontium were made with specimens of zeolite, which are synthetic zeolites A, X and Y; synthetic mordenite; natural mordenite; and clinoptilolite. Ammonium chloride was used as eluent, because it was considered to be a most appropriate eluent in alkaline chlorides. Cesium was easily eluted from the zeolites A and X by ammonium chloride solution, but it was difficult to elute from the synthetic mordenite, natural mordenite and clinoptilolite by ammonium chloride solution, but it was difficult to elute from the zeolites A and X. The zeolite Y is the only one zeolite among these zeolites from which both of cesium and strontium were easily eluted by ammonium chloride solution. Strontium could be separated from cesium with zeolites by formation of Sr-EDTA chelate at pH above 11. In this process, cesium was only exchanged in zeolite column, but strontium flow out from it.

  11. Separation of cesium and strontium with zeolites

    Kanno, Takuji; Hashimoto, Hiroyuki


    The basic studies of separation of cesium and strontium were made with specimens of zeolite, which are synthetic zeolites A, X and Y; synthetic mordenite; natural mordenite; and clinoptilolite. Ammonium chloride was used as eluent, because it was considered to be a most appropriate eluent in alkaline chlorides. Cesium was easily eluted from the zeolites A and X by ammonium chloride solution, but it was difficult to elute from the synthetic mordenite, natural mordenite and clinoptilolite by ammonium chloride solution, but it was difficult to elute from the zeolites A and X. The zeolite Y is the only one zeolite among these zeolites from which both of cesium and strontium were easily eluted by ammonium chloride solution. Strontium could be separated from cesium with zeolites by formation of Sr-EDTA chelate at pH above 11. In this process, cesium was only exchanged in zeolite column, but strontium flow out from it. (auth.)

  12. Radiochemical determination of cesium-137 in seawater

    Cunha, I.I.L.; Munita, C.S.; Paiva, R.P.


    Seawater samples were collected from the Atlantic Ocean, in the vicinity of Ubatuba (Sao Paulo State - Brazil), acidified to pH 1 and stored in polyethylene containers. Cesium was precipitated with ammonium phospho molybdate (AMP), synthesized in our laboratory. The elements potassium and rubidium present in the seawater are also coprecipitated by AMP and adequate decontamination of the cesium is made by preparing a column by mixing Cs-137 AMP precipitate and asbestos. The interfering elements were eluted with 1.0 M ammonium nitrate solution whereas cesium was eluted with 1.0 M sodium hydroxide solution. Cesium was reprecipitated by acidifying the solution with concentrated hydrochloric acid. The overall chemical yield of cesium was of 75%. (author)

  13. Iotech cesium capsule recovery abstract

    Stevens, J.; Higgins, D.


    This report has been prepared to detail the project operations performed by OHM Remediation Services Corp. (OHM) under contract to the Westinghouse Hanford Company (WHC) for the removal and transfer of 309 cesium sources from the lotech Inc. Facility in Northglenn, Colorado, to the Department of Energy Site in Hanford, Washington. The activities covered by this report were performed between October of 1993 and August of 1995. The report includes the following major sections: (1) Project Description, (2) Project Organization, (3) Major Project Tasks, (4) Industrial and Radiological Safety, (5) Personnel Exposures, (6) Quality Assurance, (7) Scheduling/Costs, and (8) Lessons Learned

  14. Multiphoton ionization of atomic cesium

    Compton, R.N.; Klots, C.E.; Stockdale, J.A.D.; Cooper, C.D.


    We describe experimental studies of resonantly enhanced multi-photon ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photo-electron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photo-ionization signal. For both ns and np states the ''field induced'' MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength

  15. Multiphoton ionization of atomic cesium

    Compton, R.N.; Klots, C.E.; Stockdale, J.A.D.; Cooper, C.D.


    We describe experimental studies of resonantly enhanced multiphoton ionization (MPI) of cesium atoms in the presence and absence of an external electric field. In the zero-field studies, photoelectron angular distributions for one- and two-photon resonantly enhanced MPI are compared with the theory of Tang and Lambropoulos. Deviations of experiment from theory are attributed to hyperfine coupling effects in the resonant intermediate state. The agreement between theory and experiment is excellent. In the absence of an external electric field, signal due to two-photon resonant three-photon ionization of cesium via np states is undetectable. Application of an electric field mixes nearby nd and ns levels, thereby inducing excitation and subsequent ionization. Signal due to two-photon excitation of ns levels in field-free experiments is weak due to their small photoionization cross section. An electric field mixes nearby np levels which again allows detectable photoionization signal. For both ns and np states the field induced MPI signal increases as the square of the electric field for a given principal quantum number and increases rapidly with n for a given field strength. Finally, we note that the classical two-photon field-ionization threshold is lower for the case in which the laser polarization and the electric field are parallel than it is when they are perpendicular. 22 references, 11 figures

  16. Thermal properties of cesium molybdate

    Minato, Kazuo; Fukuda, Kousaku; Takano, Masahide; Sato, Seichi; Ohashi, Hiroshi


    Cesium is one of the most important fission products to aid in the understanding and prediction of the behavior of oxide nuclear fuels because of its high mobility, chemical reactivity, and large yield. In postirradiation examinations of the Phoenix reactor fuel pins, the accumulation of cesium and molybdenum between the fuel pellet and cladding was observed, though the chemical form was not determined. In the thermodynamic analyses of chemical states of fission products, Cs 2 MoO 4 was often predicted to exist as a stable compound in oxide fuels. The Cs 2 MoO 4 compound is thermodynamically stable under the conditions of light water reactors, fast breeder reactors, and high-temperature gas-cooled reactors. In the Cs-Mo-O system several phases have been found, and the structural and thermodynamic properties were studied. At room temperature, Cs 2 MoO 4 has an orthorhombic structure and a phase transition occurs at 841 K to a hexagonal structure. Both structures are expected to exist in the fuel, depending on the fuel temperature. However, no data has been available on the thermal properties of CS 2 MoO 4 . In the current work, the thermal expansion and thermal conductivity of Cs 2 MoO 4 were determined, which are the basic data needed to understand and predict the fuel/clad mechanical interaction and fuel temperature

  17. Application of Cesium isotopes in daily life

    Jordao, B.O.; Quaresma, D.S.; Carvalho, R.J.; Peixoto, J.G.P.


    In the world of science, the desire of the scientific community to discover new chemical elements is crucial for the development of new technologies in various fields of knowledge. And the main chemical element addressed by this article is Cesium, but specifically 133 Cesium isotope and radioisotope 137 Cesium, exemplifying their physical and chemical characteristics, and their applications. This article will also show how these isotopes have provided researchers a breakthrough in the field of radiological medicine and in time and frequency metrology. (author)

  18. Cesium Eluate Analytical Data Evaluation

    Pierce, R.A.


    Bechtel National Inc. (BNI) is using IBC Company's SuperLigand ion exchange resins to separate Cs and Tc from low-activity waste (LAW) solutions (IBC-1996). Cesium is removed using the SuperLig(R) 644 resin. The resin is then eluted after each use cycle with 0.5M nitric acid solution. BNI is planning to evaporate the Cs eluate solution to reduce the storage volume and recover eluate for re-use. The primary issue associated with evaporation is end point, or salt matrix solubility. To preclude formation of solids during the storage of evaporator products, an additional criteria has been set that limits the concentration of the evaporator bottoms to 80 percent of saturation at 25 degrees C. As a result, an understanding of the effects of constituent species on the bulk solubility must be developed prior to effective evaporator operations

  19. Cesium-137: A physiological disruptor?

    Souidi, Maamar; Grison, Stephane; Dublineau, Isabelle; Aigueperse, Jocelyne; Lestaevel, Philippe


    Today, radiation protection is a major issue for the nuclear industry throughout the world, particularly in France. The 2011 disaster of Fukushima Dai-ichi has brought back to public attention questions about the risks associated with nuclear power for civilian purposes. The risk of accidental release of radioactive molecules, including cesium-137 ( 137 Cs), from these facilities cannot be completely eliminated. The non-cancer-related health consequences of chronic exposure to this radionuclide remain poorly understood. After absorption, cesium is distributed throughout the body. The toxicity of 137 Cs is due mainly to its radiological properties. Studies in humans report that 137 Cs impairs the immune system and induces neurological disorders. Children appear more susceptible than adults to its toxic effects. In animals, and most particularly in rodents, low-dose internal contamination disrupts the sleep-wake cycle, but without behavioural disorders. Impairment of the cardiovascular system has also been observed. Physiologic systems such as the metabolism of vitamin D, cholesterol and steroid hormones are altered, although without leading to the emergence of diseases with clinical symptoms. Recently, a metabolomics study based on contamination levels comparable to those around Chernobyl after the accident showed that it is possible to identify individual rats chronically exposed to low doses of 137 Cs, even though the exposure was too low to affect the standard clinical markers. In conclusion, the scientific evidence currently available, particularly that from experimental animal models exposed to chronic contamination, suggests that 137 Cs is likely to affect many physiologic and metabolic functions. Thus, it could contribute, with other artificial substances in the environment, to increasing the risk of developing non-cancer diseases in some regions. (authors)

  20. Cement materials for cesium and iodine confinement

    Nicolas, G.; Lequeux, N.; Boch, P.; Prene, S.


    The following topics were dealt with: radioactive waste storage, cement materials reacting with radioactive cesium and iodine, chemical barrier formation against radioactive pollution, ceramization, long term stability, XRD, PIXE analysis

  1. Cesium levels in foodstuffs fall slowly

    Rantavaara, A.


    Since spring 1986, radioactive decay has reduced the total amount of radioactive cesium 137 in the Finnish environment, originating in Chernobyl, by 17 per cent. The cesium content in fish keeps falling at a diminishing rate, depending on the species of fish and environmental factors. The use of fish from lakes need not be restricted anymore. The cesium contents of game, mushrooms and wild berries have remained steady for some years now. The same is true for agricultural produce. The contents in milk and meat still keep falling slowly. Most of the cesium ingested by finns comes from fish, then from game, reindeer and gathered foods; the lowest amounts are received from agricultural products. (orig.)

  2. Method of processing radioactive cesium liquid wastes

    Nishijima, Hiroaki; Asaoka, Sachio; Kondo, Tadami; Suzuki, Isao.


    Purpose: To convert and settle cesium, mainly, Cs-137 in liquid wastes in the form of pollucites, that is, cesium-containing ores. Constitution: Water, silica, alumina and alkali metal source are mixed with radioactive liquid wastes containing cesium as the main metal element ingredient, to which an onium compound is further added and they are brought into reaction till pollucite ores (Cs 16 (Al 16 Si 32 O 96 )) are formed. Since most portion of cesium is thus settled in the form of pollucites, storage safety can be attained. Further, the addition of the onium compound can moderate the condition and shorten the time till the pollucite ores are formed. The onium compound usable herein includes tetramethyl ammonium. (Kamimura, M.)

  3. Extraction of cesium from acid solutions

    Katykhin, G.S.; Simonov, A.S.


    The extraction of cesium from acidic solutions is studied. Halogen-substituted carboxylic acids were chosen for the aqueous phase and nitrobenzene the diluent. The distribution coefficients are determined by the use of radioactive tracers 134 Cs and 137 Cs. It is believed that large singly charged anions of strong acids are necessary for the extraction of cesium. Metal halide acids are selected for supplying the anions

  4. Cesium ion bombardment of metal surfaces

    Tompa, G.S.


    The steady state cesium coverage due to cesium ion bombardment of molybdenum and tungsten was studied for the incident energy range below 500 eV. When a sample is exposed to a positive ion beam, the work function decreases until steady state is reached with a total dose of less than ≅10 16 ions/cm 2 , for both tungsten and molybdenum. A steady state minimum work function surface is produced at an incident energy of ≅100 eV for molybdenum and at an incident energy of ≅45 eV for tungsten. Increasing the incident energy results in an increase in the work function corresponding to a decrease in the surface coverage of cesium. At incident energies less than that giving the minimum work function, the work function approaches that of cesium metal. At a given bombarding energy the cesium coverage of tungsten is uniformly less than that of molybdenum. Effects of hydrogen gas coadsorption were also examined. Hydrogen coadsorption does not have a large effect on the steady state work functions. The largest shifts in the work function due to the coadsorption of hydrogen occur on the samples when there is no cesium present. A theory describing the steady-state coverage was developed is used to make predictions for other materials. A simple sticking and sputtering relationship, not including implantation, cannot account for the steady state coverage. At low concentrations, cesium coverage of a target is proportional to the ratio of (1 - β)/γ where β is the reflection coefficient and γ is the sputter yield. High coverages are produced on molybdenum due to implantation and low backscattering, because molybdenum is lighter than cesium. For tungsten the high backscattering and low implantation result in low coverages

  5. Separation of cesium from aqueous solutions using alkylated tetraaryl borates

    Feldmaier, F.


    The water solubility of cesium tetraaryl borates was lowered by introducing hydrophobic aliphatic side chains into corresponding acid-resistant fluorosubstituted tetraaryl borates. This improved cesium spearability both in precipitation and in extraction from aqueous solutions. (orig.) [de

  6. 13 CFR 113.310 - Recruitment.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...

  7. Cesium vapor cycle for an advanced LMFBR

    Fraas, A.P.


    A review indicates that a cesium vapor topping cycle appears attractive for use in the intermediate fluid circuit of an advanced LMFBR designed for a reactor outlet temperature of 1250 0 F or more and would have the following advantages: (1) it would increase the thermal efficiency by about 5 to 10 points (from approximately 40 percent to approximately 45 to 50 percent) thus reducing the amount of waste heat rejected to the environment by 15 to 30 percent. (2) the higher thermal efficiency should reduce the overall capital cost of the reactor plant in dollars per kilowatt. (3) the cesium can be distilled out of the intermediate fluid circuit to leave it bone-dry, thus greatly reducing the time and cost of maintenance work (particularly for the steam generator). (4) the large volume and low pressure of the cesium vapor region in the cesium condenser-steam generator greatly reduces the magnitude of pressure fluctuations that might occur in the event of a leak in a steam generator tube, and the characteristics inherent in a condenser make it easy to design for rapid concentration of any noncondensibles that may form as a consequence of a steam leak into the cesium region so that a steam leak can be detected easily in the very early stages of its development

  8. Radioactive cesium in Finnish mushrooms

    Kostiainen, E.; Ylipieti, J.


    Surveillance of radioactive cesium in Finnish mushrooms was started in 1986 at STUK. Results of the surveillance programs carried out in Lapland and other parts of Finland are given in this report. More than 2000 samples of edible mushrooms have been analysed during 1986-2008. The 137 Cs detected in the mushrooms mainly originates from the 137 Cs deposition due to the accident at the Chernobyl nuclear power plant in 1986. The 137 Cs concentrations of mushrooms in the end of 1970s and in the beginning of 1980s varied from some ten to two hundred becquerels per kilogram originating from the nuclear weapon test period. The uneven division of the Chernobyl fallout is seen in the areal variation of 137 Cs concentrations of mushrooms, the 137 Cs concentrations being about tenfold in the areas with the highest deposition compared to those where the deposition was lowest. After the Chernobyl accident the maximum values in the 137 Cs concentrations were reached during 1987-88 among most species of mushrooms. The 137 Cs concentrations have decreased slowly, being in 2008 about 40 per cent of the maximum values. The 137 Cs concentrations may be tenfold in the mushroom species with high uptake of cesium (Rozites caperatus, Hygrophorus camarophyllus, Lactarius trivialis) compared to the species with low uptake (Albatrellus ovinus, Leccinum sp.) picked in the same area. The 137 Cs contents in certain species of commercial mushrooms in Finland still exceed the maximum permitted level, 600 Bq/kg, recommended to be respected when placing wild game, wild berries, wild mushrooms and lake fish on the market (Commission recommendation 2003/274/Euratom). Therefore, the 137 Cs concentrations of mushrooms should be measured before placing them on the market in the areas of the highest 137 Cs deposition, except for Albatrellus ovinus, Boletus sp. and Cantharellus cibarius. The 137 Cs concentrations of common commercial mushroom species, Cantharellus tubaeformis and Craterellus

  9. Cesium Salts of Phosphotungstic Acid: Comparison of Surface ...


    acidity and lowest solubility in reaction media in comparison with the other cesium content salts. KEYWORDS. Polyoxometalates, cesium ... insoluble salt of HPA is cesium salt of tungstophosphoric acid,. CsxH3-xPW12O40 (CsxPW), a ... of Cs2CO3, very fine particles (precipitates) were formed to make the solution milky.

  10. Cesium removal flow studies using ion exchange

    Lee, D.D.; Walker, J.F. Jr.; Taylor, P.A.


    Cesium and strontium radionuclides are a small fraction of the mainly sodium and potassium salts in underground storage tank supernatant at US Department of Energy (DOE) sites at Hanford, Oak Ridge, Savannah River, and Idaho that DOE must remediate. Cesium-137 ( 137 Cs) is the primary gamma radiation source in the dissolved tank waste at these sites, and its removal from the supernatant can reduce the hazard and waste classification of the treated waste reducing the further treatment and disposal costs. Several cesium removal sorbents have been developed by private industry and the US DOE's Office of Science and Technology. Several of these removal technologies have been previously tested in small batch and column tests using simulated and a few actual supernatant under DOE's Environmental Management (EM) programs including the Tanks Focus Area (TFA) and the Efficient Separations and Processing (ESP) Cross-Cutting Program

  11. Hanford waste encapsulation: strontium and cesium

    Jackson, R.R.


    The strontium and cesium fractions separated from high radiation level wastes at Hanford are converted to the solid strontium fluoride and cesium chloride salts, doubly encapsulated, and stored underwater in the Waste Encapsulation and Storage Facility (WESF). A capsule contains approximately 70,000 Ci of 137 Cs or 70,000 to 140,000 Ci of 90 Sr. Materials for fabrication of process equipment and capsules must withstand a combination of corrosive chemicals, high radiation dosages and frequently, elevated temperatures. The two metals selected for capsules, Hastelloy C-276 for strontium fluoride and 316-L stainless steel for cesium chloride, are adequate for prolonged containment. Additional materials studies are being done both for licensing strontium fluoride as source material and for second generation process equipment


    Rimshaw, S.J.


    A method is given for recovering Cs/sup 137/ from radioactive waste solutions together with extraneous impurities. Ammonium alum is precipitated in the waste solution. The alum, which carries the cesium, is separated from the supernatant liquid and then dissolved in water. The resulting aqueous solution is then provided with a source of hydroxyl ions, which precipitates aluminum as the hydroxide, and the aluminum hydroxide is separated from the resulting liquid. This liquid, which contains anionic impurities together with ammonium and cesium, is passed through an anion exchange resin bed which removes the anionic impurities. The ammonium in the effluent is removed by destructive distiilation, leaving a substantiaily pure cesium salt in the effluent.

  13. Microbial accumulation of uranium, radium, and cesium

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; North, S.E.


    Diverse microbial species varied considerably in their ability to accumulate uranium, cesium, and radium. Mechanistic differences in uranium uptake by Saccharomyces cerevisiae and Pseudomonas aeruginosa were indicated. S. serevisiae exhibited a slow (hours) surface accumulation of uranium which was subject to environmental factors, while P. aeruginosa accumulated uranium rapidly (minutes) as dense intracellular deposits and did not appear to be affected by environmental parameters. Metabolism was not required for uranium uptake by either organism. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several species tested

  14. Cesium injection system for negative ion duoplasmatrons

    Kobayashi, M.; Prelec, K.; Sluyters, T.J.


    A design for admitting cesium vapor into a hollow hydrogen plasma discharge in a duoplasmatron ion source for the purpose of increasing the negative hydrogen ion output current is described. 60 mA beam currents for negative hydrogen ions are reported

  15. Cesium and Strontium Separation Technologies Literature Review

    T. A. Todd; T. A. Todd; J. D. Law; R. S. Herbst


    Integral to the Advanced Fuel Cycle Initiative (AFCI) Program’s proposed closed nuclear fuel cycle, the fission products cesium and strontium in the dissolved spent nuclear fuel stream are to be separated and managed separately. A comprehensive literature survey is presented to identify cesium and strontium separation technologies that have the highest potential and to focus research and development efforts on these technologies. Removal of these high-heat-emitting fission products reduces the radiation fields in subsequent fuel cycle reprocessing streams and provides a significant short-term (100 yr) heat source reduction in the repository. This, along with separation of actinides, may provide a substantial future improvement in the amount of fuel that could be stored in a geologic repository. The survey and review of the candidate cesium and strontium separation technologies are presented herein. Because the AFCI program intends to manage cesium and strontium together, technologies that simultaneously separate both elements are of the greatest interest, relative to technologies that separate only one of the two elements.

  16. Conceptual design of cesium removal device for ITER NBI maintenance

    Oka, Kiyoshi; Shibanuma, Kiyoshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment


    Cesium is required in order to generate a stable negative ion of hydrogen in an ion source of the neutral beam injector (NBI), which is one of the plasma-heating devices for International Thermonuclear Experimental Reactor (ITER). After long time operation of the NBI, the cesium deposits to the insulators supporting the electrode. Due to the deterioration of the insulation resistance, the continuous operation of the NBI will be difficult. In addition, the NBI device is activated by neutrons from D-T plasma, so that periodic removal and cleaning of the cesium on the insulators by remove handling is required. A study of the cesium removal scenario and the device is therefore required considering remote handling. In this report, a cesium removal procedure and conceptual design of the cesium removal device using laser ablation technique are studied, and the feasibility of the laser ablation method is shown. (author)

  17. Photon interactions in a cesium beam

    Nygaard, K.J.; Jones, J.D.; Hebner, R.E. Jr


    Photoionization of excited cesium atoms in the 6 2 P3/2 - state has been studied in a triple crossed-beam experiment. A thermal beam of cesium atoms was intersected by one photon beam of wavelength 8521A that served to excite the atoms and another photon beam with wavelengths below 5060A that served to ionize the excited atoms. The resulting ions were detected with a channel electron multiplier. All background effects were discriminated against by chopping the beam of exciting radiation and by analyzing the net count rate with digital synchronous techniques. The relative cross section for photoionization fo Cs(6 2 P3/2) has been measured from threshold (5060A) to 2500A. The results fall off faster than the theoretical calculations of Weisheit and Norcross

  18. Protection of cesium-antimony photocathodes

    Buzulutskov, A.; Breskin, A.; Chechik, R.; Prager, M.; Shefer, E.


    In order to operate gaseous photomultipliers in the visible range it was suggested to protect sensitive photocathodes against contact to air and counting gases by their coating with a thin solid dielectric film. We present data on coating of cesium- antimony photocathodes with alkali-halide (NaI, CsI, CsF, NaF), oxide (SiO) and organic (hexatriacontane, calcium stearate) films. The photoelectron transmission through these films and their protection capability have been studied in detail. Cesium-antimony photocathodes are shown to withstand exposure to considerable doses of oxygen and dry air when coated with Nal films. This opens ways to their operation in gas media. (authors), 11 refs., 6 figs

  19. Cesium titanium silicate and method of making

    Balmer, Mari L.


    The invention is the new material, a ternary compound of cesium, silica, and titania, together with a method of making the ternary compound, cesium titanium silicate pollucite. More specifically, the invention is Cs.sub.2 Ti.sub.2 Si.sub.4 O.sub.13 pollucite which is a new crystalline phase representing a novel class of Ti-containing zeolites. Compositions contain relatively high Cs.sub.2 O and TiO.sub.2 loadings and are durable glass and ceramic materials. The amount of TiO.sub.2 and Cs.sub.2 that can be incorporated into these glasses and crystalline ceramics far exceeds the limits set for the borosilicate high level waste glass.

  20. Progress toward Brazilian cesium fountain second generation

    Bueno, Caio; Rodriguez Salas, Andrés; Torres Müller, Stella; Bagnato, Vanderlei Salvador; Varela Magalhães, Daniel


    The operation of a Cesium fountain primary frequency standard is strongly influenced by the characteristics of two important subsystems. The first is a stable frequency reference and the second is the frequency-transfer system. A stable standard frequency reference is key factor for experiments that require high accuracy and precision. The frequency stability of this reference has a significant impact on the procedures for evaluating certain systematic biases in frequency standards. This paper presents the second generation of the Brazilian Cesium Fountain (Br-CsF) through the opto-mechanical assembly and vacuum chamber to trap atoms. We used a squared section glass profile to build the region where the atoms are trapped and colled by magneto-optical technique. The opto-mechanical system was reduced to increase stability and robustness. This newest Atomic Fountain is essential to contribute with time and frequency development in metrology systems.

  1. Thermochemical evaluation and preparation of cesium uranates

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku; Sato, Seichi; Ohashi, Hiroshi.


    Two kinds of cesium uranates, Cs 2 UO 4 and Cs 2 U 2 O 7 , which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U 3 O 8 and Cs 2 CO 3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs 2 UO 4 and Cs 2 U 2 O 7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs 2 UO 4 and Cs 2 U 2 O 7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  2. Pilot unit for cesium-137 separation

    Raggenbass, A.; Quesney, M.; Fradin, J.; Dufrene, J.


    Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of 137 Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain 137 Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author) [fr

  3. Cesium legacy safety project management work plan

    Durham, J.S.


    This Management Work Plan (MWP) describes the process flow, quality assurance controls, and the Environment, Safety, and Health requirements of the Cesium Legacy Safety Project. This MWP provides an overview of the project goals and methods for repackaging the non-conforming Type W overpacks and packaging the CsCl powder and pellets. This MWP is not intended to apply to other activities associated with the CsCl Legacy Safety Program (i.e., clean out of South Cell)

  4. Cesium migration experiments in different media

    Tello, C.C.O. de


    The environmental impact caused by the radioactive waste disposal depends on many factors, mainly on the release pathways of the radionuclides from the waste product to the environment. The migration of the radioelements through the different barriers, which compose the disposal system, is considered the main via for this release. This paper describes the experiments carried out to improve the cemented waste quality, as well to assess the cesium migration in different media. (author)

  5. Investigations on cesium uranates. Pt. 7

    Cordfunke, E.H.P.


    The thermochemical properties of Cs 2 U 4 O 12 have been evaluated using new experimental data, including the low-temperature heat capacities, the enthalpy of formation at room temperature, and the high-temperature enthaply increments by drop calorimetry. From the results a section of the Cs-U-O phase diagram at 1000 K has been constructed showing the stability of the compound as a function of cesium and oxygen pressure. (orig.) [de

  6. Axial migratin of cesium in LMFBR fuel pins

    Karnesky, R.A.; Bridges, A.E.; Jost, J.W.


    A correlated model for quantitatively predicting the behavior of cesium in LMFBR fuel pins has been developed. This correlation was shown to be in good agreement with experimental data. It has been used to predict the behavior of cesium in the FFTF driver fuel and as the result of this analysis it has been shown that the accumulation of cesium in the insulator pellets at the ends of the fuel column will not be life limiting

  7. Cesium-137 retention in irops obtained from various soils

    Gulyakin, I.V.; Yudintseva, E.V.; Gorina, L.I.


    A non-station experiment has shown that the accumulation of cesium-137 in a plant yield depends on the type of soil. The highest contents of cesium-137 were found in the yield of plants from soddy-podzolic sandy loam soils, and the lowest- in those from leached chernozem. The accumulation of radiocesium in the yield of the basic produce strongly depended on the plant species. The amount of cesium-137 differed 5- to 7-fold in different crops


    de Steese, J. G.; Zollweg, R. J.


    The plasma-anode technique was used to observe anomalously high thermionic emission from a rhenium surface with small cesium coverage, where the work function of the composite surface is greater than the ionization potential of cesium. Data suggest that emission enhancement is caused by increased cesium coverage because of cesiumion trapping near the emitter surface under the influence of an ion-rich sheath. (auth)

  9. Sorption of cesium on titanium and zirconium phosphates

    Lebedev, V.N.; Mel'nik, N.A.; Rudenko, A.V.


    Titanium and zirconium phosphates were prepared from mineral raw materials of the Kola Peninsula. Their capability to recover cesium cations from the model solutions and liquid radioactive waste (LRW) was studied. Titanium phosphate prepared from solutions formed by titanite breakdown demonstrates greater distribution coefficients of cesium as compared to zirconium phosphate. Titanium phosphate as a cheaper agent featuring greater sorption capacity was recommended for treatment of LRW to remove cesium [ru

  10. Removal of cesium from red deer meat

    Jandl, J.; Novosad, J.; Francova, J.; Prochazka, H.


    The effect was studied of marinading on the reduction of cesium radionuclide activity in red deer meat contaminated by ingestion of feed containing 134 Cs+ 137 Cs from radioactive fallout following the Chernobyl accident. Two types of marinade were studied, viz., a vinegar infusion and a vinegar infusion with an addition of vegetables and spices. The meat was chopped to cubes of about 1.5 cm in size and the marinading process took place at temperatures of 5 and 11 degC. The drop of cesium content in the meat was determined by gamma spectrometry at given time intervals. The replacement of the marinade and the duration of the process were found to maximally affect efficiency. If the solution was not replaced, about 80% of cesium radionuclides were removed after seven hours of marinading. With one replacement of the infusion the drop in 134 Cs+ 137 Cs radioactivity amounted to up to 90% after seven hours of marinading. No effects were shown of vegetable additions to the vinegar infusion and of the change in temperature from 5 to 11 degC on the efficiency of the process. (author). 3 tabs., 6 refs

  11. Cesium-137 as a radiation source

    McMullen, W.H.; Sloan, D.P.


    The U.S. Department of Energy (DOE) Byproducts Utilization Program (BUP) seeks to develop and encourage widespread commercial use of defense byproducts that are produced by DOE. Cesium-l37 is one such byproduct that is radioactive and decays with emission of gamma rays. The beneficial use of this radiation to disinfect sewage sludge or disinfest food commodities is actively being pursued by the program. The radiation produced by cesium-l37(Cs-l37) is identical in form to that produced by cobalt-60(Co-60), an isotope that is widely used in commercial applications such as medical product sterilization. The choice of isotope to use depends on several factors ranging from inherent properties of the isotopes to availability and cost. The BUP, although centrally concerned with the beneficial use of Cs-l37, by investigating and assessing the feasibility of various uses hopes to define appropriate circumstances where cesium or cobalt might best be used to accomplish specific objectives. This paper discusses some of the factors that should be considered when evaluating potential uses for isotopic sources

  12. Cesium immobilization into potassium magnesium phosphate matrix

    Sayenko, S.Y.; Shkuropatenko, V.A.; Bereznyak, O.P.; Hodyreva, Y.S.; Tarasov, R.V.; Virych, V.D.; Ulybkina, E.A.; Pylypenko, O.V.; Kholomeev, G.O.; Zykova, A.V.; Wagh, Arun S.


    The possibility of isomorphous substitution of potassium ions by cesium ions in the structure of potassium magnesium phosphate KMgPO 4 centred dot 6H 2 O (PMP) was shown. It was established, that the Cs included into the PMP matrix does not transfer to the environment during high temperatures heating process (1176 deg C, 3 hours). Analysis of the IR absorption spectrum of the PMP sample has demonstrated that an increase in the amount of additive of the cesium chloride resulted in the shift of the main bands in the spectrum to the low-frequency region with average shift value 10 cm -1 , which indicates the strengthening of bonds in the crystal lattice of matter. The calculated degree of substitution of potassium by cesium during energy release process in the PMP matrix at the level of vitrified high level wastes is about 4%, i. e. the PMP matrix should correspond to the formula K 0.96 Cs 0.04 MgPO 4 centred dot 6H 2 O.

  13. Surface interactions of cesium and boric acid with stainless steel

    Grossman-Canfield, N.


    In this report, the effects of cesium hydroxide and boric acid on oxidized stainless steel surfaces at high temperatures and near one atmosphere of pressure are investigated. This is the first experimental investigation of this chemical system. The experimental investigations were performed using a mass spectrometer and a mass electrobalance. Surfaces from the different experiments were examined using a scanning electron microscope to identify the presence of deposited species, and electron spectroscopy for chemical analysis to identify the species deposited on the surface. A better understanding of the equilibrium thermodynamics, the kinetics of the steam-accelerated volatilizations, and the release kinetics are gained by these experiments. The release rate is characterized by bulk vaporization/gas-phase mass transfer data. The analysis couples vaporization, deposition, and desorption of the compounds formed by cesium hydroxide and boric acid under conditions similar to what is expected during certain nuclear reactor accidents. This study shows that cesium deposits on an oxidized stainless steel surface at temperatures between 1000 and 1200 Kelvin. Cesium also deposits on stainless steel surfaces coated with boric oxide in the same temperature ranges. The mechanism for cesium deposition onto the oxide layer was found to involve the chemical reaction between cesium and chromate. Some revaporization in the cesium hydroxide-boric acid system was observed. It has been found that under the conditions given, boric acid will react with cesium hydroxide to form cesium metaborate. A model is proposed for this chemical reaction

  14. Behavior of ion-implanted cesium in silicon dioxide films

    Fishbein, B.J.


    Charged impurities in silicon dioxide can be used to controllably shift the flatband voltage of metal-oxide-semiconductor devices independently of the substrate doping, the gate oxide thickness and the gate-electrode work function. Cesium is particularly well suited for this purpose because it is immobile in SiO 2 at normal device operating temperatures, and because it can be controllably introduced into oxide films by ion implantation. Cesium is positively charged in silicon dioxide, resulting in a negative flatband voltage shift. Possible applications for cesium technology include solar cells, devices operated at liquid nitrogen temperature, and power devices. The goal of this work has been to characterize as many aspects of cesium behavior in silicon dioxide as are required for practical applications. Accordingly, cesium-ion implantation, cesium diffusion, and cesium electrical activation in SiO 2 were studied over a broad range of processing conditions. The electrical properties of cesium-containing oxides, including current-voltage characteristics, interface trap density, and inversion-layer carrier mobility were examined, and several potential applications for cesium technology have been experimentally demonstrated

  15. Removal of cesium radioisotopes from solutions using granulated zeolites

    Bronic, J.; Subotic, B.


    The influence of type of zeolite and the flow rate of solution through the column on the removal efficiency of radioactive cesium ions from solution has been investigated. The analysis of the change in the concentration of cesium ions in the solutions and distribution of cesium ions in the column fillings (granulated zeolites), after passing the solutions through the columns filled with various granulated zeolites (zeolite 4A, zeolite 13X, synthetic mordenite) was performed. On the basis of the results of this study, the conditions for the most efficient removal of cesium ions from solutions have been discussed. (author) 35 refs.; 9 figs.; 1 tab

  16. Lanthanide doped strontium-barium cesium halide scintillators

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew


    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  17. Sorption of cesium in intact rock

    Puukko, E.


    The mass distribution coefficient K d is used in performance assessment (PA) to describe sorption of a radionuclide on rock. The R d is determined using crushed rock which causes uncertainty in converting the R d values to K d values for intact rock. This work describes a method to determine the equilibrium of sorption on intact rock. The rock types of the planned Olkiluoto waste disposal site were T-series mica gneiss (T-MGN), T-series tonalite granodiorite granite gneiss (T-TGG), P-series tonalite granodiorite granite gneiss (P-TGG) and pegmatitic granite (PGR). These rocks contain different amount of biotite which is the main sorbing mineral. The sorption of cesium on intact rock slices was studied by applying an electrical field to speed up migration of cesium into the rock. Cesium is in the solution as a noncomplex cation Cs + and it is sorbed by ion exchange. The tracer used in the experiments was 134 Cs. The experimental sorption on the intact rock is compared with values calculated using the in house cation exchange sorption model (HYRL model) in PHREEQC program. The observed sorption on T-MGN and T-TGG rocks was close to the calculated values. Two PGR samples were from a depth of 70 m and three samples were from a depth of 150 m. Cesium sorbed more than predicted on the two 70 m PGR samples. The sorption of Cs on the three 150 m PGR samples was small which was consistent with the calculations. The pegmatitic granite PGR has the smallest content of biotite of the four rock types. In the case of P-TGG rock the observed values of sorption were only half of the calculated values. Two kind of slices were cut from P-TGG drill core. The slices were against and to the direction of the foliation of the biotite rims. The sorption of cesium on P-TGG rock was same in both cases. The results indicated that there was no effect of the directions of the electric field and the foliation of biotite in the P-TGG rock. (orig.)

  18. 14 CFR 1240.113 - Financial accounting.


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...

  19. 7 CFR 1220.113 - Marketing.


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...

  20. 32 CFR 724.113 - Application.


    ... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...

  1. 28 CFR 551.113 - Counseling.


    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...

  2. 21 CFR 163.113 - Cocoa.


    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...

  3. 9 CFR 113.7 - Multiple fractions.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...

  4. 24 CFR 27.113 - Foreclosure costs.


    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...

  5. 21 CFR 113.60 - Containers.


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...

  6. 19 CFR 113.35 - Individual sureties.


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...

  7. 42 CFR 66.113 - Publications.


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...

  8. 42 CFR 56.113 - Grantee accountability.


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...

  9. 48 CFR 49.113 - Cost principles.


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...

  10. 38 CFR 75.113 - Data breach.


    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...

  11. 13 CFR 113.405 - Housing.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...

  12. 13 CFR 113.500 - Employment.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...

  13. 7 CFR 1710.113 - Loan security.


    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...

  14. 10 CFR 71.113 - Document control.


    ... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...

  15. 23 CFR 660.113 - Construction.


    ... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...

  16. 49 CFR 194.113 - Information summary.


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...

  17. Strontium-90 and cesium-137 in powdered milk


    Japan Chemical Analysis Center has analysed the strontium-90 and cesium-137 content in powdered milk. The samples were purchased on the open market in Tokyo from the powdered milk producers. The analysis of Strontium-90 and Cesium-137 content was carried out using the method recommended by Science and Technology Agency. (author)

  18. Uptake behavior of titanium molybdophosphate for cesium and strontium

    Yavari, R.; Ahmadi, S.J.; Huang, Y.D.


    This study investigates uptake of cesium and strontium from aqueous solution similar to nuclear waste on three samples of titanium molybdophosphate (TMP) synthesized under various conditions. Effects of concentration of sodium nitrate, pH and contact time on the uptake of cesium and strontium have been studied by bath method. The results showed that TMP has high affinity toward cesium and strontium at pH > 2 and relatively low concentration of sodium nitrate. Kinetic data indicated that cesium uptake process to achieve equilibrium was faster than strontium. Cesium and strontium breakthrough curves were examined at 25 deg C using column packed with H 3 O + form of TMP and breakthrough curves showed symmetrical S-shaped profiles. At the same time, the calculated breakthrough capacity for cesium was higher than strontium. The results of desorption studies showed that over 99% of cesium and strontium was washed out of column by using 4 M NH 4 Cl solution. This study suggests that TMP can have great potential applications for the removal of strontium and specially cesium from nuclear waste solution. (author)

  19. Hydrological Methods can Separate Cesium from Nuclear Waste Saltcake

    Brooke, J.N.; Peters, J.F.; Staheli, K.


    Interstitial Fluid Displacement (IFD) is a new and novel method for separating cesium from saltcake waste. Hydrologic modeling of liquid flow through porous saltcake suggests that the cesium, potassium and sodium hydroxide can be separated at high recovery and low volume using IFD.'

  20. Quality control of the 113Sn-113mIn generator

    Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.


    Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia

  1. Magnetic circular Dichroism and Faraday rotation of cesium-argon excimers and cesium dimers

    Islam, M.A.


    Magnetic Circular Dichroism (MCD) and Faraday Rotation (FR) of excimer absorption bands in gases are measured to obtain the first direct information about the angular momentum quantum numbers and the angular momentum coupling schemes of excimer molecules. So far, there has been no experimental method to obtain information about the axial angular momentum and the angular momentum coupling schemes of excimer molecules. In this experiment, the MCD and the FR of cesium-argon excimer and cesium dimer absorption bands between 5000 A and 10,000 A are measured for the range of temperature from 116 0 to 355 0 C. Of particular interest is the blue wing of D 2 line in cesium which has been the subject of vigorous investigation. The measured MCD data at the blue wing of D 2 line clearly shows that the assignment of 2 μ/sub 1/2/ to this excited state assuming Hund's case (b) is a poor approximation. By a simple inspection of the MCD data, it is found that the coupling scheme is more nearly Hund's case (c) than Hynd's case (b). Several other new and interesting results are obtained. The blue wing associated with 5D transition in atomic cesium is devoid of MCD and exhibits strong MCD in the red wings. Thus, the assignment of 2 μ/sub 1/2/ and 2 π to the blue and red wings, respectively, assuming Hund's case (a) and (b), is a very good approximation. Again the yellow-green band associated with 7s-6s transition in atomic cesium shows no MCD. It is therefore also a good approximation to assign 2 μ/sub 1/2/ to the upper state assuming Hund's case (b). Much more information can be obtained by a detailed analysis of the MCD data

  2. Radiation safety for incineration of radioactive waste contaminated by cesium

    Veryuzhs'kij, Yu.V.; Gryin'ko, O.M.; Tokarevs'kij, V.V.


    Problems in the treatment of radioactive waste contaminated by cesium nuclides are considered in the paper. Chornobyl experience in the management of contaminated soil and contaminated forests is analyzed in relation to the accident at Fukushima-1. The minimization of release of cesium aerosols into atmosphere is very important. Radiation influence of inhaling atmosphere aerosols polluted by cesium has damage effect for humans. The research focuses on the treatment of forests contaminated by big volumes of cesium. One of the most important technologies is a pyro-gasification incineration with chemical reactions of cesium paying attention to gas purification problems. Requirements for process, physical and chemical properties of treatment of radioactive waste based on the dry pyro-gasification incineration facilities are considered in the paper together with the discussion of details related to incineration facilities. General similarities and discrepancies in the environmental pollution caused by the accidents at Chornobyl NPP and Fukushima-1 NPP in Japan are analyzed

  3. A combined cesium-strontium extraction/recovery process

    Horwitz, E.P.; Dietz, M.L.; Jensen, M.P.


    A new solvent extraction process for the simultaneous extraction of cesium and strontium from acidic nitrate media is described. This process uses a solvent formulation comprised of 0.05 M di-t-butylcyclohexano-18-crown-6 (DtBuCH18C6), 0.1 M Crown 100' (a proprietary, cesium-selective derivative of dibenzo-18-crown-6), 1.2 M tributyl phosphate (TBP), and 5% (v/v) lauryl nitrile in an isoparaffinic hydrocarbon diluent. Distribution ratios for cesium and strontium from 4 M nitric acid are 4.13 and 3.46, respectively. A benchtop batch countercurrent extraction experiment indicates that >98% of the cesium and strontium initially present in the feed solution can be removed in only four extraction stages. Through proper choice of extraction and strip conditions, extracted cesium and strontium can be recovered either together or individually

  4. Evaluation of electrochemical ion exchange for cesium elution

    Bontha, J.D.; Kurath, D.E.; Surma, J.E.; Buehler, M.F.


    Electrochemical elution was investigated as an alternative method to acid elution for the desorption of cesium from loaded ion exchange resins. The approach was found to have several potential advantages over existing technologies, in particular, electrochemical elution eliminates the need for addition of chemicals to elute cesium from the ion exchange resin. Also, since, in the electrochemical elution process the eluting solution is not in direct contact with the ion exchange material, very small volumes of the eluting solution can be used in a complete recycle mode in order to minimize the total volume of the cesium elute. In addition, the cesium is eluted as an alkaline solution that does not require neutralization with caustic to meet the tank farm specifications. Other advantages include easy incorporation of the electrochemical elution process into the present cesium recovery schemes

  5. Method for synthesizing pollucite from chabazite and cesium chloride

    Pereira, C.


    A method is described for immobilizing waste chlorides salts containing radionuclides and hazardous nuclear material for permanent disposal, and in particular, a method is described for immobilizing waste chloride salts containing cesium, in a synthetic form of pollucite. The method for synthesizing pollucite from chabazite and cesium chloride includes mixing dry, non-aqueous cesium chloride with chabazite and heating the mixture to a temperature greater than the melting temperature of the cesium chloride, or above about 700 C. The method further comprises significantly improving the rate of retention of cesium in ceramic products comprised of a salt-loaded zeolite by adding about 10% chabazite by weight to the salt-loaded zeolite prior to conversion at elevated temperatures and pressures to the ceramic composite. 3 figs

  6. Biochemical changes in rats under the influence of cesium chloride

    N. M. Melnikova


    Full Text Available Cesium is lately accumulated actively in the environment, but its influence on human and ani­mal organism is the least studied among heavy metals. It is shown that the action of cesium chloride in rats caused significant changes in blood chemistry, which are characterized by a decrease of total protein content, pH, an increase in the level of urea, creatinine, glucose and total hemoglobin. The results showed that potassium content in all the studied organs and tissues of poisoned rats decreases under the action of cesium chloride. Histological examination of the heart tissue in rats poisoned with cesium chloride indicates the onset of pathology of cardiovascular system. It was found out that use of the drug “Asparkam” reduces the negative effect of cesium chloride on the body of rats.

  7. Adsorption of cesium on cement mortar from aqueous solutions

    Volchek, Konstantin, E-mail: [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Miah, Muhammed Yusuf [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Department of Applied Chemistry and Chemical Technology, Noakhali Science and Technology University (Bangladesh); Kuang, Wenxing; DeMaleki, Zack [Emergencies Science and Technology Section, Environment Canada, 335 River Road, Ottawa, Ontario, Canada K1A 0H3 (Canada); Tezel, F. Handan [Department of Chemical and Biological Engineering, University of Ottawa, 161 Louis-Pasteur, Ottawa, Ontario, Canada K1N 6N5 (Canada)


    Highlights: {yields} The adsorption of cesium on cement mortar was investigated in a range of temperatures and cesium concentrations. {yields} The pseudo-second order kinetic model produced a good fit with the experimental kinetic data. {yields} Equilibrium test results correlated well with the Freundlich isotherm adsorption model. {yields} The interaction between cesium ions and cement mortar was dominated by chemical adsorption. - Abstract: The adsorption of cesium on cement mortar from aqueous solutions was studied in series of bench-scale tests. The effects of cesium concentration, temperature and contact time on process kinetics and equilibrium were evaluated. Experiments were carried out in a range of initial cesium concentrations from 0.0103 to 10.88 mg L{sup -1} and temperatures from 278 to 313 K using coupons of cement mortar immersed in the solutions. Non-radioactive cesium chloride was used as a surrogate of the radioactive {sup 137}Cs. Solution samples were taken after set periods of time and analyzed by inductively coupled plasma mass spectroscopy. Depending on the initial cesium concentration, its equilibrium concentration in solution ranged from 0.0069 to 8.837 mg L{sup -1} while the respective surface concentration on coupons varied from 0.0395 to 22.34 {mu}g cm{sup -2}. Equilibrium test results correlated well with the Freundlich isotherm model for the entire test duration. Test results revealed that an increase in temperature resulted in an increase in adsorption rate and a decrease in equilibrium cesium surface concentration. Among several kinetic models considered, the pseudo-second order reaction model was found to be the best to describe the kinetic test results in the studied range of concentrations. The adsorption activation energy determined from Arrhenius equation was found to be approximately 55.9 kJ mol{sup -1} suggesting that chemisorption was the prevalent mechanism of interaction between cesium ions and cement mortar.

  8. Studies on release and deposition behaviour of cesium from contaminated sodium pools and cesium trap development for FBTR

    Sahoo, P.; Kannan, S.E.; Muralidharan, P.; Chandran, K.


    Investigations were carried out on the release and deposition behaviour of cesium from sodium pools in air-filled chamber in the temperature range of 673 to 873 K, using Cs-134 to simulate Cs-137. About 0.12 kg of sodium was loaded in a burn-pot together with 92.5 kBq of cesium. Experiments were carried out with 21% oxygen. Natural burning period of sodium and specific activity ratio between cesium and sodium showed a tendency to decrease and release fractions of both the species tended to increase with temperature. From the surface deposited aerosols it was observed that cesium has propensity to settle down closer to the point of release. A cesium trap has been developed for FBTR with RVC as getter material. Absorption kinetics and particle release behaviour studies pointed to its intended satisfactory performance in the plant. (author)

  9. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms

    Haas, M.


    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m f =2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m f =1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m f =4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The last chapter

  10. Feasibility Assessment of Cesium Removal using Microaglae

    Kim, Ilgook; Ryu, Byung-Gon; Seo, Bum-Kyoung; Moon, Jei Kwon; Choi, Jong-Won [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    The aim of this work is to assess the feasibility of selected one of microalgae in the uptake of Cs+. The obtained results showed the maximum Cs+ removal by D. armatus SCK was 280μM indicating 70% removal efficiency. Also, D. armatus SCK could uptake Cs+ in the presence of K+, is particularly known to be transported into cells as an analog of Cs+ in freshwater condition. Recently, increased attention has been directed on the use of biological technologies for the removal of radionuclides as the cheap and eco-friendly alternative to the non-biological methods. Metal including radioactive compounds uptake by microorganisms can be occurred by metabolism –independent and/or -dependent processes. One involves biosorption based on the ability of microbial cells to bind dissolved metals; on the other involves bioaccumulation, which depends on the metabolic ability of cells to transport metals into the cytoplasm. The purpose of this work is to investigate the feasibility of microalgae in bioaccumulation system to remove cesium from solution. The effect of different environmental parameters on cesium removal was also examined.

  11. Thermochemical evaluation and preparation of cesium uranates

    Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Seichi; Ohashi, Hiroshi


    Two kinds of cesium uranates, Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7}, which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U{sub 3}O{sub 8} and Cs{sub 2}CO{sub 3} for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)

  12. Intense non-relativistic cesium ion beam

    Lampel, M.C.


    The Heavy Ion Fusion group at Lawrence Berkeley Laboratory has constructed the One Ampere Cesium Injector as a proof of principle source to supply an induction linac with a high charge density and high brightness ion beam. This is studied here. An electron beam probe was developed as the major diagnostic tool for characterizing ion beam space charge. Electron beam probe data inversion is accomplished with the EBEAM code and a parametrically adjusted model radial charge distribution. The longitudinal charge distribution was not derived, although it is possible to do so. The radial charge distribution that is derived reveals an unexpected halo of trapped electrons surrounding the ion beam. A charge fluid theory of the effect of finite electron temperature on the focusing of neutralized ion beams (Nucl. Fus. 21, 529 (1981)) is applied to the problem of the Cesium beam final focus at the end of the injector. It is shown that the theory's predictions and assumptions are consistent with the experimental data, and that it accounts for the observed ion beam radius of approx. 5 cm, and the electron halo, including the determination of an electron Debye length of approx. 10 cm

  13. Microbial uptake of uranium, cesium, and radium

    Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; McWhirter, D.A.


    The ability of diverse microbial species to concentrate uranium, cesium, and radium was examined. Saccharomyces cerevisiae, Pseudomonas aeruginosa, and a mixed culture of denitrifying bacteria accumulated uranium to 10 to 15% of the dry cell weight. Only a fraction of the cells in a given population had visible uranium deposits in electron micrographs. While metabolism was not required for uranium uptake, mechanistic differences in the metal uptake process were indicated. Uranium accumulated slowly (hours) on the surface of S. cerevisiae and was subject to environmental factors (i.e., temperature, pH, interfering cations and anions). In contrast, P. aeruginosa and the mixed culture of denitrifying bacteria accumulated uranium rapidly (minutes) as dense, apparently random, intracellular deposits. This very rapid accumulation has prevented us from determining whether the uptake rate during the transient between the initial and equilibrium distribution of uranium is affected by environmental conditions. However, the final equilibrium distributions are not affected by those conditions which affect uptake by S. cerevisiae. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several microbial species tested. The potential utility of microorganisms for the removal and concentration of these metals from nuclear processing wastes and several bioreactor designs for contacting microorganisms with contaminated waste streams will be discussed.

  14. Effect of cesium seeding on hydrogen negative ion volume production

    Bacal, M.; Balghiti-Sube, F. El; Elizarov, L. I.; Tontegode, A. J.


    The effect of cesium vapor partial pressure on the plasma parameters has been studied in the dc hybrid negative ion source ''CAMEMBERT III.'' The cesium vapor pressure was varied up to 10 -5 Torr and was determined by a surface ionization gauge in the absence of the discharge. The negative ion relative density measured by laser photodetachment in the center of the plasma extraction region increases by a factor of four when the plasma is seeded with cesium. However the plasma density and the electron temperature (determined using a cylindrical electrostatic probe) are reduced by the cesium seeding. As a result, the negative ion density goes up by a factor of two at the lowest hydrogen pressure studied. The velocity of the directed negative ion flow to the plasma electrode, determined from two-laser beam photodetachment experiments, appears to be affected by the cesium seeding. The variation of the extracted negative ion and electron currents versus the plasma electrode bias will also be reported for pure hydrogen and cesium seeded plasmas. The cesium seeding leads to a dramatic reduction of the electron component, which is consistent with the reduced electron density and temperature. The negative ion current is enhanced and a goes through a maximum at plasma electrode bias lower than 1 V. These observations lead to the conclusion that the enhancement of pure volume production occurs in this type of plasma. Possible mechanisms for this type of volume process will be discussed

  15. Spatial variability and Cesium-137 inventories in native forest

    Andrello, A.C.; Appoloni, C.R.


    With the nuclear fission discovery and development of nuclear weapons in 1940s, artificial radioisotopes were introduced in the environment. This contamination is due to worldwide fallout by superficial nuclear tests realized from early 1950s to late 1970s by USA, former URSS, UK, France and China. One of theses radioisotopes that have been very studied is cesium-137. Cesium-137 has a half-life of 30.2 years and its biological behavior is similar to the potassium. The behavior in soil matrix, depth distribution, spatial variability and inventories values of cesium-137 has been determinate for several regions of the world. In Brazil, some research groups have worked on this subject, but there are few works published about theses properties of cesium-137. The aim of this paper was study the depth distribution, spatial variability, and inventory of cesium-137 in native forest. Two native forests (Mata 1 and Mata UEL) were sampling in region of Londrina, PR. The results shows that there is a spatial variability of 40% for Mata 1 and 42% for Mata UEL. The depth distribution of cesium-137 for two forests presented a exponential form, characteristic to undisturbed soil. Cesium-137 inventory determinate for Mata 1 was 358 Bq m -2 and for Mata UEL was 320 Bq m -2 . (author)

  16. The burden of cesium 137 in forest clerks

    Piechotowski, I.; Jaroni, J.; Link, B.; Groezinger, O.


    In 47 forest clerks from the regions Ortenau and Oberschwaben in south-west Germany the incorporation of cesium 137 and potassium 40 was measured in autumn 1994. Soil burden as well as burden of nutrition with cesium 137 are different in these regions for geological reasons and as a result of the nuclear accident of Chernobyl. Caused by low content of clay in Oberschwaben, the transfer of cesium to plants is assisted. Heavy rainfall after the nuclear accident led to an additional increase of burden. The median of the concentration of cesium 137 was 1.4 Bq/kg body weight. The median for potassium 40 was 58 Bq/kg body weight. For cesium 137 regional differences were observed. For persons from Oberschwaben the median for cesium 137 was with 2.8 Bq/kg body weight clearly higher than for persons from Ortenau with 0,6 Bq/kg body weight. Concerning nutrition habits, the clearest difference was found comparing persons who had ate a minimum of four portions of deer from the surroundings within the last four weeks with persons who had ate less than four portions of deer from the surroundings within the last four weeks. The difference was greater in Oberschwaben than in Ortenau. The effective dose of cesium 137 calculated on the basis of the incorporation is very low compared to natural radiation. This is also valid for persons from Oberschwaben. (orig.) [de

  17. study on 113 Sn-113m In generator of the chromatographic column elution mode

    Abdel-Halim, A.A.


    this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days

  18. Management of cesium loaded AMP- Part I preparation of 137Cesium concentrate and cementation of secondary wastes

    Singh, I.J.; Sathi Sasidharan, N.; Yalmali, Vrunda S.; Deshingkar, D.S.; Wattal, P.K.


    Separation of 137 cesium from High Level Waste can be achieved by use of composite-AMP, an engineered form of Ammonium Molybdo-Phosphate(AMP). Direct vitrification of cesium loaded composite AMP in borosilicate glass matrix leads to separation of water soluble molybdate phase. A proposed process describes two different routes of selective separation of molybdates and phosphate to obtain solutions of cesium concentrates. Elution of 137 Cesium from composite-AMP by decomposing it under flow conditions using saturated barium hydroxide was investigated. This method leaves molybdate and phosphate embedded in the column but only 70% of total cesium loaded on column could be eluted. Alternatively composite-AMP was dissolved in sodium hydroxide and precipitation of barium molybdate-phosphate from the resultant solution, using barium nitrate was investigated by batch methods. The precipitation technique gave over 99.9% of 137 Cesium activity in solutions, free of molybdates and phosphates, which is ideally suited for immobilization in borosilicate glass matrix. Detailed studies were carried out to immobilize secondary waste of 137 Cesium contaminated barium molybdate-phosphate precipitates in the slag cement matrix using vermiculite and bentonite as admixtures. The cumulative fraction of 137 Cs leached from the cement matrix blocks was 0.05 in 140 days while the 137 Cs leach rate was 0.001 gm/cm 2 /d. (author)

  19. Investigations on cesium uranates and related compounds

    Egmond, A.B. van


    Crystal structures of cesium uranate are determined mainly by X-ray diffraction techniques. From phase studies it is concluded that of the Cs-U-O system, Cs 2 U 4 O 12 will play a prominent role in fuel elements of fast reactors due to fission product-fuel reactions causing swelling of the fuel and fuel-element failure. Crystal structures and lattice parameters are determined from Cs 2 U 4 O 12 , Cs 2 U 4 O 13 , Cs 2 U 5 O 16 , Cs 4 U 5 O 17 , Cs 2 U 7 O 22 , Cs 2 U 15 O 46 , Cs 2 UO 4 and Cs 2 U 2 O 7 . Finally some crystal structures of potassium and rubidium uranates are measured and a comparison of all available data on alkali uranates is made

  20. Cesium return program lessons learned FY 1994

    Clements, E.P.


    The U.S. Department of Energy (DOE) is returning leased cesium capsules from IOTECH, Incorporated (IOTECH), Northglenn, Colorado, and the Applied Radiant Energy Company (ARECO), Lynchburg, Virginia, to the Waste Encapsulation and Storage Facility (WESF) on the Hanford Site, to ensure safe management and storage, pending final capsule disposition. Preparations included testing and modifying the Beneficial Uses Shipping System (BUSS) cask, preparing an Environmental Assessment (EA), development of a comprehensive Transportation Plan, coordination with the Western Governors' Association (WGA) and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR), and interface with the public and media. Additional activities include contracting for a General Electric (GE) 2000 cask to expedite IOTECH capsule returns, and coordination with Eastern and Midwestern States to revise the transportation plan in support of ARECO capsule returns

  1. Biosorption of uranium, radium, and cesium

    Strandberg, G.W.


    Some fundamental aspects of the biosorption of metals by microbial cells were investigated. These studies were carried out in conjunction with efforts to develop a process to utilize microbial cells as biosorbents for the removal of radionuclides from waste streams generated by the nuclear fuel cycle. It was felt that an understanding of the mechanism(s) of metal uptake would potentially enable the enhancement of the metal uptake phenomenon through environmental or genetic manipulation of the microorganisms. Also presented are the results of a preliminary investigation of the applicability of microorganisms for the removal of 137 cesium and 226 radium from existing waste solutions. The studies were directed primarily at a characterization of uranium uptake by the yeast, Saccharomyces cerevisiae, and the bacterium, Pseudomonas aeruginosa

  2. Social aspects concerning the cesium-137 accident

    Chaves, Elza Guedes


    The present work aims to understand how social representations constructed upon nuclear energy have influenced on molding and orienting public's behavior in the presence of the accident that occurred in Goiania with the capsule of Cesium-137. As a starting point, it is accepted here that panic caused by that accident could be properly understood only if dimension of subjectivity is taken into consideration. This perspective is required whenever events that put human life and environment in risk happen. Facing the accident, people internalized radioactivity, an unknown element, as certainty of cancer and death despite the fact that cancer and death could only outcome in case there had been excessive exposure to radioactivity. (author)

  3. Electron-stimulated desorption of cesium atoms from cesium layers adsorbed on gold-covered tungsten

    Ageev, V N; Kuznetsov, Yu A; Potekhina, N D, E-mail: kuznets@ms.ioffe.r [A F Ioffe Physico-Technical Institute, Russian Academy of Sciences, 194021, St Petersburg (Russian Federation)


    The electron-stimulated desorption (ESD) yields and energy distributions (ED) for neutral cesium atoms have been measured from cesium layers adsorbed on a gold-covered tungsten surface as a function of electron energy, gold film thickness, cesium coverage and substrate temperature. The measurements have been carried out using a time-of-flight method and surface ionization detector in the temperature range 160-300 K. A measurable ESD yield for Cs atoms is observed only after deposition of more than one monolayer of gold and cesium on a tungsten surface at a temperature T = 300 K, which is accompanied by the formation of a CsAu semiconductor film covered with a cesium atom monolayer. The Cs atom ESD yield as a function of incident electron energy has a resonant character and consists of two peaks, the appearance of which depends on both electron energy and substrate temperature. The first peak has an appearance threshold at an electron energy of 57 eV and a substrate temperature of 300 K that is due to Au 5p{sub 3/2} core level excitation in the substrate. The second peak appears at an electron energy of 24 eV and a substrate temperature of 160 K. It is associated with a Cs 5s core level excitation in the Cs adsorbed layer. The Au 5p{sub 3/2} level excitation corresponds to a single broad peak in the ED with a maximum at a kinetic energy of 0.45 eV at a substrate temperature T = 300 K, which is split into two peaks with maxima at kinetic energies of 0.36 and 0.45 eV at a substrate temperature of 160 K, associated with different Cs atom ESD channels. The Cs 5s level excitation leads to an ED for Cs atoms with a maximum at a kinetic energy of approx 0.57 eV which exists only at T < 240 K and low Cs concentrations. The mechanisms for all the Cs atom ESD channels are proposed and compared with the Na atom ESD channels in the Na-Au-W system.

  4. On mobility of cesium-137, sodium, potassium in various types of soils and prediction of cesium-137 cumulation in agricultural plants

    Ashkinazi, Eh.I.


    Mobility of cesium-137, sodium and potassium in the natural environment in podzolic gray and chernozem medium-loamy, sward podzolic sandy soils and chernozem has been studied. Durability of fixation of cesium-137 increases in a number of soils and increase of the level of metabolic potassium. Coefficient of transition of level of metabolic cesium-137 by potassium and sodium, and of sodium by potassium. The mentioned above coefficients can be used for the prediction of cesium-137 cumulation in plants

  5. Strontium-90 and cesium-137 in tea (Japanese tea)


    Strontium-90 and cesium-137 in tea (Japanese tea) were determined. Five hundred grams of manufactured green tea was collected from six sampling locations in Japan. The results are shown in a table. (Namekawa, K.)

  6. CETESB's actions in Goiania in what concerns cesium-137 accident

    Penteado Filho, Azor Camargo; Derisio, Jose Carlos; Albuquerque, Antonio Martins de


    This work presents several actions performed by CETESB, the sanitary engineering agency of Sao Paulo State - Southeast Brazil, in what concerns the accident involving cesium-137 in Goiania, Goias State - Center Brazil. The adopted procedures are described in details

  7. A model for radial cesium transport in a fuel pellet

    Imoto, Shosuke


    In order to explain the radial redistribution of cesium in an irradiated pellet, a two-step release model is proposed. The first step involves the migration of cesium by atomic diffusion to some channels, such as grain boundaries and cracks, and the second step assumes a thermomigration down along the temperature gradient. Distribution profiles of cesium are obtained by numerical calculation with the present model assuming a constant and spatially uniform birth rate of cesium in the pellet. The result agrees well with the profile observed by micro-gamma scanning for the LWR fuel in the outer region of the pellet but diverges from it at the inner region. Discussion is made on the steady-state model hitherto generally utilized. (orig.)

  8. Functions and requirements for a cesium demonstration unit

    Howden, G.F.


    Westinghouse Hanford Company is investigating alternative means to pretreat the wastes in the Hanford radioactive waste storage tanks. Alternatives include (but are not limited to) in-tank pretreatment, use of above ground transportable compact processing units (CPU) located adjacent to a tank farm, and fixed processing facilities. This document provides the functions and requirements for a CPU to remove cesium from tank waste as a demonstration of the CPU concept. It is therefore identified as the Cesium Demonstration Unit CDU

  9. Cesium powder and pellets inner container decontamination method determination

    Ferrell, P.C.


    The cesium powder and pellets inner container is to be performance tested per the criteria specified in Section 4.0 of HNF-2399, ''Design, Fabrication, and Assembly Criteria for Cesium Powder and Pellet Inner Container.'' The test criteria specifies that the inner container be water tight during decontamination of the exterior surface. Three prototypes will be immersed into a pool of water to simulate a water decontamination process

  10. 9 CFR 113.2 - Testing aids.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...

  11. 21 CFR 113.81 - Product preparation.


    ...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

  12. 49 CFR 214.113 - Head protection.


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...

  13. 13 CFR 113.410 - Comparable facilities.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...

  14. 40 CFR 113.3 - Definitions.


    ... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...

  15. 27 CFR 21.113 - Isopropyl alcohol.


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...

  16. 13 CFR 113.510 - Recruitment.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...

  17. 7 CFR 1955.113 - Price (housing).


    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...

  18. 9 CFR 113.451 - Tetanus Antitoxin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...

  19. 13 CFR 113.540 - Advertising.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...

  20. 9 CFR 11.3 - Scar rule.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...

  1. 19 CFR 113.0 - Scope.


    ... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...

  2. 13 CFR 113.450 - Athletics.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...

  3. 33 CFR 136.113 - Other compensation.


    ...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...

  4. Study of strontium and cesium migration in fractured crystalline rock

    Gustafsson, E.; Klockars, C.E.


    The purpose of this investigation has been to study the retardation and dilution of non-active strontium and cesium relative to a non-absorbing substance (iodide) in a well-defined fracture zone in the Finnsjoen field research area. The investigation was carried out in a previously tracer-tested fracture zone. The study has encompassed two separate test runs with prolonged injection of strontium and iodide and of cesium and iodide. The test have shown that: - Strontium is not retarded, but rather absorbed to about 40% at equilibrium. - At injection stop, 36.3% of the injected mass of strontium has been absorbed and there is no deabsorption. -Cesium is retarded a factor of 2-3 and absorbed to about 30% at equilibrium. - At injection stop, 39.4% of the injected mass of cesium has been absorbed. Cesium is deabsorbed after injection stop (400h) and after 1300 hours, only 22% of the injected mass of cesium is absorbed. (author)

  5. Cesium-134 and cesium-137 in honey bees and cheese samples collected in the U. S. after the Chernobyl accident

    Ford, B C; Jester, W A; Griffith, S M; Morse, R A; Zall, R R; Lisk, D J; Burgett, D M; Bodyfelt, F W


    As a result of the Chernobyl accident on April 25, 1986, possible radioactive contamination of honey bees and cheese sampled in several areas of the United States were measured. Of bees collected in May and June of 1986 in both Oregon and New York, only those from Oregon showed detectable levels of cesium-134 (T1/2 = 2.05 years), a radionuclide which would have originated from the Chernobyl incident. Cheese produced in Oregon and New York before the accident showed only cesium-137 (T1/2 = 30.23 years) but cheese produced afterwards (May and September, 1986) in Oregon contained cesium-134. Cheese produced in Ohio and California at the time of the accident and thereafter contained only cesium-137. In general, the levels of radioactivity were higher in the West coast samples as compared to those taken in the East. The levels of radioactivity detected were considered to be toxicologically of no consequence.

  6. Seasonal variation of cesium 134 and cesium 137 in semidomestic reindeer in Norway after the Chernobyl accident

    Eikelmann, I.M.H.; Bye, K.; Sletten, H.D.


    The Chernobyl accident had a great impact on the semidomestic reindeer husbandry in central Norway. Seasonal differences in habitat and diet resulted in large variations in observed radiocesium concentrations in reindeer after the Chernobyl accident. In three areas with high values of cesium-134 and cesium-137 in lichens, the main feed for reindeer in winter, reindeer were sampled every second month to monitor the seasonal variation and the decrease rate of the radioactivity. The results are based on measurements of cesium-134 and cesium-137 content in meat and blood and by whole-body monitoring of live animals. In 1987 the increase of radiocesium content in reindeer in Vågå were 4x from August to January. The mean reductions in radiocesium content from the winter 1986/87 to the winter 1987/88 were 32%, 50% and 43% in the areas of Vågå, Østre-Namdal and Lom respectively

  7. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    Fujishiro, F.; Ishii, K.; Matsuyama, S.; Arai, H.; Ishizaki, A.; Osada, N.; Sugai, H.; Kusano, K.; Nozawa, Y.; Yamauchi, S.; Karahashi, M.; Oshikawa, S.; Kikuchi, K.; Koshio, S.; Watanabe, K.; Suzuki, Y.


    Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ˜0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds.

  8. Improvement of cesium retention in uranium dioxide by additional phases

    Gamaury Dubois, S.


    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs 2 O-Al 2 O 3 -SiO 2 et Cs 2 O-ZrO 2 -SO 2 . The compounds CsAISi 2 O 6 and Cs 2 ZrSi 6 O 15 were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al 2 O 3 + SiO 2 ) or (ZrO 2 + SiO 2 ) and the intergranular phase was characterized. In the presence of (Al 2 O 3 + SiO 2 ), the sintering is realized at 1610 deg C in H 2 . It is a liquid phase sintering. On the other end, with (ZrO 2 + SiO 2 ), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO 2+x . We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs

  9. Cluster formation of network-modifier cations in cesium silicate glasses

    Jardón-Álvarez, Daniel; Sanders, Kevin J.; Phyo, Pyae; Baltisberger, Jay H.; Grandinetti, Philip J.


    Natural abundance 29Si two-dimensional magic-angle flipping (2D MAF) NMR spectra were measured in a series of ten cesium silicate glass compositions xCs2O.(1 - x)SiO2, where x is 0.067, 0.113, 0.175, 0.179, 0.218, 0.234, 0.263, 0.298, 0.31, and 0.36. The Q3 shielding anisotropy decreases with increasing Cs content—interpreted as an increase in the non-bridging oxygen (NBO) bond length from increasing Cs coordination (clustering) around the NBO. The 29Si 2D MAF spectra for four glass compositions x = 0.218, 0.234, 0.263, 0.298 exhibit a second co-existing and distinctly smaller shielding anisotropy corresponding to a significantly longer Si-NBO length arising from a higher degree of Cs clustering around the NBO. This second Q3 site appears at a Cs2O mole fraction close to the critical mole fraction of x = 0.24 associated with the percolation threshold of non-bridging oxygen in random close packing of oxygen, thus suggesting that the longer Si-NBO length is associated with an infinite size spanning cluster while the sites with larger anisotropies are associated with shorter Si-NBO lengths and belong to finite size clusters. The equilibrium constant of the Q3 disproportionation reaction was determined as k3 = 0.005, indicating a Qn anionic species distribution close to a binary model as expected for a low field strength modifier such as cesium. It is also found that evolution of the isotropic Q4 and line shapes with increasing Cs content are consistent with a random connectivity model between Qn of differing number of bridging oxygen, n.

  10. Dosimetry of a Cesium 137 source

    Torres R, J.G.; Manzanares A, E.; Vega C, H.R.


    It was carried out a dosimetric study of a source of Cesium 137 used in investigations of Radiobiology. This radionuclide has a half life of 30.07 years and it emits photons of 661.657 keV with a probability of 85.2%. The source has been used in a series of experiments trending to observe the cellular response before the gamma rays, as well as for the calibration of equipment of radiological protection. For such reason it is important to determine the dosimetric properties. In this work it was determined the absorbed dose that this source takes when being placed in the center from a methylmethacrylate badge to three distances, 5, 10 and 15 cm. The dose was measured with thermoluminescent dosemeters and it was calculated by means of Monte Carlo method, also was derived an expression that allows to determine the dose starting from the information of the activity of the source and of the distance regarding the same one. (Author)

  11. Crystalline silicotitanates -- novel commercial cesium ion exchangers

    Braun, R.; Dangieri, T.J.; Fennelly, D.J.


    A new class of inorganic ion exchangers called crystalline silicotitanates (CST), invented by researchers at Sandia National Laboratories and Texas A ampersand M University, has been commercialized in a joint Sandia-UOP effort. The original developmental materials exhibited high selectivity for the ion exchange of cesium, strontium, and several other radionuclides from highly alkaline solutions containing molar concentrations of Na + . The materials also showed excellent chemical and radiation stability. These CST properties made them excellent candidates for treatment of solutions such as the Hanford tank supernates and other DOE radwastes. Sandia and UOP, under a Cooperative Research and Development Agreement (CRADA), developed CSTs in the powdered form and in an engineered form suitable for column ion exchange use. A continuous-flow, column ion exchange process is expected to be used to remove Cs and other radionuclides from the Hanford supernatant. The powder material invented by Sandia and Texas A ampersand M consists of submicron-size particles. It is not designed for column ion exchange but may be used in other applications such as batch waste processing. Data are also presented confirming the excellent stability of the commercial CSTs over a broad pH range and the high radiation stability of the exchangers. In addition, data are provided that demonstrate the high physical strength and attrition resistance of IONSIV reg-sign IE-911, critical properties for column ion exchange applications

  12. Pilot unit for cesium-137 separation; Unite pilote de separation du cesium-137

    Raggenbass, A; Quesney, M; Fradin, J; Dufrene, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    Users of radiation are becoming increasingly interested in cesium-137. At the same time the starting up of the industrial plant at Marcoule will make available in the near future large stocks of fission products which should be made use of as quickly as possible. The installation described is a pilot plant for cesium-137 production which should make it possible: - to verify the chemical method on actual solutions of fission products, by treating about 100 curies of {sup 137}Cs by operation, - to obtain technical information on the chemical equipment (tele-commands, corrosion, maintenance, etc...), - to obtain {sup 137}Cs in sufficient quantity to perfect the technique of the manufacture of sealed sources. (author)Fren. [French] L'interet des utilisateurs de rayonnement se porte de plus en plus vers le caesium-137. Parallelement, la mise en oeuvre de l'ensemble industriel de Marcoule nous permettra de disposer dans un avenir proche de stocks importants de produits de fission qu'il sera interessant de valoriser au plus vite. L'installation que nous decrivons est un pilote de production de caesium-137 qui doit nous permettre: - de verifier la methode chimique sur des solutions de produits de fission reelles en traitant environ 100 curies de {sup 137}Cs par operation; - d'obtenir des renseignements techniques sur l'appareillage chimique (telecommandes, corrosion, entretien, etc...); - d'obtenir du {sup 137}Cs en quantite suffisante pour mettre au point la technique de fabrication des sources scellees. (auteur)

  13. 27 CFR 11.3 - Application.


    ... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...

  14. Micro-PIXE evaluation of radioactive cesium transfer in contaminated soil samples

    Fujishiro, F.; Ishii, K.; Matsuyama, S.; Arai, H.; Ishizaki, A.; Osada, N.; Sugai, H.; Kusano, K.; Nozawa, Y.; Yamauchi, S.; Karahashi, M.; Oshikawa, S.; Kikuchi, K.; Koshio, S.; Watanabe, K.; Suzuki, Y.


    Highlights: • There are radioactively contaminated soils having a radioactive cesium transfer of 0.01. • Micro-PIXE analysis has revealed an existence of phosphorus in a contaminated soil. • Radioactive cesium captured by phosphorus compound would be due to radioactive transfer. -- Abstract: Micro-PIXE analysis has been performed on two soil samples with high cesium activity concentrations. These soil samples were contaminated by fallout from the accident at Fukushima Daiichi Nuclear Power Plant. One exhibits a radioactive cesium transfer of ∼0.01, and the other shows a radioactive cesium transfer of less than 0.001, even though both samples have high cesium activity concentrations exceeding 10,000 Bq/kg. X-ray spectra and elemental images of the soil samples revealed the presence of chlorine, which can react with cesium to produce an inorganic soluble compound, and phosphorus-containing cesium-capturable organic compounds

  15. Measurements of cesium and strontium diffusion in biotite gneiss

    Skagius, K.; Neretnieks, I.


    A significant retardation of radionuclides transported by flowing water from an underground repository can be expected if the nuclides are able to diffuse into the water filled micropores in the rock. This diffusion into the pores will also increase the surface available to interactions between the nuclides in the ground water and the rock material, such as sorption. To calculate the retardation, it is necessary to know the sorption properties and the diffusivities in the rock matrix for the radionuclides. Diffusion experiments with cesium and strontium in biotite gneiss samples have been performed. Both the transport of strontium and cesium through rock samples and the concentration profiles of cesium and strontium inside rock samples have been determined. The result shows that diffusion of cesium and strontium occurs in the rock material. A diffusion model has been used to evaluate the diffusivity. Both pore diffusion and surface diffusion had to be included in the model to give good agreement with the experimental data. If surface diffusion is not included in the model, the effective pore diffusivity that gives the best fit to the experimental data is found to be higher than expected from earlier measurement of iodide diffusion in the same type of rock material. This indicates that the diffusion of cesium and strontium (sorbing components) in rock material is caused by both pore diffusion and surface diffusion acting in parallel

  16. Accumulation of strontium 90 and cesium 137 in some hydrobionts

    Boyadzhiev, A.; Keslev, D.; Kerteva, A.; Novakova, E.


    Factors responsible for the accumulation of strontium 90 and cesium 137 in some plant organisms, characteristic for fishes in Bulgarian fresh-water reservoirs and in Black Seawater, were examined. The investigated samples were taken during spring, summer and autumn-winter seasons 1967/1968. Each sample burnt to ashes at 450 0 C was examined for strontium 90 and cesium 137 content as well as stable isotopes of calcuim and potassium. Accumulation factors for strontium 90 and cesium 137 were significantly higher in freshwater hydrobionts than in seawater hydrobionts. This could be explained by variations in the concentration of stable isotopes of calcium and potassium from freshwater reservoirs and from seawater. Potassium and calcium concentrations were relatively constant in seawater while in freshwater they were significantly variable. Accumulation factors for these radionuclides increased according to the amount of rain and the altitude above sea level. Strontium 90 was deposited mostly in fins, less in scales and least in the meat of fishes; cesium 137 was mainly deposited in the meat and less in the other parts of fishes. The highest accumulation factors for strontium 90 were determined in fishes and for cesium 137 in plant organisms. The most convenient plant and fish species for tracing radioactive contamination of freshwater reservoirs and in the Black Sea were indicated. (A.B.)

  17. Diffusion measurements of cesium and strontium in biotite gneiss

    Skagius, K.; Neretnieks, I.


    A significant retardation of radionuclides transported by flowing water from an underground repository can be expected if the nuclides are able to diffuse into the water filled micropores in the rock. This diffusion into the pores will also increase the surface available to interaction between the nuclides in the groundwater and the rock material, such as sorption. To calculate the retardation it is necessary to know the sorption properties and the diffusivities in the rock matrix for the radionuclides. Diffusion experiments with cesium and strontium in biotite gneiss samples have been performed. Both the transport of strontium and cesium through rock samples and the concentration profiles of cesium and strontium inside rock samples have been determined. The result show that diffusion of cesium and strontium occurs in the rock material. A diffusion model has been used to evaluate the diffusivity. Both pore diffusion and surface diffusion had to be included in the model to give good agreement with the experimental data. If surface diffusion is not included in the model, the effective pore diffusivity that gives the best fit to the experimental data is found to be higher than expected from earlier measurements of iodide diffusion in the same type of rock material. This indicates that the diffusion of cesium and strontium (sorbing components) in rock material is caused by both pore diffusion and surface diffusion acting in parallel. (author)

  18. Adsorption of Radioactive Cesium to Illite-Sericite Mixed Clays

    Hwang, J. H.; Choung, S.; Park, C. S.; Jeon, S.; Han, J. H.; Han, W. S.


    Once radioactive cesium is released into aquatic environments through nuclear accidents such as Chernobyl and Fukushima, it is harmful to human and ecological system for a long time (t1/2 = 30.2 years) because of its chemical toxicity and γ-radiation. Sorption mechanism is mainly applied to remove the cesium from aquatic environments. Illite is one of effective sorbent, considering economical cost for remediation. Although natural illite is typically produced as a mixture with sericite formed by phyllic alteration in hydrothermal ore deposits, the effects of illite-sericite mixed clays on cesium sorption was rarely studied. This study evaluated the sorption properties of cesium to natural illite collected at Yeongdong in Korea as the world-largest illite producing areas (termed "Yeongdong illite"). The illite samples were analyzed by XRF, XRD, FT-IR and SEM-EDX to determine mineralogy, chemical composition, and morphological characteristics, and used for batch sorption experiments. Most of "Yeongdong illite" samples predominantly consist of sericite, quartz, albite, plagioclase feldspar and with minor illite. Cesium sorption distribution coefficients (Kd,Cs) of various "Yeongdong illite" samples ranged from 500 to 4000 L/kg at low aqueous concentration (Cw 10-7 M). Considering Kd,Cs values were 400 and 6000 using reference sericite and illite materials, respectively, in this study, these results suggested that high contents of sericite significantly affect the decrease of sorption capabilities for radiocesium by natural illite (i.e., illite-sericite mixed clay).

  19. Cesium removal using crystalline silicotitanate. Innovative technology summary report


    Approximately 100 million gallons of radioactive waste is stored in underground storage tanks at the Hanford Site, Idaho National Engineering and Environmental Laboratory (INEEL), Oak Ridge Reservation, and Savannah River Site (SRS). Most of the radioactivity comes from 137 Cs, which emits high-activity gamma radiation. The Cesium Removal System is a modular, transportable, ion-exchange system configured as a compact processing unit. Liquid tank waste flows through columns packed with solid material, called a sorbent, that selectively adsorbs cesium and allows the other materials to pass through. The sorbent is crystalline silicotitanate (CST), an engineered material with a high capacity for sorbing cesium from alkaline wastes. The Cesium Removal System was demonstrated at Oak Ridge using Melton Valley Storage Tank (MVST) waste for feed. Demonstration operations began in September 1996 and were completed during June 1997. Prior to the demonstration, a number of ion-exchange materials were evaluated at Oak Ridge with MVST waste. Also, three ion-exchange materials and three waste types were tested at Hanford. These bench-scale tests were conducted in a hot cell. Hanford's results showed that 300 times less sorbent was used by selecting Ionsiv IE-911 over organic ion-exchange resins for cesium removal. This paper gives a description of the technology and discusses its performance, applications, cost, regulatory and policy issues and lessons learned

  20. Cesium diffusion in Bure mud-rock: effect of cesium sorption and of the surface structure of the clay

    Melkior, T.; Motellier, S.; Yahiaoui, S.


    Full text of publication follows: This work is devoted to cesium diffusion through mud-rock samples from Bure (Meuse/Haute- Marne, France). This rock is mainly composed of interstratified illite/smectite, quartz and calcite. According to published data, positively charged solutes exhibit high diffusion coefficients in argillaceous media compared to neutral species. This effect was actually observed for cesium in Bure mud-rock samples: the effective diffusion coefficients (De) of tritiated water and cesium were found to be ca. 2 x 10 -11 m 2 s -1 and 2.5 x 10 -10 m 2 s -1 , respectively. Some authors assign this 'enhanced diffusion' of cations to the particular migration of ions within the electrical double layer, next to mineral surfaces (surface diffusion mechanism). To assess the role of sorbed ions in the diffusive transfer, cesium diffusion coefficients in Bure mud-rock were measured at different cesium concentrations. The distribution coefficient of cesium onto Bure mud-rock was measured in batch: it significantly varies over the concentration range investigated in the diffusion tests (between 2 x 10 -6 M and 2 x 10 -2 M). If sorbed ions contribute to the transfer, the effective diffusion coefficients deduced from these different tests should depend on cesium concentration. Nevertheless, the measured effective diffusion coefficients are found to be relatively unaffected by cesium concentration. It is thus concluded that ions at the sorbed state play a minor role in the diffusion. Following the assumption of an 'accelerated' transfer due to ions located in the diffuse double layer, the charge of the clay particles should affect the 'enhanced diffusion' of cesium. Therefore, a mud-rock sample was first crushed and contacted with a cationic surfactant at different solid/liquid ratios. The conditions were adjusted to obtain suspensions having positive, neutral and negative zeta potentials respectively. Three compact samples were then made with these different

  1. A novel role for methyl cysteinate, a cysteine derivative, in cesium accumulation in Arabidopsis thaliana

    Adams, Eri; Miyazaki, Takae; Hayaishi-Satoh, Aya


    Phytoaccumulation is a technique to extract metals from soil utilising ability of plants. Cesium is a valuable metal while radioactive isotopes of cesium can be hazardous. In order to establish a more efficient phytoaccumulation system, small molecules which promote plants to accumulate cesium we...

  2. Cesium in the Savannah River Site environment

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of 137 Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of 137 Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope 137 Cs releases have resulted in a negligible risk to the environment and the population it supports

  3. Sorption of cesium and uranium to Feldspar

    Wijland, G.C.; Pennders, R.M.J.


    Within safety assessment studies, for nuclear waste disposal in deep geologic formations, calculation for the migration of radionuclides through the geosphere are often carried out with models taking sorption into account. In the past 8 years the insight grew that other physico-chemical processes, besides sorption, could affect migration behaviour. While the currently used transport models were being improved taking either linear or non-linear sorption into account, the coupling of geochemical and transport models came into scope. In spite of these developments models which are still based on the sorption theory are frequently applied in studying migration behaviour of radionuclides. This is caused by the necessity of making preliminary pronouncements, while coupled models are still in stage of development and thermodynamic data are very limited available. Therefore one has to obtain insight in the reliability of the models based on the sorption theory. within the sorption database there is a lack of knowledge about mineralogy, composition of the fluid and the experimental conditions underlying the data. Therefore the Expert Group on geochemical Modelling supported by the Finnish proposal in order to obtain insight in the possible deviation of the sorption coefficients that can be estimated from experiments performed with standard samples, fluid composition and experimental conditions. Nine laboratories from OECD membership countries took part in this intercalibration study. In the framework of the Dutch safety assessment studies the Dutch National Institute of Public health and Environmental protection (RIVM) has decided to participate in this exercise. In this report the results are presented of sorption experiments for cesium and natural Uranium to Feldspar. (H.W.). 4 refs.; 1 fig.; 7 tabs

  4. Cesium in the Savannah River Site environment

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of [sup 137]Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of [sup 137]Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope [sup 137]Cs releases have resulted in a negligible risk to the environment and the population it supports.

  5. Cesium in the Savannah River Site environment

    Carlton, W.H.; Bauer, L.R.; Evans, A.G.; Geary, L.A.; Murphy, C.E. Jr.; Pinder, J.E.; Strom, R.N.


    Cesium in the Savannah River Site Environment is published as a part of the Radiological Assessment Program (RAP). It is the fourth in a series of eight documents on individual radioisotopes released to the environment as a result of Savannah River Site (SRS) operations. The earlier documents describe the environmental consequences of tritium, iodine, and uranium. Documents on plutonium, strontium, carbon, and technetium will be published in the future. These are dynamic documents and current plans call for revising and updating each one on a two-year schedule.Radiocesium exists in the environment as a result of above-ground nuclear weapons tests, the Chernobyl accident, the destruction of satellite Cosmos 954, small releases from reactors and reprocessing plants, and the operation of industrial, medical, and educational facilities. Radiocesium has been produced at SRS during the operation of five production reactors. Several hundred curies of {sup 137}Cs was released into streams in the late 50s and 60s from leaking fuel elements. Smaller quantities were released from the fuel reprocessing operations. About 1400 Ci of {sup 137}Cs was released to seepage basins where it was tightly bound by clay in the soil. A much smaller quantity, about four Ci. was released to the atmosphere. Radiocesium concentration and mechanisms for atmospheric, surface water, and groundwater have been extensively studied by Savannah River Technology Center (SRTC) and ecological mechanisms have been studied by Savannah River Ecology Laboratory (SREL). The overall radiological impact of SRS releases on the offsite maximum individual can be characterized by total doses of 033 mrem (atmospheric) and 60 mrem (liquid), compared with a dose of 12,960 mrem from non-SRS sources during the same period of time. Isotope {sup 137}Cs releases have resulted in a negligible risk to the environment and the population it supports.

  6. Cesium 137 in oils and plants from Guatemala

    Ayala, R.E.; Perez, J.F.


    Since 1990 the project of radioactive and environmental contamination started in Guatemala. Studies about the radioactive contamination levels are made within the framework of this project. Cesium-137 has been an interest radionuclide, because it is a fission product released to the environment by the use of nuclear weapons and nuclear power plants accidents. The sampling consisted in collection of soil and grass in 20 provinces of Guatemala, one point by province, and it was made in 1990. The cesium-137 concentration in the samples, was determined by gamma spectrometry, using an hyper pure germanium detector. The results show the presence of radioactive contamination in soil and grass due to cesium-137, at levels that might be considered as normal. The levels found are not harmful for human health, and its importance is the fact that can be used as reference levels for the environmental radioactivity monitoring in Guatemala

  7. Environmental application of cesium-137 irradiation technology: sludges and foods

    Sivinski, J.S.


    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation. (author)

  8. Catalytic oxidation of silicon by cesium ion bombardment

    Souzis, A.E.; Huang, H.; Carr, W.E.; Seidl, M.


    Results for room-temperature oxidation of silicon using cesium ion bombardment and low oxygen exposure are presented. Bombardment with cesium ions is shown to allow oxidation at O 2 pressures orders of magnitude smaller than with noble gas ion bombardment. Oxide layers of up to 30 A in thickness are grown with beam energies ranging from 20--2000 eV, O 2 pressures from 10 -9 to 10 -6 Torr, and total O 2 exposures of 10 0 to 10 4 L. Results are shown to be consistent with models indicating that initial oxidation of silicon is via dissociative chemisorption of O 2 , and that the low work function of the cesium- and oxygen-coated silicon plays the primary role in promoting the oxidation process

  9. Environmental application of cesium-137 irradiation technology: Sludges and foods

    Sivinski, Jacek S.

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation.

  10. Measurement of low levels of cesium-137 in water

    Milham, R.C.; Kantelo, M.V.


    Large volume water sampling systems were developed to measure very low levels of cesium-137 in river water and in finished water from water treatment plants. Three hundred to six hundred liters of filtered water are passed through the inorganic ion exchanger potassium cobalti-ferrocyanide to remove greater than 90% of the cesium. Measurement of cesium-137 by gamma ray spectrometry results in a sensitivity of 0.001 pCi/L. Portable as well as stationary samplers were developed to encompass a variety of applications. Results of a one year study of water from the Savannah River and from water treatment plants processing Savannah River water are presented. 3 references, 7 figures

  11. Sorption kinetics of cesium on hydrous titanium dioxide

    Altas, Y.; Tel, H.; Yaprak, G.


    Two types of hydrous titanium dioxide possessing different surface properties were prepared and characterized to study the sorption kinetics of cesium. The effect of pH on the adsorption capacity were determined in both type sorbents and the maximum adsorption percentage of cesium were observed at pH 12. To elucidate the kinetics of ion-exchange reaction on hydrous titanium dioxide, the isotopic exchange rates of cesium ions between hydrous titanium dioxides and aqueous solutions were measured radiochemically and compared with each other. The diffusion coefficients of Cs + ion for Type1 and Type2 titanium dioxides at pH 12 were calculated as 2.79 x 10 -11 m 2 s -1 and 1.52 x 10 -11 m 2 s -1 , respectively, under particle diffusion controlled conditions. (orig.)

  12. Sericitization of illite decreases sorption capabilities for cesium

    Choung, S.; Hwang, J.; Han, W.; Shin, W.


    Release of radioactive cesium (137Cs) to environment occurs through nuclear accidents such as Chernobyl and Fukushima. The concern is that 137Cs has long half-life (t1/2 = 30.2 years) with chemical toxicity and γ-radiation. Sorption techniques are mainly applied to remove 137Cs from aquatic environment. In particular, it has been known well that clay minerals (e.g, illite) are effective and economical sorbents for 137Cs. Illite that was formed by hydrothermal alteration exist with sericite through "sericitization" processes. Although sericite has analogous composition and lattice structure with illite, the sorptive characteristics of illite and sericite for radiocesium could be different. This study evaluated the effects of hydrothermal alteration and weathering process on illite cesium sorption properties. Natural illite samples were collected at Yeongdong area in Korea as the world-largest hydrothermal deposits for illite. The samples were analyzed by XRF, XRD and SEM-EDX to determine mineralogy, chemical compositions and morphological characteristics, and used for batch sorption experiments. The Yeongdong illites predominantly consist of illite, sericite, quartz, and albite. The measured cesium sorption distribution coefficients (Kd,Cs) of reference illite and sericite were approximately 6000 and 400 L kg-1 at low aqueous concentration (Cw 10-7 M), respectively. In contrast, Kd,Cs values for the Yeongdong illite samples ranged from 500 to 4000 L kg-1 at identical concentration. The observed narrow and sharp XRD peak of sericite indicated that the sericite has better crystallinity compared to illite. These experimental results suggested that sericitization processes of illite can decline the sorption capabilities of illite for cesium under various hydrothermal conditions. In particular, weathering experiments raised the cesium sorption to illite, which seems to be related to the increase of preferential sorption sites for cesium through crystallinity destruction

  13. Strontium-90 and cesium-137 in freshwater from May 1984


    Strontium-90 and cesium-137 in freshwater measured in May 1984 are given in pCi/l. The sampling point is 1, Kasumigaura-Lake (Ibaraki). Collection and pretreatment of samples, preparation of samples for analysis, separation of strontium-90 and cesium-137, determination of stable strontium, calcium and potassium, and counting are described. The sample was passed through a cation exchange column. After the radiochemical separation, the mounted precipitates were counted for activity using low background beta counters normally for 60 minutes. (Mori, K.)

  14. Cesium-137: psychological and social consequences of the Goiania's accident

    Helou, Suzana; Costa Neto, Sebastiao Benicio da


    The book care for radioactive accident occurred in 1987 in Goiania - brazilian city. The accident had origin by the hospitable equipment incorrect handling which contained a stainless steel capsule, in which interior there was cesium-137 chloride. The main boarded aspects are: psychological and social aspects verified after the accident; psychological and social analysis of population of Goiania three years after the accident; essay on the pertinence of Luscher's abbreviate test in psychological evaluation of the radioactive accident victims of Goiania; and psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

  15. Thallous and cesium halide materials for use in cryogenic applications

    Lawless, W.N.


    Certain thallous and cesium halides, either used alone or in combination with other ceramic materials, are provided in cryogenic applications such as heat exchange material for the regenerator section of a closed-cycle cryogenic refrigeration section, as stabilizing coatings for superconducting wires, and as dielectric insulating materials. The thallous and cesium halides possess unusually large specific heats at low temperatures, have large thermal conductivities, are nonmagnetic, and are nonconductors of electricity. They can be formed into a variety of shapes such as spheres, bars, rods, or the like and can be coated or extruded onto substrates or wires. (author)

  16. Using Cesium for 3D Thematic Visualisations on the Web

    Gede, Mátyás


    Cesium ( is an open source, WebGL-based JavaScript library for virtual globes and 3D maps. It is an excellent tool for 3D thematic visualisations, but to use its full functionality it has to be feed with its own file format, CZML. Unfortunately, this format is not yet supported by any major GIS software. This paper intro- duces a plugin for QGIS, developed by the author, which facilitates the creation of CZML file for various types of visualisations. The usability of Cesium is also examined in various hardware/software environments.

  17. Adsorption of iodine and cesium onto some cement materials

    Mine, Tatsuya [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan); Mihara, Morihiro; Ito, Masaru [Power Reactor and Nuclear Fuel Development Corp., Tokai, Ibaraki (Japan). Tokai Works; Kato, Hiroshige [IDC, Tokai, Ibaraki (Japan)


    Cement materials, being expected to be used in structural materials in underground disposals of radioactive wastes, may adsorb nuclides resulting in retardation of their migration in environment. In this report adsorption behaviors of cement pastes toward iodine (as anion) and cesium (as cation) were studied. Adsorption of iodine was remarkable for OPC and MHP pastes that are known to have high molar ratio CaO/SiO{sub 2}, partition coefficient being 100 ml/g for initial tracer concentration of 10{sup -5} mol/l. Partition coefficient for cesium for PFA paste was found to be 5 ml/g on average. (S. Ohno)

  18. Adsorption of iodine and cesium onto some cement materials

    Mine, Tatsuya; Mihara, Morihiro; Ito, Masaru


    Cement materials, being expected to be used in structural materials in underground disposals of radioactive wastes, may adsorb nuclides resulting in retardation of their migration in environment. In this report adsorption behaviors of cement pastes toward iodine (as anion) and cesium (as cation) were studied. Adsorption of iodine was remarkable for OPC and MHP pastes that are known to have high molar ratio CaO/SiO 2 , partition coefficient being 100 ml/g for initial tracer concentration of 10 -5 mol/l. Partition coefficient for cesium for PFA paste was found to be 5 ml/g on average. (S. Ohno)

  19. Cesium accumulation in native trees from the Brazilian Cerrado

    Franca, E.J.D.; Miranda, M.V.F.E.S.; Santos, T.O.; Cantinha, R.S.; Fernandes, E.A.D.N.


    Even considered not essential for plants, cesium may cycle within forest ecosystems. Taking into account the lack of knowledge on the distribution of this chemical element in Brazilian ecosystems, this work encompasses the unexpected cesium accumulation in native plant leaves from Cerradao, a Brazilian hotspot of world biodiversity. Some trees were Cs accumulators, achieving mass fractions in leaves 700 times higher (up to 12.7 mg kg -1 ) when compared to other Brazilian native tree leaves from the Atlantic Forest. In fact, such trace element accumulation in leaves was not previously noticed for Brazilian ecosystems despite the intra- and inter-species variability observed in Cerrado tree leaves. (author)

  20. Selective chemical binding enhances cesium tolerance in plants through inhibition of cesium uptake.

    Adams, Eri; Chaban, Vitaly; Khandelia, Himanshu; Shin, Ryoung


    High concentrations of cesium (Cs(+)) inhibit plant growth but the detailed mechanisms of Cs(+) uptake, transport and response in plants are not well known. In order to identify small molecules with a capacity to enhance plant tolerance to Cs(+), chemical library screening was performed using Arabidopsis. Of 10,000 chemicals tested, five compounds were confirmed as Cs(+) tolerance enhancers. Further investigation and quantum mechanical modelling revealed that one of these compounds reduced Cs(+) concentrations in plants and that the imidazole moiety of this compound bound specifically to Cs(+). Analysis of the analogous compounds indicated that the structure of the identified compound is important for the effect to be conferred. Taken together, Cs(+) tolerance enhancer isolated here renders plants tolerant to Cs(+) by inhibiting Cs(+) entry into roots via specific binding to the ion thus, for instance, providing a basis for phytostabilisation of radiocesium-contaminated farmland.

  1. Sorption of cesium in young till soils

    Lusa, Merja; Lempinen, Janne; Ahola, Hanna; Soederlund, Mervi; Lehto, Jukka [Helsinki Univ. (Finland). Laboratory of Radiochemistry; Lahdenperae, Anne-Maj [Saanio and Riekkola Oy, Consulting Engineers, Helsinki (Finland); Ikonen, Ari T.K. [Posiva Oy, Eurajoki (Finland)


    Soil samples from three forest soil pits were examined down to a depth of approximately three metres using 1 M ammonium acetate extraction and microwave-assisted extraction with concentrated nitric acid (HNO{sub 3}), to study the binding of cesium (Cs) at Olkiluoto Island, southern Finland. Ammonium acetate was used to extract the readily exchangeable Cs fractions roughly representing the Cs fraction in soil which is available for plants. Microwave-assisted HNO{sub 3} extraction dissolves various minerals, e.g. carbonates, most sulphides, arsenides, selenides, phosphates, molybdates, sulphates, iron (Fe) and manganese (Mn) oxides and some silicates (olivine, biotite, zeolite), and reflects the total Cs concentrations. Cs was mostly found in the strongly bound fraction obtained through HNO{sub 3} extraction. The average Cs concentrations found in this fraction were 3.53 ± 0.30 mg/kg (d.w.), 3.06 ± 1.86 mg/kg (d.w.) and 1.83 ± 0.42 mg/kg (d.w.) in the three soil pits, respectively. The average exchangeable Cs found in the ammonium acetate extraction in all three sampling pits was 0.015 ± 0.008 mg/kg (d.w.). In addition, Cs concentrations in the soil solution were determined and in situ distribution coefficients (K{sub d}) for Cs were calculated. Furthermore, the in situ K{sub d} data was compared with the Cs K{sub d} data obtained using the model batch experiments. The in situ K{sub d} values were observed to fairly well follow the trend of batch sorption data with respect to soil depth, but on average the batch distribution coefficients were almost an order of magnitude higher than the in situ K{sub d} data. In situ Cs sorption data could be satisfactory fitted with the Langmuir sorption isotherm, but the Freundlich isotherm failed to fit the data. Finally, distribution coefficients were calculated by an ion exchange approach using soil solution data, the cation exchange capacity (CEC) as well as Cs to sodium (Na) and Cs to potassium (K) ion exchange selectivity

  2. 21 CFR 113.5 - Current good manufacturing practice.


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...

  3. Dicty_cDB: VFB113 [Dicty_cDB

    Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

  4. Dicty_cDB: CHC113 [Dicty_cDB

    Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

  5. Ionization mechanism of cesium plasma produced by irradiation of dye laser

    Yamada, Jun; Shibata, Kohji; Uchida, Yoshiyuki; Hioki, Yoshiaki; Sahashi, Toshio.


    When a cesium vapor was irradiated by a dye laser which was tuned to the cesium atomic transition line, the number of charged particles produced by the laser radiation was observed. Several sharp peaks in the number of charged particles were observed, which corresponded to the atomic transition where the lower level was the 6P excited atom. The ionization mechanism of the laser-produced cesium plasma has been discussed. An initial electron is produced by laser absorptions of the cesium dimer. When the cesium density is high, many 6P excited atoms are excited by electron collisions. The 6P excited atom further absorbs the laser photon and is ionized through the higher-energy state. As the cesium vapor pressure increases, the resonance effect becomes observable. The 6P excited atom plays dominant role in the ionization mechanism of the laser-produced cesium plasma. (author)

  6. Cesium-137 accumulation in higher plants before and after Chernobyl

    Sawidis, T.; Drossos, E.; Papastefanou, C.; Heinrick, G.


    Cesium-137 concentrations in plant species of three biotypes of northern Greece, differing in location as well as in vegetation, are reported following the Chernobyl reactor accident. The cesium uptake by plants was due to the foliar deposition rather than the root uptake. The highest level of cesium in plants was found in Ranunculus sardous, a pubescent plant. The 137 Cs concentration was about 22kBq kg -1 d.w. A high level of cesium was also found in Salix alba ( 137 Cs: 19.6 kBq kg -1 d.w.), a deciduous tree showing that hairy leaves or leaves having rough and large surfaces can absorb greater amounts of radioactivity (surface effect). A comparison is also made between the results of measurements of the present study and the results of measurements of some herbarium plants collected one year before the accident as well as the results of measurements of some new plants grown and collected one year after the accident resulting in a natural removal rate of 137 Cs in plants varying from 14 to 130 days

  7. Monocrystallomimicry in the aerosols of ammonium and cesium halides

    Melikhov, I.V.; Kitova, E.N.; Kozlovskaya, EhD.; Kamenskaya, A.N.; Mikheev, N.B.; Kulyukhin, S.A.


    It is experimentally shown that initial CsI and NH 4 Hal nanocrystals combining into mixed aggregates of polyhedral form (pseudo monocrystals) are formed in the process of cocrystallization of ammonium halide and cesium iodide. The origination and growth of the pseudo monocrystals on the account of successive addition of initial crystals is described by the Fokker-Plank equation [ru

  8. Behaviour of cesium 134 and 137 in lake ecosystems

    Huebel, K.; Saenger, W.; Luensmann, W.


    The time dependent cesium activity concentration observed in surface water samples from South Bavarian lakes after the Chernobyl accident is analysed by use of a two-compartment model simulating the accidental transport of radiocesium from surface water to suspended particles. (orig.)

  9. Detection of quadrupole relaxation in an optically pumped cesium vapour

    Bernabeu, E; Tornos, J


    The relaxation of quadrupole orientation induced by means of optical pumping in a cesium vapour is experimentally studied, and the results are compared to the theoretical predictions. The optical detection process of this type of orientation is also discussed as a function of the polarization and spectral profile of the detection light.

  10. Kinetics of 137cesium in cerebral structures and blood

    Ribas, B.; Gonzalez, M.D.; Rio, J. del; Reus, M.I.S.; Gonzalez-Baron, M.


    The old clinical use of cesium in epilepsy expresses a relation of this metal with the central nervous system. Two groups of male Wistar rats of 200 g were administered single doses of 50μCi intravenously for blood kinetics and 2μCi 137 CsCl in each lateral ventricle of the brain for the kinetics in the cerebral structures, respectively. In both cases under ether anesthesia. Blood samples of IV gouts were weighed, and cerebral structure hypothalamus, hypocampus, striatum, cortex, cerebellum, mesencephalon and medulla oblongata dissected, cleaned, washed, dried, weighed, and in both cases cpm of the samples evaluated submitting it to the gamma radiations detector. In both experimental values of the 137 CsCl kinetics are expressed and applying the retroprojection method; parameters and constants are obtained. tsub(1/2) alpha = 0.0358 h and tsub(1/2) beta = 6.7159 h. In tables the equations of the alpha and beta phases are expressed. In blood after the rapid diminution of the radioactivity in the first 5 min the equilibrium phase is reached in 30 min afterwards, and the values remain almost the same 4 h after the injection and cesium is slowly eliminated by the rat. Cerebral structures after its intracerebroventricular application show that cesium has a great uptake velocity, it is rapidly incorporated by hypothalamus and after by cortex, hypocampus, striatum, mesencephalon and medulla oblongata, the two last showing the slower incorporation. After 24 h the cesium radioactivity declines slowly and progressively. (author)

  11. Strontium-90 and cesium-137 in fresh water


    Japan Chemical Analysis Center has analysed the strontium-90 and Cesium-137 contents in fresh water from 7 prefectures in Japan by the commission of Science and Technology Agency of Japanese Government. The method described in ''Radioactivity Survey Data in Japan No. 43 (NIRS-RSD-43, 1977) was applied to the analysis of these two radionuclides in samples. (author)

  12. Hot demonstration of proposed commercial cesium removal technology

    Lee, D.D.; Travis, J.R.; Gibson, M.R.


    This report describes the work done in support of the development of technology for the continuous removal and concentration of radioactive cesium in supernatant from Melton Valley Storage Tanks (MVSTs) at the ORNL site. The primary objective was to test candidate absorbers and ion exchangers under continuous-flow conditions using actual supernatant from the MVSTs. An experimental system contained in a hot-cell facility was constructed to test the materials in columns or modules using the same batch of supernatant to allow comparison on an equal basis. Resorcinol/formaldehyde (RF) resin was evaluated at three flow rates with 50% breakthrough ranges of 35 to 50 column volumes (CV) and also through a series of five loading/elution/regeneration cycles. The results reported here include the cesium loading breakthrough curves, elution curves (when applicable), and operational problems and observations for each material. The comparative evaluations should provide critical data for the selection of the sorbent for the ORNL Cesium Removal Demonstration project. These results will be used to help determine the design parameters for demonstration-scale systems. Such parameters include rates of cesium removal, quantity of resin or sorbent to be used, and elution and regeneration requirements, if applicable

  13. Membrane-based separation technologies for cesium, strontium, and technetium

    Kafka, T.


    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah

  14. Validation and Application of Concentrated Cesium Eluate Physical Property Models

    Choi, A.S.


    This work contained two objectives. To verify the mathematical equations developed for the physical properties of concentrated cesium eluate solutions against experimental test results obtained with simulated feeds. To estimate the physical properties of the radioactive AW-101 cesium eluate at saturation using the validated models. The Hanford River Protection Project (RPP) Hanford Waste Treatment and Immobilization Plant (WTP) is currently being built to extract radioisotopes from the vast inventory of Hanford tank wastes and immobilize them in a silicate glass matrix for eventual disposal at a geological repository. The baseline flowsheet for the pretreatment of supernatant liquid wastes includes removal of cesium using regenerative ion-exchange resins. The loaded cesium ion-exchange columns will be eluted with nitric acid nominally at 0.5 molar, and the resulting eluate solution will be concentrated in a forced-convection evaporator to reduce the storage volume and to recover the acid for reuse. The reboiler pot is initially charged with a concentrated nitric acid solution and kept under a controlled vacuum during feeding so the pot contents would boil at 50 degrees Celsius. The liquid level in the pot is maintained constant by controlling both the feed and boilup rates. The feeding will continue with no bottom removal until the solution in the pot reaches the target endpoint of 80 per cent saturation with respect to any one of the major salt species present

  15. Selective extraction of cesium: from compound to process

    Simon, N.; Eymard, S.; Tournois, B.; Dozol, J.F.


    Under the French law of 30 December 1991 on nuclear waste management, research is conducted to recover long-lived fission products from high-level radioactive effluents generated by spent fuel reprocessing, in order to destroy them by transmutation or encapsulate them in specific matrices. Cesium extraction with mono and bis-crown calix(4)arenes (Frame 1) is a candidate for process development. These extractants remove cesium from highly acidic or basic pH media even with high salinity. A real raffinate was treated in 1994 in a hot cell to extract cesium with a calix-crown extractant. The success of this one batch experiment confirmed the feasibility of cesium decontamination from high-level liquid waste. It was then decided to develop a process flowchart to extract cesium selectively from high-level raffinate, to be included in the general scheme of long-lived radionuclide partitioning. It was accordingly decided to develop a process based on liquid-liquid extraction and hence optimize a calixarene/diluent solvent according to: - hydraulic properties: density, viscosity, interfacial tension, - chemical criteria: sufficient cesium extraction (depending on the diluent), kinetics, third phase elimination... New mono-crown-calixarenes branched with long aliphatic groups (Frame 2) were designed to be soluble in aliphatic diluents. To prevent third phase formation associated with nitric acid extraction, the addition of modifiers (alcohol, phosphate and amide) in the organic phase was tested (Frame 3). Table 1 shows examples of calixarene/diluent systems suitable for a process flowchart, and Figure 2 provides data on cesium extraction with these new systems. Alongside these improvements, a system based on a modified 1,3-di(n-octyl-oxy)2,4-calix[4]arene crown and a modified diluent was also developed, considering a mixed TPH/NPHE system as the diluent, where TPH (hydrogenated tetra propylene) is a common aliphatic industrial solvent and NPHE is nitrophenyl

  16. Cesium separation using integrated electro-membrane technique

    Fors, Patrik; Lillfors-Pintér, Christina; Widestrand, Henrik; Velin, Anna; Bengtsson, Bernt


    Conventional separation technologies such as ion exchange, electro-deionisation and cross flow filtration are not always effective to eliminate nuclides, which are weekly ionised, complexed or hydrated in effluents. Specific nuclide selective absorbers perform well for the treatment of active and contaminated wastewaters but most absorbers generate additional waste while treating high volumes of contaminated water and often show limitations in operating at high flow rates. Electrochemical Ion Exchange (EIX) and EIX in combination with absorbers may offer an alternative solution that overcomes those limitations. This paper reports on the optimization and performance of the integrated technique EIX, for the treatment of low activity effluents that contain cesium and other nuclides. The three-compartment EIX system, which operates with authentic reactor coolant with enhanced nuclide content, indicates high, over 90%, elimination of cesium in a single pass operation mode. With the in-situ and instant ion exchange regeneration, the system successfully reduces the activity from an initial range of 400-2600 Bq/kg to close to detection limit at a velocity of 10-15 cm/min. The applied current density varies between 50-200 mA/cm 2 and the mass balance is close to 100%. During the process, the eliminated cesium and other nuclides are concentrated up to the limits where reverse migration from the concentrated chamber occurs. The concentrate could then be treated with specific absorbents at low flow rates. EIX in combination with cesium-selective ion exchanger CsTreat ® separates the cesium-137 efficiently, but up to now the process does not perform according to EIX principles for the treatment of low grade radioactive wastewaters it rather performs as an irreversible adsorber. The aim with the outcome of the presently ongoing long-term tests is to further support the Best Available Technique Minimizing All Nuclide (BATMAN) projects of Vattenfall NPPs. (author)

  17. Experimental study on cesium immobilization in struvite structures

    Wagh, Arun S.; Sayenko, S.Y.; Shkuropatenko, V.A.; Tarasov, R.V.; Dykiy, M.P.; Svitlychniy, Y.O.; Virych, V.D.; Ulybkina, E.A.


    Graphical abstract: X-ray diffraction patterns of Ceramicrete forms, green representing struvite-K, and red, struvite-(K,Cs) with 10 wt.% CsCl in it. Cs substitutes partially for K, which immobilizes Cs at room temperature by the acid–base reaction. - Highlights: • Struvite structure of Ceramicrete is an excellent host of radioactive cesium. • The volatility problem of cesium can be avoided by this method. • This method can be used to produce cesium waste forms in ambient conditions. • It can also be used to pretreat cesium in glass vitrification technology. • It also provides a method to produce safe sealed radioactive sources of cesium. - Abstract: Ceramicrete, a chemically bonded phosphate ceramic, was developed for nuclear waste immobilization and nuclear radiation shielding. Ceramicrete products are fabricated by an acid–base reaction between magnesium oxide and mono potassium phosphate that has a struvite-K mineral structure. In this study, we demonstrate that this crystalline structure is ideal for incorporating radioactive Cs into a Ceramicrete matrix. This is accomplished by partially replacing K by Cs in the struvite-K structure, thus forming struvite-(K, Cs) mineral. X-ray diffraction and thermo-gravimetric analyses are used to confirm such a replacement. The resulting product is non-leachable and stable at high temperatures, and hence it is an ideal matrix for immobilizing Cs found in high-activity nuclear waste streams. The product can also be used for immobilizing secondary waste streams generated during glass vitrification of spent fuel, or the method described in this article can be used as a pretreatment method during glass vitrification of high level radioactive waste streams. Furthermore, it suggests a method of producing safe commercial radioactive Cs sources.

  18. Analysis of cesium extracting solvent using GCMS and HPLC

    White, T.L.; Herman, C.C.; Crump, S.L.; Marinik, A.R.; Lambert, D.P.; Eibling, R.E.


    A high-level waste (HLW) remediation process scheduled to begin in 2007 at the Savannah River Site is the Modular Caustic Side Solvent Extraction (CSSX) Unit (MCU). The MCU will use a hydrocarbon solvent (diluent) containing a cesium extractant, a calix[4]arene compound, to extract radioactive cesium from caustic HLW. The resulting decontaminated HLW waste or raffinate will be processed into grout at the Saltstone Production Facility (SPF). The cesium containing CSSX stream will undergo washing with dilute nitric acid followed by stripping of the cesium nitrate into a very dilute nitric acid or the strip effluent stream and the CSSX solvent will be recycled. The Defense Waste Processing Facility (DWPF) will receive the strip effluent stream and immobilize the cesium into borosilicate glass. Excess CSSX solvent carryover from the MCU creates a potential flammability problem during DWPF processing. Bench-scale DWPF process testing was performed with simulated waste to determine the fate of the CSSX solvent components. A simple high performance liquid chromatography (HPLC) method was developed to identify the modifier (which is used to increase Cs extraction and extractant solubility) and extractant within the DWPF process. The diluent and trioctylamine (which is used to suppress impurity effect and ion-pair disassociation) were determined using gas chromatography mass spectroscopy (GCMS). To close the organic balance, two types of sample preparation methods were needed. One involved extracting aqueous samples with methylene chloride or hexane, and the second was capturing the off gas of the DWPF process using carbon tubes and rinsing the tubes with carbon disulfide for analysis. This paper addresses the development of the analytical methods and the bench-scale simulated waste study results. (author)

  19. Experimental study on cesium immobilization in struvite structures

    Wagh, Arun S., E-mail: [Environmental Science Division, Argonne National Laboratory, 9700 S. Cass Avenue, IL 60439 (United States); Sayenko, S.Y.; Shkuropatenko, V.A.; Tarasov, R.V.; Dykiy, M.P.; Svitlychniy, Y.O.; Virych, V.D.; Ulybkina, E.A. [National Science Center, Kharkov Institute of Physics and Technology, Kharkov (Ukraine)


    Graphical abstract: X-ray diffraction patterns of Ceramicrete forms, green representing struvite-K, and red, struvite-(K,Cs) with 10 wt.% CsCl in it. Cs substitutes partially for K, which immobilizes Cs at room temperature by the acid–base reaction. - Highlights: • Struvite structure of Ceramicrete is an excellent host of radioactive cesium. • The volatility problem of cesium can be avoided by this method. • This method can be used to produce cesium waste forms in ambient conditions. • It can also be used to pretreat cesium in glass vitrification technology. • It also provides a method to produce safe sealed radioactive sources of cesium. - Abstract: Ceramicrete, a chemically bonded phosphate ceramic, was developed for nuclear waste immobilization and nuclear radiation shielding. Ceramicrete products are fabricated by an acid–base reaction between magnesium oxide and mono potassium phosphate that has a struvite-K mineral structure. In this study, we demonstrate that this crystalline structure is ideal for incorporating radioactive Cs into a Ceramicrete matrix. This is accomplished by partially replacing K by Cs in the struvite-K structure, thus forming struvite-(K, Cs) mineral. X-ray diffraction and thermo-gravimetric analyses are used to confirm such a replacement. The resulting product is non-leachable and stable at high temperatures, and hence it is an ideal matrix for immobilizing Cs found in high-activity nuclear waste streams. The product can also be used for immobilizing secondary waste streams generated during glass vitrification of spent fuel, or the method described in this article can be used as a pretreatment method during glass vitrification of high level radioactive waste streams. Furthermore, it suggests a method of producing safe commercial radioactive Cs sources.

  20. 7 CFR 1221.113 - Financial statements.


    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...

  1. 13 CFR 113.525 - Fringe benefits.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...

  2. Desorption of intrinsic cesium from smectite: inhibitive effects of clay particle organization on cesium desorption.

    Fukushi, Keisuke; Sakai, Haruka; Itono, Taeko; Tamura, Akihiro; Arai, Shoji


    Fine clay particles have functioned as transport media for radiocesium in terrestrial environments after nuclear accidents. Because radiocesium is expected to be retained in clay minerals by a cation-exchange reaction, ascertaining trace cesium desorption behavior in response to changing solution conditions is crucially important. This study systematically investigated the desorption behavior of intrinsic Cs (13 nmol/g) in well-characterized Na-montmorillonite in electrolyte solutions (NaCl, KCl, CaCl2, and MgCl2) under widely differing cation concentrations (0.2 mM to 0.2 M). Batch desorption experiments demonstrated that Cs(+) desorption was inhibited significantly in the presence of the environmental relevant concentrations of Ca(2+) and Mg(2+) (>0.5 mM) and high concentrations of K(+). The order of ability for Cs desorption was Na(+) = K(+) > Ca(2+) = Mg(2+) at the highest cation concentration (0.2 M), which is opposite to the theoretical prediction based on the cation-exchange selectivity. Laser diffraction grain-size analyses revealed that the inhibition of Cs(+) desorption coincided with the increase of the clay tactoid size. Results suggest that radiocesium in the dispersed fine clay particles adheres on the solid phase when the organization of swelling clay particles occurs because of changes in solution conditions caused by both natural processes and artificial treatments.

  3. TED Study of Si(113) Surfaces

    Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.

    A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.

  4. Beta-delayed proton emitter $^{113}Xe$

    Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T


    The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).

  5. Method and article for primary containment of cesium wastes. [DOE patent application

    Angelini, P.; Lackey, W.J.; Stinton, D.P.; Blanco, R.E.; Bond, W.D.; Arnold, W.D. Jr.


    A method for producing a cesium-retentive waste form, characterized by a high degree of compositional stability and mechanical integrity, is provided by subjecting a cesium-loaded zeolite to heat under conditions suitable for stabilizing the zeolite and immobilizing the cesium, and coating said zeolite for sufficient duration within a suitable environment with at least one dense layer of pyrolytic carbon to seal therein said cesium to produce a final, cesium-bearing waste form. Typically, the zolite is stabilized and the cesium immobilized in less than four hours by confinement within an air environment maintained at about 600/sup 0/C. Coatings are thereafter applied by confining the calcined zeolite within a coating environment comprising inert fluidizing and carbon donor gases maintained at 1000/sup 0/C for a suitable duration.

  6. Theoretical study of the chemical properties of cesium hydride; Teoreticke studium chemickych vlastnosti hydridu cezia

    Skoviera, J [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Katedra fyzikalnej a teoretickej chemie, 84215 Bratislava (Slovakia)


    A theoretical study of radiofrequency source of hydrogen ions in the International Thermonuclear Experimental Reactor (ITER) used a cesium grid as a source of electrons for ionization of hydrogen. In the process of ionization of hydrogen, however, there is a weathering of cesium grid, resulting into a group of undesired products - cesium hydrides and materials derived from cesium hydride. We calculated the potential curves of cesium hydride and of its anion and cation, their spectroscopic properties and partly their electrical properties. To make electrical properties comparable with the experiment, we calculated for all also the vibration corrections. Lack of convergence in RASSCF step caused, that the electrical properties of excited states are still an open question of chemical properties of cesium hydride. (authors)

  7. Strontium-90 and cesium-137 in service water


    Prefectural public health laboratories and institutes and Japan Chemical Analysis Center have analysed the contents of strontium-90 and cesium-137 in service water under the commission of Science and Technology Agency. At each prefectural public health laboratories and institutes, 100 literes of service water (8 prefectures, water from the intake of each station of water works) and tap water (32 prefectures) were collected as sample twice a year. The samples were filtrated with large filter papers after addition and mixture of both some carries. The filtration was then applied on a column filled the sodium cation exchange resin, and all the cations were absorbed on it. These resin and filter papers were collected at Japan Chemical Analysis Center. At Japan Chemical Analysis Center, these collected samples were radiochemically analysed for strontium-90 and cesium-137 using the method applied for the analysis of rain and dry fallout materials. (author)

  8. Strontium-90 and cesium-137 in total diet


    Under the commission of Science and Technology Agency, Japan Chemical Analysis Center has analysed total diet samples collected from 30 prefectures (2 times per year), and determined to content of strontium-90 and cesium-137 in these samples. Each Prefectural public health laboratories and institutes have collected all the daily regular diet consumed for five persons, namely three meals and other eating between meals, for radiochemical analysis in polyethylene containers. These samples were collected to Japan Chemical Analysis Center after carbonization without smoke rising in the large stainless dish. At Japan Chemical Analysis Center, these samples were asked in an electric muffle furnance. And the ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The nuclides were dissolved into hydrochloric acid and filtrated, after it was added with nitric acid and heated to dryness. The filtrates was analysed for strontium-90 and cesium-137 using the method recommended by Science and Technology Agency. (author)

  9. Cesium-137 in Norwegian milk 1960-1976

    Hvinden, T.


    Cesium-137 in milk has been measured at 11 sampling sites in Norway since 1960. The results show seasonal variations, normally with a peak during summer, and variations from district to district, depending upon farming and precipitation conditions. The concentration of cesium-137, averaged over the 11 sampling sites, reached a maximum of 0.44 nanocurie/litre in 1964, decreasing to 0.05 in 1975 and 1976. The range of variations within the 11 sites is of the order of 10. At other sites, with high precipitation and low grazing field qualities, the concentration has been found to be higher than at the 11 sites, giving a range of variations of more than 100. (Auth.)

  10. Modelling the release behaviour of cesium during severe fuel degradation

    Lewis, B.J.; Andre, B.; Morel, B.


    An analytical model has been applied to describe the diffusional release of fission product cesium from Zircaloy-clad fuel under high-temperature reactor accident conditions. The present treatment accounts for the influence of the atmosphere (i.e., changing oxygen potential) on the state of fuel oxidation and the release kinetics. The effects of fuel dissolution on the volatile release behaviour (under reducing conditions) is considered in terms of earlier crucible experiments and a simple model based on bubble coalescence and transport in metal pools. The model has been used to interpret the cesium release kinetics observed in steam and hydrogen experiments at the Vertical Irradiation (VI) Facility in the Oak Ridge National Laboratory and at the HEVA/VERCORS Facility in the Commissariat a l'Energie Atomique. (author)

  11. Hydrological methods preferentially recover cesium from nuclear waste salt cake

    Brooke, J.N.; Hamm, L.L.


    The Savannah River Site is treating high level radioactive waste in the form of insoluble solids (sludge), crystallized salt (salt cake), and salt solutions. High costs and operational concerns have prompted DOE to look for ways to improve the salt cake treatment process. A numerical model was developed to evaluate the feasibility of pump and treat technology for extracting cesium from salt cake. A modified version of the VAM3DCG code was used to first establish a steady-state flow field, then to simulate 30 days of operation. Simulation results suggest that efficient cesium extraction can be obtained with low displacement volumes. The actual extraction process will probably be less impressive because of nonuniform properties. 2 refs., 2 figs

  12. Cesium contamination of mosses in county Vas, Hungary

    Golya, I.; Sebestyen, R.


    Two species of mosses were examined to assess radiocesium contamination of Vas county, and to analyse some aspects of mosses for use as indicator of radioactive contamination. Experimental results demonstrated that the distribution of contamination in a given region could be characterized by the cesium contamination of mosses. Sampling sites should be selected with special attention paid to spots with high contamination. Regression analysis proved that the contamination of mosses originated from Chernobyl fallout. (author) 4 refs.; 2 figs

  13. Detection of the actinides and cesium from environmental samples

    Snow, Mathew Spencer

    Detection of the actinides and cesium in the environment is important for a variety of applications ranging from environmental remediation to safeguards and nuclear forensics. The utilization of multiple different elemental concentrations and isotopic ratios together can significantly improve the ability to attribute contamination to a unique source term and/or generation process; however, the utilization of multiple elemental "signatures" together from environmental samples requires knowledge of the impact of chemical fractionation for various elements under a variety of environmental conditions (including predominantly aqueous versus arid conditions). The research reported in this dissertation focuses on three major areas: 1. Improving the understanding of actinide-mineral interactions at ultra-low concentrations. Chapter 2 reports a batch sorption and modeling study of Np(V) sorption to the mineral goethite from attomolar to micromolar concentrations. 2. Improving the detection capabilities for Thermal Ionization Mass Spectrometry (TIMS) analyses of ultra-trace cesium from environmental samples. Chapter 4 reports a new method which significantly improves the chemical yields, purification, sample processing time, and ultimately, the detection limits for TIMS analyses of femtogram quantities of cesium from a variety of environmental sample matrices. 3. Demonstrating how actinide and cesium concentrations and isotopic ratios from environmental samples can be utilized together to determine a wealth of information including environmental transport mechanisms (e.g. aqueous versus arid transport) and information on the processes which generated the original material. Chapters1, 3 and 5 demonstrate these principles using Pu, Am, Np, and Cs concentrations and isotopic ratios from contaminated soils taken near the Subsurface Disposal Area (SDA) of Idaho National Laboratory (INL) (a low level radioactive waste disposal site in southeastern Idaho).

  14. Extraction of cesium and strontium from nuclear waste

    Davis, Jr., Milton W.; Bowers, Jr., Charles B.


    Cesium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5) [1-hydroxy-2-ethylhexyl]benzo 18-crown-6 compound and a cation exchanger in a matrix solution. Strontium is extracted from acidified nuclear waste by contacting the waste with a bis 4,4'(5') [1-hydroxyheptyl]cyclohexo 18-crown-6 compound, and a cation exchanger in a matrix solution.

  15. Tunable Optical Delay in Doppler-Broadened Cesium Vapor


    REFERENCE: 36 % [1] J. M. Amini and H. Gould 37 % High Precision Measurement of the Static Dipole Polarizability of Cs 38 % Phys. Rev. Lett., American... polarizability of cesium. Phys. Rev. Lett. 91 (15), 153001. Andalkar, A. and R. B. Warrington (2002, Feb). High-resolution measurement of the pressure...Physics Publishing. Morgus, L., T. Morgus, T. Drake, and J. Huennekens (2008). Hyperfine state- changing collisions of Cs (6p1/2) atoms with argon

  16. Electrically switched cesium ion exchange. FY 1997 annual report

    Lilga, M.A.; Orth, R.J.; Sukamto, J.P.H.


    This paper describes the Electrically Switched Ion Exchange (ESIX) separation technology being developed as an alternative to ion exchange for removing radionuclides from high-level waste. Progress in FY 1997 for specific applications of ESIX is also outlined. The ESIX technology, which combines ion exchange and electrochemistry, is geared toward producing electroactive films that are highly selective, regenerable, and long lasting. During the process, ion uptake and elution can be controlled directly by modulating the potential of an ion exchange film that has been electrochemically deposited onto a high surface area electrode. This method adds little sodium to the waste stream and minimizes the secondary wastes associated with traditional ion exchange techniques. Development of the ESIX process is well underway for cesium removal using ferrocyanides as the electroactive films. Films having selectivity for perrhenate (a pertechnetate surrogate) over nitrate also have been deposited and tested. Based on the ferrocyanide film capacity, stability, rate of uptake, and selectivity shown during performance testing, it appears possible to retain a consistent rate of removal and elute cesium into the same elution solution over several load/unload cycles. In batch experiments, metal hexacyanoferrate films showed high selectivities for cesium in concentrated sodium solutions. Cesium uptake was unaffected by Na/Cs molar ratios of up to 2 x 10 4 , and reached equilibrium within 18 hours. During engineering design tests using 60 pores per inch, high surface area nickel electrodes, nickel ferrocyanide films displayed continued durability. losing less than 20% of their capacity after 1500 load/unload cycles. Bench-scale flow system studies showed no change in capacity or performance of the ESIX films at a flow rate up to 13 BV/h, the maximum flow rate tested, and breakthrough curves further supported once-through waste processing. 9 refs., 24 figs

  17. Effect of Suez Canal Marine Sediment on Sorption of Cesium

    Hassan, H.B.


    Suez Canal is surrounded by navigation, industrial, agricultural activities and suffers from high rate of population growth that discharging waste into Suez Canal. The Suez Canal coastal waters are influenced by a complex variety of physical, geochemical and biological processes, which influence the behavior, transport and fate of containments released into the marine environment. Sorption of releasing containment such as cesium in Suez Canal water is investigated because of its toxic effect on the marine environment. The object of present study is to determine the effects some of physical and chemical characteristics of collected sediment samples from the three important locations on Suez Canal (Suez Bay, Bitter Lakes and El- Temsah Lake beaches) on sorption behavior of cesium by using batch experiment. Batch experiment was used to study the sorption of the cesium ion. The sorption process is dependent on mineral constituents of Suez Canal sediment and their characteristics. Analytical methods which included particle size and X-ray diffraction (XRD) analyses found that particle size of Suez Canal sediment samples is characterized by sand to fine sand and quartz is the main mineralogical species. Distribution coefficient (K d ) which represent geochemical processes and particle size of these sediment samples effect on the degree of cesium sorption to the sediment. Also (K d ) increase with increase cation exchangeable capacity (CEC). The Suez Canal sediment samples have low (K d ) values which effected by their physical and chemical properties. Sample (2) has highest distribution coefficient (K d ) between measured samples due to containing ratio 30% of fine sand and high ratio of organic matter.

  18. Cesium dihydrophosphate monocrystal growth and certain of their properties

    Rashkovich, L.N.; Meteva, K.B.; Shevchik, Ya.Eh.; Goffman, V.G.; Mishchenko, A.V.


    Crystals of cesium dihydrophosphate (centrisymmetrical, monoclinic, point symmetric group 2/m) are obtained by methods involving solvent evaporation and temperature reduction. At -122 deg C, a ferroelectric phase transition occurs, and at 230 and 265 deg C first-kind transitions, which are not accompanied by composition changes. CsH 2 PO 4 solubility substantially increases with higher medium acidity, and remains approximately constant in alkali medium

  19. Juridical-penal aspects of the cesium-137 accident

    Soares, Carolina Chaves


    The study of the juridical-penal aspects of the Cesium-137 accident, has, as a base, the police inquiry and the penal lawsuit concerning to the episode. Due to the lack of a law which typified activities related with radioisotope material as crime, the responsible were sentenced according to the penalties of body injury crime and homicide. Among the 10 investigated people, only 5 were condemned by the Judiciary and only 4 serve the sentence. (author)

  20. Mechanism of cesium sorption on potassium titanium hexacyanoferrate

    Sun Yongxia; Xu Shiping; Song Chongli


    The mechanism of cesium sorption on potassium titanium hexacyanoferrate is described. The dependence of the sorption speed on temperature, particle granule size, and the stirring speed is studied. The results show that the sorption process is controlled by liquid film diffusion and particle diffusion. An exchange reaction occurs mainly between K + in the exchanger and Cs + in the solution, i.e. potassium titanium hexacyanoferrate, and Cs + of simulated high-level liquid waste

  1. Test procedures and instructions for Hanford tank waste supernatant cesium removal

    Hendrickson, D.W., Westinghouse Hanford


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test using Hanford Double-Shell Slurry Feed supernatant liquor from tank 251-AW-101 in a bench-scale column.Cesium sorbents to be tested include resorcinol-formaldehyde resin and crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-022, Hanford Tank Waste Supernatant Cesium Removal Test Plan.

  2. Test procedures and instructions for Hanford complexant concentrate supernatant cesium removal using CST

    Hendrickson, D.W.


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Complexant Concentrate supernatant liquor from tank 241-AN-107, in a bench-scale column. The cesium sorbent to be tested is crystalline silicotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-023, Hanford Complexant Concentrate Supernatant Cesium Removal Test Plan.

  3. Separation of radio cesium from PUREX feed solution by sorption on composite ammonium molybdo phosphate (AMP)

    Singh, I.J.; Achuthan, P.V.; Jain, S.; Janardanan, C.; Gopalakrishnan, V.; Wattal, P.K.; Ramanujam, A.


    Composite AMP exchanger was developed and evaluated for separation of radio cesium from dissolver solutions of PUREX process using a column experiment. The composite shows excellent sorption of radio cesium from dissolver solutions without any loss of plutonium and uranium. The removal of radio cesium from dissolver solutions will help in lowering the degradation of tri-n-butyl phosphate (TBP) in the solvent extraction process and will also help in reducing the radiation related problems. (author)

  4. The molar enthalpies of solution and vapour pressures of saturated aqueous solutions of some cesium salts

    Apelblat, Alexander; Korin, Eli


    Vapour pressures of water over saturated solutions of cesium chloride, cesium bromide, cesium nitrate, cesium sulfate, cesium formate, and cesium oxalate were determined as a function of temperature. These vapour pressures were used to evaluate the water activities, osmotic coefficients and molar enthalpies of vapourization. Molar enthalpies of solution of cesium chloride, Δ sol H m (T = 295.73 K; m = 0.0622 mol . kg -1 ) = (17.83 ± 0.50) kJ . mol -1 ; cesium bromide, Δ sol H m (T = 293.99 K; m = 0.0238 mol . kg -1 ) = (26.91 ± 0.59) kJ . mol -1 ; cesium nitrate, Δ sol H m (T = 294.68 K; m = 0.0258 mol . kg -1 ) = (37.1 ± 2.3) kJ . mol -1 ; cesium sulfate, Δ sol H m (T = 296.43 K; m = 0.0284 mol . kg -1 ) (16.94 ± 0.43) kJ . mol -1 ; cesium formate, Δ sol H m (T = 295.64 K; m = 0.0283 mol . kg -1 ) = (11.10 ± 0.26) kJ . mol -1 and Δ sol H m (T = 292.64 K; m = 0.0577 mol . kg -1 ) = (11.56 ± 0.56) kJ . mol -1 ; and cesium oxalate, Δ sol H m (T = 291.34 K; m = 0.0143 mol . kg -1 ) = (22.07 ± 0.16) kJ . mol -1 were determined calorimetrically. The purity of the chemicals was generally greater than 0.99 mass fraction, except for HCOOCs and (COOCs) 2 where purities were approximately 0.95 and 0.97 mass fraction, respectively. The uncertainties are one standard deviations

  5. Transition of cesium in food chains [after Chernobyl catastrophe

    Procházka, H.; Brunclík, T.; Jandl, J.; Jirásek, V.; Novosad, J.; Hampl, J.


    An investigation of 25,000 samples of foodstuffs and feedstuffs in Czechoslovakia, contaminated by fall-out cesium after the accident in the Chernobyl nuclear power plant, performed from May 5, 1986 to March 31, 1988, revealed that both the values of cesium transfer-factors in food--animal tissues--milk transitions and the values of biological half-life of cesium are functions of internal and external conditions of contamination. Organism individuality as the main internal condition causes the variance of about +/- 50% of the mean value of the respective transfer-factor. Through the external conditions, mainly the environmental contamination level, type of ingested food and time of ingestion, the mean values of transfer-factors are influenced up to 500%, e.g. to the value of 0.5. But this value converges with growing up contamination of food and environment to the limit of 0.3. The first two to three biological half-lives after the last ingestion of contaminated food are up to ten-times shorter than those at stabilized state

  6. Cesium transfer to agricultural crops for three years after Chernobyl

    Eriksson, A.; Rosen, K.


    In 1986 about 50 farms in the fallout region were selected for sampling at fixed sites of the soil surface layer and of the grassland and grain crops to come. The aim was to cover the different soil types and the farming practices of the region during studies on the transfer levels and on the change with time in transfer of cesium to the crops. It was found that the transfer level, as expected, was much higher for the grassland than for the grain crops. However, within both groups of considerable variation in the transfer level for the same year as measured by the transfer factors has occurred. For the former crops it can be concluded that the transfer factor during year 1 depends on the interception capacity of the plant cover and on the dilution by growth i.e on soil fertility and on fertilization level. In the following years the cesium TF-value for the grass cover was reduced by a factor from 2 to about 10. The reduction rate differed above all between the organic soils and the mineral soils and should largely depend on the type of the grass cover, on the different cesium fixing capacities of the two soil groups and on the potassium fertilization level. On ploughed land the transfer by root uptake to grain crops was about one magnitude lower than the transfer to the hey crops. (orig.)

  7. Mineral-deposit model for lithium-cesium-tantalum pegmatites

    Bradley, Dwight C.; McCauley, Andrew D.; Stillings, Lisa L.


    Lithium-cesium-tantalum (LCT) pegmatites comprise a compositionally defined subset of granitic pegmatites. The major minerals are quartz, potassium feldspar, albite, and muscovite; typical accessory minerals include biotite, garnet, tourmaline, and apatite. The principal lithium ore minerals are spodumene, petalite, and lepidolite; cesium mostly comes from pollucite; and tantalum mostly comes from columbite-tantalite. Tin ore as cassiterite and beryllium ore as beryl also occur in LCT pegmatites, as do a number of gemstones and high-value museum specimens of rare minerals. Individual crystals in LCT pegmatites can be enormous: the largest spodumene was 14 meters long, the largest beryl was 18 meters long, and the largest potassium feldspar was 49 meters long.Lithium-cesium-tantalum pegmatites account for about one-fourth of the world’s lithium production, most of the tantalum production, and all of the cesium production. Giant deposits include Tanco in Canada, Greenbushes in Australia, and Bikita in Zimbabwe. The largest lithium pegmatite in the United States, at King’s Mountain, North Carolina, is no longer being mined although large reserves of lithium remain. Depending on size and attitude of the pegmatite, a variety of mining techniques are used, including artisanal surface mining, open-pit surface mining, small underground workings, and large underground operations using room-and-pillar design. In favorable circumstances, what would otherwise be gangue minerals (quartz, potassium feldspar, albite, and muscovite) can be mined along with lithium and (or) tantalum as coproducts.Most LCT pegmatites are hosted in metamorphosed supracrustal rocks in the upper greenschist to lower amphibolite facies. Lithium-cesium-tantalum pegmatite intrusions generally are emplaced late during orogeny, with emplacement being controlled by pre-existing structures. Typically, they crop out near evolved, peraluminous granites and leucogranites from which they are inferred to be

  8. Room temperature deposition of crystalline indium tin oxide films by cesium-assisted magnetron sputtering

    Lee, Deuk Yeon; Baik, Hong-Koo


    Indium tin oxide (ITO) films were deposited on a Si (1 0 0) substrate at room temperature by cesium-assisted magnetron sputtering. Including plasma characteristics, the structural, electrical, and optical properties of deposited films were investigated as a function of cesium partial vapor pressure controlled by cesium reservoir temperature. We calculated the cesium coverage on the target surface showing maximum formation efficiency of negative ions by means of the theoretical model. Cesium addition promotes the formation efficiency of negative ions, which plays important role in enhancing the crystallinity of ITO films. In particular, the plasma density was linearly increased with cesium concentrations. The resultant decrease in specific resistivity and increase in transmittance (82% in the visible region) at optimum cesium concentration (4.24 x 10 -4 Ω cm at 80 deg. C of reservoir temperature) may be due to enhanced crystallinity of ITO films. Excess cesium incorporation into ITO films resulted in amorphization of its microstructure leading to degradation of ITO crystallinity. We discuss the cesium effects based on the growth mechanism of ITO films and the plasma density

  9. Structure of cesium loaded iron phosphate glasses: An infrared and Raman spectroscopy study

    Joseph, Kitheri; Premila, M.; Amarendra, G.; Govindan Kutty, K.V.; Sundar, C.S.; Vasudeva Rao, P.R.


    The structure of cesium loaded iron phosphate glasses (IPG) was investigated using infrared and Raman spectroscopy. The spectra of the cesium doped samples revealed a structural modification of the parent glass owing to the incorporation of cesium. The structural changes could be correlated with the variation observed in the glass transition temperature of these glasses. Increased Cs-mediated cationic cross linking appears to be the reason for the initial rise in glass transition temperature up to 21 mol% Cs 2 O in IPG; while, breakdown of the phosphate network with increasing cesium content, brings down the glass transition temperature.

  10. Cesium Toxicity Alters MicroRNA Processing and AGO1 Expressions in Arabidopsis thaliana.

    Il Lae Jung

    Full Text Available MicroRNAs (miRNAs are short RNA fragments that play important roles in controlled gene silencing, thus regulating many biological processes in plants. Recent studies have indicated that plants modulate miRNAs to sustain their survival in response to a variety of environmental stimuli, such as biotic stresses, cold, drought, nutritional starvation, and toxic heavy metals. Cesium and radio-cesium contaminations have arisen as serious problems that both impede plant growth and enter the food chain through contaminated plants. Many studies have been performed to define plant responses against cesium intoxication. However, the complete profile of miRNAs in plants during cesium intoxication has not been established. Here we show the differential expression of the miRNAs that are mostly down-regulated during cesium intoxication. Furthermore, we found that cesium toxicity disrupts both the processing of pri-miRNAs and AGONOUTE 1 (AGO1-mediated gene silencing. AGO 1 seems to be especially destabilized by cesium toxicity, possibly through a proteolytic regulatory pathway. Our study presents a comprehensive profile of cesium-responsive miRNAs, which is distinct from that of potassium, and suggests two possible mechanisms underlying the cesium toxicity on miRNA metabolism.

  11. Laboratory plant for the separation of cesium from waste solutions of the PUREX process

    Richter, M.; Eckert, B.; Riemenschneider, J.; Mallon, C.; Mann, D.


    A laboratory plant for the separation of cesium from a fission product waste solution of the fuel reprocessing is described. The plant consists of two stages. In the first stage cesium is adsorbed on ammonium molybdatophosphate (AMP). Then the adsorbent is dissolved. From the solution cesium is adsorbed on a cationic ion exchanger in the second stage. Then AMP can be reproduced from this solution. For the elution of cesium in the second stage a NH 4 NO 3 solution (3 m) is used. Flow sheet, construction and the control device of the plant are described and the results of tests with a model solution are given. (author)

  12. Cesium transport in Four Mile Creek of the Savannah River Plant

    Kiser, D.L.


    The behavior of a large radioactive cesium release to a Savannah River Plant (SRP) stream was examined using a stable cesium release to Four Mile Creek. Measurements following the release show that most of the cesium released was transported downstream; however, sorption and desorption decreased the maximum concentration and increased the travel time and duration, relative to a dye tracer, at sampling stations downstream. The study was made possible by the development of an analytical technique using ammonium molybdophosphate and neutron activation that permitted the measurement of stable cesium concentrations as low as 0.2 μg/L

  13. Removal of radioactive cesium from soil by ammonium citrate solution and ionic liquid

    Ishiwata, Shunji; Kitakouji, Manabu; Taga, Atsushi; Ogata, Fumihiko; Ouchi, Hidekazu; Yamanishi, Hirokuni; Inagaki, Masayo


    Radioactive cesium has strongly bound soil as time proceeded, which could not be cleaved in mild condition. We have found that serial treatment of ammonium citrate solution and ionic liquid removed radioactive cesium from soil effectively. The sequence of the treatment is crucial, since inverse serial treatment or mixture of two kinds of solution did not show such an effect, which suggested that ammonium citrate unlocked trapped cesium in soil and ionic liquid solved it. We also found that repeating serial treatment and prolonged treatment time additively removed cesium from soil. (author)

  14. Ion exchange flowsheet for recovery of cesium from purex sludge supernatant at B Plant

    Carlstrom, R.F.


    Purex Sludge Supernatant (PSS) contains significant amounts of 137 Cs left after removal of strontium from fission product bearing Purex wastes. To remove cesium from PSS, an Ion Exchange Recovery system has been set up in Cells 17-21 at B Plant. The cesium that is recovered is stored within B Plant for eventual purification through the Cesium Purification process in Cell 38 and eventual encapsulation and storage in a powdered form at the Waste Encapsulation Storage Facility. Cesium depleted waste streams from the Ion Exchange processes are transferred to underground storage

  15. Desorption of radioactive cesium by seawater from the suspended particles in river water.

    Onodera, Masaki; Kirishima, Akira; Nagao, Seiya; Takamiya, Kouichi; Ohtsuki, Tsutomu; Akiyama, Daisuke; Sato, Nobuaki


    In 2011, the accident at the Fukushima-Daiichi nuclear power plant dispersed radioactive cesium throughout the environment, contaminating the land, rivers, and sea. Suspended particles containing clay minerals are the transportation medium for radioactive cesium from rivers to the ocean because cesium is strongly adsorbed between the layers of clay minerals, forming inner sphere complexes. In this study, the adsorption and desorption behaviors of radioactive cesium from suspended clay particles in river water have been investigated. The radioactive cesium adsorption and desorption experiments were performed with two kinds of suspended particulate using a batch method with 137 Cs tracers. In the cesium adsorption treatment performed before the desorption experiments, simulated river water having a total cesium concentration ([ 133+137 Cs + ] total ) of 1.3 nM (10 -9  mol/L) was used. The desorption experiments were mainly conducted at a solid-to-liquid ratio of 0.17 g/L. The desorption agents were natural seawater collected at 10 km north of the Fukushima-Daiichi nuclear power plant, artificial seawater, solutions of NaCl, KCl, NH 4 Cl, and 133 CsCl, and ultrapure water. The desorption behavior, which depends on the preloaded cesium concentration in the suspended particles, was also investigated. Based on the cesium desorption experiments using suspended particles, which contained about 1000 ng/g loaded cesium, the order of cesium desorption ratios for each desorption agent was determined as 1 M NaCl (80%) > 470 mM NaCl (65%) > 1 M KCl (30%) ≈ seawater (natural seawater and Daigo artificial seawater) > 1 M NH 4 Cl (20%) > 1 M 133 CsCl (15%) ≫ ultrapure water (2%). Moreover, an interesting result was obtained: The desorption ratio in the 470 mM NaCl solution was much higher than that in seawater, even though the Na + concentrations were identical. These results indicate that the cesium desorption mechanism is not a simple ion exchange reaction

  16. 9 CFR 113.326 - Avian Pox Vaccine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...

  17. 34 CFR 668.113 - Request for review.


    ... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...

  18. 46 CFR 113.10-9 - Power supply.


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...

  19. 46 CFR 113.43-5 - Power supply.


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...

  20. 46 CFR 113.25-6 - Power supply.


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...

  1. 14 CFR 13.113 - Noncompliance with the investigative process.


    ... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...

  2. 9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.


    ..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...

  3. 9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.


    ... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...

  4. 9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.


    ... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...

  5. 9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.


    ... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...

  6. 9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.


    ... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...

  7. 9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.


    ... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...

  8. 49 CFR 230.113 - Wheels and tire defects.


    ... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...

  9. 6 CFR 11.3 - Demand for payment.


    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...

  10. 9 CFR 113.40 - Dog safety tests.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...

  11. 47 CFR 25.113 - Station licenses and launch authority.


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...

  12. 48 CFR 432.113 - Customary contract financing.


    ... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...

  13. 48 CFR 32.113 - Customary contract financing.


    ... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...

  14. 9 CFR 113.39 - Cat safety tests.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...

  15. 32 CFR Appendix A to Part 113 - Certificate of Compliance


    ... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...

  16. 14 CFR 1214.113 - Allocation of risk.


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...

  17. 5 CFR 831.113 - Payments to children.


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...

  18. 46 CFR 113.05-7 - Environmental tests.


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...

  19. 9 CFR 113.33 - Mouse safety tests.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...

  20. 9 CFR 113.4 - Exemptions to tests.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...

  1. Solid state cesium ion guns for surface studies

    Souzis, A.E.; Carr, W.E.; Kim, S.I.; Seidl, M.


    Three cesium ion guns covering the energy range of 5--5000 V are described. These guns use a novel source of cesium ions that combine the advantages of porous metal ionizers with those of aluminosilicate emitters. Cesium ions are chemically stored in a solid electrolyte pellet and are thermionically emitted from a porous thin film of tungsten at the surface. Cesium supply to the emitting surface is controlled by applying a bias across the pellet. A total charge of 10.0 C can be extracted, corresponding to greater than 2000 h of lifetime with an extraction current of 1.0 μA. This source is compact, stable, and easy to use, and produces a beam with >99.5% purity. It requires none of the differential pumping or associated hardware necessary in designs using cesium vapor and porous tungsten ionizers. It has been used in ultrahigh-vacuum (UHV) experiments at pressures of -10 Torr with no significant gas load. Three different types of extraction optics are used depending on the energy range desired. For low-energy deposition, a simple space-charge-limited planar diode with a perveance of 1x10 -7 A/V 3/2 is used. Current densities of 10.0 μA/cm 2 at the exit aperture for energies ≤20 V are typical. This type of source provides an alternative to vapor deposition with the advantage of precise flux calibration by integration of the ion current. For energies from 50 to 500 V and typical beam radii of 0.5 to 0.2 mm, a high perveance Pierce-type ion gun is used. This gun was designed with a perveance of 1x10 -9 A/V 3/2 and produces a beam with an effective temperature of 0.35 eV. For the energy range of 0.5 to 5 keV, the Pierce gun is used in conjunction with two Einzel lenses, enabling a large range of imaging ratios to be obtained. Beam radii of 60 to 300 μm are typical for beam currents of 50 nA to 1.0 μA

  2. Radioactive cesium content in selected food products. Pt. 2. Radioactive cesium in daily food rations of selected population groups

    Skibniewska, K.; Smoczynski, S.S.; Wisniewska, I.


    The content of radioactive cesium isotopes emitting beta radiation was studied in daily food rations analysed in diets of working-class and non-working-class families from food products from the regions of Olsztyn, Poznan, Lublin, Warsaw and Wroclaw in 1987 and 1988. In 1987 the highest level of radioactive cesium was found in the food rations in Olsztyn, and lowest in the rations in Poznan (3.32 and 0.65 Bq/kg respectively). In 1988 higher radiocesium content was found in rations composed according to the data on the diet consumed daily in non-working-class families. In that case the highest content was in the daily food rations composed in Warsaw - 2.35 Bq/kg and lowest in Poznan - 1.19 Bq/kg in the daily food rations of working-class families about one half of that value was found. The calculated means values of both analysed rations were: 1.35 for Olsztyn, 0.89 for Poznan, and 1.86 Bq/kg for Warsaw. The calculated mean value of the contamination with radioactive cesium was in 1988 0.93 Bq/kg for the rations in working-class families (in 1987 it was 1.80 Bq/kg). (author). 15 refs, 1 tab

  3. Rocksalt or cesium chloride: Investigating the relative stability of the cesium halide structures with random phase approximation based methods

    Nepal, Niraj K.; Ruzsinszky, Adrienn; Bates, Jefferson E.


    The ground state structural and energetic properties for rocksalt and cesium chloride phases of the cesium halides were explored using the random phase approximation (RPA) and beyond-RPA methods to benchmark the nonempirical SCAN meta-GGA and its empirical dispersion corrections. The importance of nonadditivity and higher-order multipole moments of dispersion in these systems is discussed. RPA generally predicts the equilibrium volume for these halides within 2.4% of the experimental value, while beyond-RPA methods utilizing the renormalized adiabatic LDA (rALDA) exchange-correlation kernel are typically within 1.8%. The zero-point vibrational energy is small and shows that the stability of these halides is purely due to electronic correlation effects. The rAPBE kernel as a correction to RPA overestimates the equilibrium volume and could not predict the correct phase ordering in the case of cesium chloride, while the rALDA kernel consistently predicted results in agreement with the experiment for all of the halides. However, due to its reasonable accuracy with lower computational cost, SCAN+rVV10 proved to be a good alternative to the RPA-like methods for describing the properties of these ionic solids.

  4. Evaluation of the radiological situation of the remedied areas - 30 years after the radiological accident with Cesium-137

    Correa, R. da S.; Santos, E.E. dos; Barbosa, R.C.; Borges, A.F. de Almeida; Costa, H.F.; Pimenta, L.


    In September 1987, the radiation accident resulting from the removal and dismantling of a sealed source containing Cesium-137 chloride happened in Goiânia, GO, Brazil. Due to its high solubility and the weather conditions of the time, there were dispersion in the environment around seven main concentrations, located in the central region. This study aimed to present the evaluation of the radiological situation of the remedied areas - 30 years after the radiation accident with cesium-137. The three main focuses were studied, being the plot of land at the 57 street, Scrap Metal I and II. Radiometric surveys were performed using a SPP2 detector, 10 cm from the floor to evaluate the integrity of the concrete and 1 m from the soil, using the IDENTIFIDER detector model NG + , to compare with the values of background radiation. A 2 x 2m pre-fixed sampling loop was used. In the plot of land at the 57 street, measurements were made at 154 points, at 10 cm from the floor, at a mean of 150 ± 121 cps, while at 1 m from the soil, the average was 0.19 ± 0.10 μSv / h. In the Scrap Metal I were 262 measurements and the average at 10 cm of the floor was 147 ± 113 cps and the 1 meter of the soil was of 0.18 ± 0.12 μSv / h. In Scrap Metal II the average of the 66 measurements carried out at 10 cm was 117 ± 58 cps and at 1 meter it was 0.13 ± 0.03 μSv / h. Currently the radiological situation of the lots, are below the limits established by the norms of CNEN

  5. Ethylenediaminetetramethylene phosphate labelled with Indium-113 m (sup(113m)In-EDTMP) in bone scintigraphy

    Guzman Acevedo, C.


    Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable

  6. Cesium uptake capacity of simulated ferrocyanide tank waste. Interim report FY 1994, Ferrocyanide Safety Project

    Burgeson, I.E.; Bryan, S.A.; Burger, L.E.


    The objective of this project is to determine the capacity for 137 CS uptake by mixed metal ferrocyanides present in Hanford waste tanks, and to assess the potential for aggregation of these 137 CS exchanged materials to form tank ''hot-spots.'' This research, performed at the Pacific Northwest Laboratory (PNL) for the Westinghouse Hanford Company (WHC), stems from concerns of possible localized radiolytic heating within the tanks. If radioactive cesium is exchanged and concentrated by the remaining nickel ferrocyanide present in the tanks, this heating could cause temperatures to rise above the safety limits specified for the ferrocyanide tanks. For the purposes of this study, two simulants, In-Farm-2 and U-Plant-2, were chosen to represent the wastes generated by the scavenging processes. These simulants were formulated using protocols from the original cesium scavenging campaign. Later additions of cesium-rich wastes from various processes also were considered. The simulants were prepared and centrifuged to obtain a moist ferrocyanide sludge. The centrifuged sludges were treated with the original supernate spiked with a known amount of cesium nitrate. After analysis by flame atomic absorption spectrometry, distribution coefficients (K d ) were calculated. The capacity of solid waste simulants to exchange radioactive cesium from solution was examined. Initial results showed that the greater the molar ratio of cesium to cesium nickel ferrocyanide, the less effective the exchange of cesium from solution. The theoretical capacity of 2 mol cesium per mol of nickel ferrocyanide was not observed. The maximum capacity under experimental conditions was 0.35 mol cesium per mol nickel ferrocyanide. Future work on this project will examine the layering tendency of the cesium nickel ferrocyanide species

  7. Recent development on the synthesis of calixcrowns and their application for cesium removal from high-level liquid waste

    Zhu Xiaowen; Gao Jianxun; Wang Jianchen; Yu Bo; Song Chongli


    The synthesis, extraction properties and molecular modeling of calixcrowns in concern of cesium removal is reviewed briefly. In particular, calix [4] crown-6 and some of its derivatives have been shown to be highly selective extractants for cesium ions

  8. Preparation of an sup(113m) indium generator

    Ling, H.W.


    This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt

  9. Decorporation of mixture of strontium and cesium isotopes with domestic mineral waters

    Slavov, S.; Filev, G.; Kiradzhiev, G.


    The possibilities of Bulgarian mineral waters to decorporate mixtures of strontium and cesium radioisotopes, simultaneous entering the body, were studied. A modified effect in respect to radioactive strontium was found. Modification of the effect of mixing two diferent types of mineral waters was not proven. No effect was found of potassium-containing mineral water on radioactive cesium kinetics. 1 tab., 7 refs

  10. The effect of fertilizer application on 137 cesium accumulation in lucerne grown on a leached chernozem

    Konstantinov, G.; Kovachev, K.; Penchev, D.; Ermolaev, I.; Mirchev, M.


    On the basis of pot experiments, carried out in a glass-house the following conclusions on the effect of fertilizer application are made: nitrogen fertilizer application increases the amount of radioactive cesium in lucerne plants. Phosphorus fertilizer introduction, similarly to potassium fertilizer application decreases cesium uptake, resulting in an increase in available phosphorus in the soil. (M.Ts.)

  11. SIMS diagnostics of nanometer semiconductor structures with the use of cesium ions

    Pustovit, A.N.; Vyatkin, A.F.


    The modernization of cesium ion source was carried out to increase the lifetime, the power range of primary ions and temporary stability of primary ion beam. The elements depth profiles obtained with the help of primary cesium ions and primary iodine ions are in good agreement with transmission electron microscopy data [ru

  12. Redistribution of strontium and cesium during alteration of smectite to illite

    Ohnuki, Toshihiko; Murakami, Takashi; Sato, Tsutomu; Isobe, Hiroshi


    The redistribution of strontium and cesium during the alteration of smectite to illite has been studied under hydrothermal conditions at 200 C using solutions of 1x10 -4 M Sr and Cs. Two different sorption conditions were applied for the hydrothermal experiments. One was the condition in which strontium and cesium were sorbed by smectite before the hydrothermal experiments (dynamic condition). The other was the condition in which strontium and cesium were sorbed by the alteration products, illite/smectite (I/S) interstratified minerals after the hydrothermal experiments (static condition). The sorption characteristics of strontium and cesium by smectite, I/S interstratified minerals were examined by a sequential extraction method. Most of the strontium was desorbed from smectite and the I/S interstratified minerals with a 1 M KCl solution under both the dynamic and static conditions. Less than 1% of cesium was desorbed from the I/S interstratified minerals with any solution of a 1 M KCl, a 1 M HCl and a 6 M HCl under the dynamic condition, while most of cesium was desorbed with either solution of a 1 M KCl and 1 M HCl from smectite and from the I/S interstratified minerals under the static condition. These suggest that cesium sorbed by smectite changes its sorption characteristic during the alteration process, but strontium does not. Possible sites for more strongly bounded cesium to the I/S interstratified minerals may be at the 'ditrigonal cavity' of adjacent tetrahedral layers. (orig.)

  13. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    Andrello, Avacir C.; Appoloni, Carlos R., E-mail: acandrello@uel.b [Universidade Estadual de Londrina, PR (Brazil). Dept. de Fisica; Araujo, Ednaldo S. [EMBRAPA Agrobiologia, Seropedica, RJ (Brazil); Thomaz, Edivaldo L. [Universidade Estadual do Centro-Oeste - UNICENTRO, Guarapuava, PR (Brazil). Dept. de Geografia; Medeiros, Pedro Henrique Augusto [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia Agricola; Macedo, Iris L. [Universidade de Brasilia (UnB), DF (Brazil). Faculdade de Tecnologia. Dept. de Engenharia Civil e Ambiental


    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 +- 15 Bq.m{sup -2} for South region to 15 +- 2 Bq.m{sup -2} for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  14. Efficient electron injection from solution-processed cesium stearate interlayers in organic light-emitting diodes

    Wetzelaer, G. A. H.; Najafi, A.; Kist, R. J. P.; Kuik, M.; Blom, P. W. M.


    The electron-injection capability of solution-processed cesium stearate films in organic light-emitting diodes is investigated. Cesium stearate, which is expected to exhibit good solubility and film formation due to its long hydrocarbon chain, is synthesized using a straightforward procedure.

  15. Cesium-137 inventories in undisturbed areas in different regions of Brazil

    Andrello, Avacir C.; Appoloni, Carlos R.; Thomaz, Edivaldo L.; Medeiros, Pedro Henrique Augusto; Macedo, Iris L.


    Cesium-137 is an anthropogenic radionuclide introduced in the environment in the early of 1960s to the end of 1970s. The Cesium-137 has very used to assess soil redistribution in the landscape because this is very tight in the fine soil particles and its movement in the landscape is due to soil redistribution. To use Cesium-137 to assess soil redistribution is need to known the Cesium-137 inventory in an area that not has experimented soil erosion neither soil deposition. So, this work present Cesium-137 inventories in undisturbed areas in different regions of Brazil, from South to Northeast of Brazil. The inventories in these areas represent the variational deposition of Cesium-137 in the whole national territory of Brazil. The inventories of Cesium-137 varied from 200 ± 15 Bq.m -2 for South region to 15 ± 2 Bq.m -2 for Northeast region. Moreover, was verified that the Cesium- 137 inventories depend on latitude and altitude of the area. (author)

  16. Cesium-137 uptake studies on ammonium phospho molybdate irradiated with electrons

    Rao, K.L.N.; Balasubramanian, K.R.; Shukla, J.P.


    Ammonium phospho molybdate is an important inorganic ion exchanger having high selectivity for cesium. This paper discusses the effects of electron irradiation to a dose of 1 mGy on this exchanger with special reference to its ion exchange performance using cesium-137 as a tracer. An explanation is attempted for the slight increase in the distribution coefficients. (author). 5 refs., 1 tab

  17. Utilization of cesium-137 environmental contamination from fallout in erosion and sedimentation studies

    Guimaraes, M.F. da; Pessenda, L.C.R.; Fernandes, E.A.N.; Freire, O.; Nascimento Filho, V.F. do; Ferraz, E.S.B.


    The radioactivity of cesium-137 from fallout in different soils profiles for erosion and sedimentation studies are described. The potential of this technique for hydrographic basin in Piracicaba/Sao Paulo is evaluated. Due to the existence of natural radionuclides in soil, with energy near to cesium-137, the soil samples are determined by a high-purity Ge detectors. (author)

  18. The determination of cesium and rubidium in highly radioactive waste liquid

    Wei Songsheng


    Cesium and rubidium in high-level waste liquid were determined by atomic absorption spectrometry with the instrument modified for analyzing radioactive samples. The results show that the method is effective and safe. The error of the method is less than +- 3%, and it has been used in the production of cesium

  19. Using copper hexacyanoferrate (II) impregnated zeolite for cesium removal from radioactive liquid waste

    Fumio, K.; Kenji, M.


    Experiments were performed to obtain fundamental data on cesium ion removal characteristics of metal hexacyanoferrate (II) impregnated zeolite in radioactive liquid waste containing a large amount of sodium sulfate. Copper hexacyanoferrate (II) impregnated zeolite (CuFZ) was prepared and showed a high selectivity for cesium ion. The material was suitable for use in an ion exchange column. This exchanger could selectively and efficiently remove the cesium even if there is 15 wt% Na 2 SO 4 in the solution. Cesium removal ability and stability of CuFZ were excellent over a wide pH range between 1.5 and 10. The cesium ion exchange ability was not influenced by the presence of the alkali metal ions, calcium and magnesium, and carbonate ions even at concentrations 25 times greater than the cesium ion. However, since ammonium ion behaves similarly to cesium ion and interrupts latter ion adsorption, the presence of ammonium ion is not desirable. The CuFZ offers the possibility of separating and removing cesium from liquid wastes produced in facilities handling radioactive materials

  20. Dosage of cesium 137 in radioactive wastes by the application of sodium tetraphenylborate; Dosage du cesium 137 dans les effluents radioactifs par le tetraphenylborate de sodium

    Testemale, G; Girault, J [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires


    A simple technique of the dosage of {sup 137}Cs has been developed. The technique consists in the formation of cesium tetraphenyl borate, followed by a double extraction with isoamyl acetate, and washing of the organic phase. The counting of known parts of the cesium solution assaying of its purity by {gamma} spectrometry enable the determination of the {sup 137}Cs. The yield is about 98 per cent. (authors) [French] Une technique simple du dosage du {sup 137}Cs a ete mise au point. Elle consiste en une double extraction du tetraphenylborate de cesium forme par l'acetate d'isoamyle suivie d'un lavage de la phase organique. Des comptages sur des parties aliquotes de la solution de cesium et un controle de purete par spectrometrie {gamma} permettent la determination de cet element. Rendement: environ 98 pour cent. (auteurs)

  1. Sorption of iodine, chlorine, technetium and cesium in soil

    Soederlund, M.; Lusa, M.; Lehto, J.; Hakanen, M.; Vaaramaa, K.


    The safety assessment of final disposal of spent nuclear fuel will include an estimate for the behavior of waste nuclides in the biosphere. As a part of this estimate also the sorption of radioactive iodine, chlorine, technetium and cesium in soil is to be considered. The chemistry and the sorption of these radionuclides in soils are described in this literature survey. Behavior of I-129, Cl-36 and Tc-99 in the environment is of great interest because of their long half-lives and relatively high mobilities. The importance of Cs-135 arises from its high content in spent nuclear fuel and long physical half-life, even though it is considered relatively immobile in soil. Factors affecting the migration and sorption of radionuclides in soils can be divided into elemental and soil specific parameters. The most important elemental factor is the speciation of the element, which is influenced by the soil redox potential, pH and complex forming ligands. Soil micro-organisms can either serve as sorbents for radionuclides or affect their speciation by altering the prevailing soil redox conditions. Soil organic matter content and mineral properties have a marked influence on the retention of radionuclides. The sorption of anionic radionuclides such as I-, Cl- and TcO 4 - is pronounced in the presence of organic matter. Clay minerals are known to bound cesium effectively. The effect of speciation of radioactive iodine, chlorine, technetium and cesium in soil is considered in this study, as well as the effect of soil micro-organisms, organic matter and mineral properties. (orig.)

  2. Cesium ion exchange using actual waste: Column size considerations

    Brooks, K.P.


    It is presently planned to remove cesium from Hanford tank waste supernates and sludge wash solutions using ion exchange. To support the development of a cesium ion exchange process, laboratory experiments produced column breakthrough curves using wastes simulants in 200 mL columns. To verify the validity of the simulant tests, column runs with actual supernatants are being planned. The purpose of these actual waste tests is two-fold. First, the tests will verify that use of the simulant accurately reflects the equilibrium and rate behavior of the resin compared to actual wastes. Batch tests and column tests will be used to compare equilibrium behaviors and rate behaviors, respectively. Second, the tests will assist in clarifying the negative interactions between the actual waste and the ion exchange resin, which cannot be effectively tested with simulant. Such interactions include organic fouling of the resin and salt precipitation in the column. These effects may affect the shape of the column breakthrough curve. The reduction in column size also may change the shape of the curve, making the individual effects even more difficult to sort out. To simplify the evaluation, the changes due to column size must be either understood or eliminated. This report describes the determination of the column size for actual waste testing that best minimizes the effect of scale-down. This evaluation will provide a theoretical basis for the dimensions of the column. Experimental testing is still required before the final decision can be made. This evaluation will be confined to the study of CS-100 and R-F resins with NCAW simulant and to a limited extent DSSF waste simulant. Only the cesium loading phase has been considered

  3. Cesium-137 inventory of the undisturbed soil areas in the Londrina Region, Parana, Brazil

    Andrello, Avacir C.; Appoloni, Carlos Roberto


    Cesium-137 is an artificial radionuclide introduced in the environment through the radioactive fallout of the superficial tests of nuclear weapons. The cesium-137 deposition occurred to middles of the 1980-decade and, due to the Chernobyl accident, great part of Europe had a additional fallout of cesium-137. The contaminations of this accident do not have reached Southern Hemisphere. Cesium-137 is an alkaline metal, high electropositive, that in contact with the soil is strongly adsorbed to the clay in the FES (Frayed Edge Sites) and RES (Regular Edge Sites) positions, and it movement by chemical processes in the soil is insignificant. Because of this, cesium-137 became a good soil marker, and its movement is related to the soil movement particles, so that the cesium-137 have been used in the study of the soil redistribution processes, as a tool of quantifying the rates of soil losses and gain. To use this methodology, it is necessary the knowledge of the reference inventory of cesium-137, that is given as function of the total concentration of cesium-137 deposited in an area by the radioactive fallout. If a sampling point presents less cesium-137 than the reference inventory, this point is considered a point with soil loss; otherwise, the point is considered a point with soil deposition. To evaluate the cesium-137 inventory in the Londrina region, four areas of the undisturbed soil were sampling in grid of 3x3, with a distance of 9 meters among the points. Of these four sampling areas, three areas were of native forest (labeled Mata1, Mata2 and Mata UEL), and one was a pasture area. Cesium-137 inventory was 223 ± 41 Bq m -2 , 240 ± 65 Bq m -2 and 305 ± 36 Bq m -2 for Mata UEL, Mata1 and Mata2, respectively, and of 211 ± 28 Bq m -2 for the native pasture. Considering the deviation in each value, it is not possible to conclude that there are differences among the values of cesium-137 inventory, so that the average reference inventory of cesium-137 for the

  4. High-current negative hydrogen ion beam production in a cesium-injected multicusp source

    Takeiri, Y.; Tsumori, K.; Kaneko, O.


    A high-current negative hydrogen ion source has been developed, where 16.2 A of the H - current was obtained with a current density of 31 mA/cm 2 . The ion source is a multicusp source with a magnetic filter for negative ion production, and cesium vapor is injected into the arc chamber, leading to enhancement of the negative ion yields. The cesium-injection effects are discussed, based on the experimental observations. Although the surface production of the negative ions on the cesium-covered plasma grid is thought to be a dominant mechanism of the H - current enhancement, the cesium effects in the plasma volume, such as the cesium ionization and the electron cooling, are observed, and could contribute to the improved operation of the negative ion source. (author)

  5. Actual situation of concentration and inventory of radioactive cesium in Matsukawaura Lagoon sediment, Fukushima Prefecture

    Arita, Koichi; Yabe, Tohru; Hayashi, Seiji


    In order to qualitatively evaluate the current status of inventory of radioactive cesium in Matsukawaura Lagoon, profiles of radioactive cesium concentration in sediment cores and sediment characteristics were measured at 36 points. It was shown that sediment characteristics were different even at high concentration of radioactive cesium to the same extent. As a result, the inventory of radioactive cesium were also different. Even at high concentration of radioactive cesium, inventory in southwestern high mud content rate was less than the western. The total inventory of down to 20 cm of sediment throughout Matsukawaura Lagoon was estimated to be about 220 GBq, that more than 80% distributed to 15 cm shallower than has been revealed. (author)

  6. Potassium effect on cesium 137 behaviour in natural waters of contaminated regions (Belarus)

    Kudel'skij, A.V.; Pashkevich, V.I.; Ovsyannikova, S.V.; Petrovich, A.A.; Smit, D.T.


    Very close relationships between cesium 137 activity of water objects (soil solutions, bog and lake water) and their stable potassium contents have been revealed in the contaminated area in south-eastern Belarus. It was revealed the increase of cesium 137 activity in soil solutions and bog ecosystems proportionally with the increase of potassium content. The exponential dependence of cesium 137 activity of fish production was similar to reverse. The coefficient of cesium 137 accumulation in plants was estimated to be reverse connected with the potassium content in soils. So an universal character of these relations and their specificity are of interest when elaborating countermeasures for reducing population dose loads due to cesium 137 water migration

  7. Cesium fallout in Norway after the Chernobyl accident

    Backe, S.; Bjerke, H.; Rudjord, A.L.; Ugletveit, F.


    Results of country-wide measurements of 137 Cs and 134 Cs in soil samples in Norway after the Chernobyl accident are reported. The results clearly demonstrates that municipalities in the central part of southern Norway, Troendelag and the southern part of Nordland, have been rather heavily contaminated. The total fallout of 137 Cs and 134 Cs from the Chernobyl accident in Norway is estimated to 2300 TBq and 1200 TBq, respectively. This is approximately 6% of the cesium activity released from the reactor

  8. Adsorbtion of oxygen and cesium on lanthanum hexaboride

    Gorodetskij, D.A.; Tskhakaya, V.K.; Shchudlo, Yu.G.; Yarygin, V.I.; Yas'ko, A.A.


    Oxygen and cesium adsorption on lanthanum hexaboride was investigated. Especial attention was paid to structural investigations of the LaB 6 (100)-O system. Diffraction pictures and curves of changes in work function in the process of oxygen disorption have been obtained. At oxygen adsorption on a crystal heated up to different temperatures in the range of 900-1400 K the same diffraction pictures as at corresponding annealing temperatures observed were. It is noted that adsorption heat changes slightly in the LaB 6 -O-Cs system

  9. Low-temperature phase transformation in rubidium and cesium superoxides

    Alikhanov, R.A.; Toshich, B.S.; Smirnov, L.S.


    Crystal structures of rubidium and cesium superoxides which are two interpenetrating lattices of metal ions and oxygen molecule ions reveal a number of phase transformations with temperature decrease. Crystal-phase transformations in CsO 2 are 1-2, 2-3 and low temperature one 3-4 at 378, 190 and 10 K. Low temperature transition is considered as the instability of lattice quadrupoles of oxygen molecule ions to phase transformation of the order-disorder type. Calculated temperatures of low temperature phase transformations in PbO 2 and CsO 2 agree with experimental calculations satisfactory [ru

  10. Safety evaluation for packaging (onsite) singly encapsulated cesium chloride capsules

    Smyth, W.W.


    Three nonstandard Waste Encapsulation and Storage Facility (WESF) cesium chloride capsules are being shipped from WESF (225B building) to the 324 building. They would normally be shipped in the Beneficial Uses Shipping System (BUSS) cask under its US Department of Energy (DOE) license (DOE 1996), but these capsules are nonstandard: one has a damaged or defective weld in the outer layer of encapsulation, and two have the outer encapsulation removed. The 3 capsules, along with 13 other capsules, will be overpacked in the 324 building to meet the requirements for storage in WESF's pool

  11. Radiolysis of dilute aqueous solutions of cesium iodide

    Gorbovitskaya, T.I.; Galinkin, D.L.; Kants, L.K.; Tiliks, Yu.E.; Kotelkin, I.M.; Luzanova, L.M.


    Study of physical-chemical processes in the NPP containment by severe accident is carried out. Radiolysis of reactor cooling water containing iodine and cesium radionuclides penetrated therein in the course of accident is considered as of such processes. Role of ionizing radiation in the process of formation and release of ecologically hazardous volatile forms of radioiodine from reactor water into environment is studied. Experiments on radiolysis of CsI diluted water solutions are carried out. The data obtained were used for clarification of radiolysis mechanism for iodine-containing water system, enabling forecast of iodine behaviour in the course of the accident. 5 refs., 4 figs., 1 tab

  12. Sorption of trace cesium on 21 Hanford Site sediment types

    Routson, R.C.; Barney, G.S.; Smith, R.M.; Delegard, C.A.


    Sorption of trace cesium (Cs) was measured on 21 Hanford Site sediment types. A Box-Behnken statistical design was used to develop empirical-statistical equations predicting 137 Cs sorption as a function of the equilibrium concentrations of macroions Na + , K + , and Ca +2 in solution over the concentration ranges of 3.0 to 0.001M, 0.2 to 0.002M, and 0.2 to 0.002M, respectively. These equations are required to estimate trace Cs transport from Hanford ground disposal sites. Average Cs sorption equations for the 21 sediments will be presented and discussed

  13. Magnetite effect in radionuclide retention : cesium, strontium, molybdenum and selenium

    Rovira, M.; Casas, I.; Gimenez, J.; Clarens, F.; Pablo, J. de


    In this work we have investigated the interaction of magnetite with cesium, strontium, molybdenum and selenium, in the frame of radionuclide retention by canister corrosion products. For each radionuclide, the retention on magnetite has been studied as a function of pH and the mass/ volume ratio. The experimental results have been modeled by means of Surface Complexation Models (SCM), that constitute a tool that allows an approach to sorption mechanisms in a wide range of experimental conditions taking into account electrostatic interactions at the mineral-water interface.(Author)

  14. Phase separation of cesium from lead borosilicate glass by heat treatment under a reducing atmosphere

    Xu, Zhanglian; Okada, Takashi, E-mail:; Nishimura, Fumihiro; Yonezawa, Susumu


    Highlights: • Cesium was phase separated from lead borosilicate glass under a reductive atmosphere. • The phase separation occurred on the glass surface that was in contact with the gas. • The leachability of cesium was enhanced by the phase separation. • The degree of such enhancement varied depending on the heat treatment conditions. - Abstract: A phase-separation technique for removing sodium from glass using a heat-treatment method under a reducing atmosphere was previously developed for sodium recovery from waste glass. In this study, this technique was applied to cesium-containing lead borosilicate glass to concentrate the cesium in phase-separated sodium-rich materials for efficient cesium extraction. The theoretical phase-separation temperature of the sodium-rich phase was simulated by thermodynamic equilibrium calculations and was predicted to occur below 700 °C for lead borosilicate glass. Experimentally, a simulated lead borosilicate glass was melted at 1000 °C and subsequently annealed below 700 °C under a CO-containing reducing atmosphere. The phase separation of cesium was found to occur with sodium enrichment on the glass surface that was in contact with the gas phase, promoting cesium extraction from the treated glass using water. The cesium extraction efficiency was affected by the surface area of the treated glass that was in contact with water, and under the examined conditions, the cesium extraction efficiency was up to 66%. Phase separation using reductive heat treatment, combined with a water leaching technique, is suggested to be effective for extracting cesium incorporated in borosilicate glass waste.

  15. Modelling the transport of radioactive cesium released from the Fukushima Dai-ichi NPP with sediments through the hydrologic system

    Kinouchi, T.; Omata, T.; Wei, L.; Liu, T.; Araya, M.


    Due to the accident of the Fukushima Dai-ichi Nuclear Power Plant on March 2011, a huge amount of radionuclides including Cesium-134 and Cesium-137 was deposited over the main island of Japan and the Pacific Ocean, resulting in further transfer and diffusion of Cesium through the atmospheric flow, watershed hydrological processes, and terrestrial ecosystem. Particularly, for the transfer of Cesium-134 and Cesium-137, sediments eroded and transported by the rainfall-runoff processes play an important role as Cesium tends to be strongly adsorbed to soil particles such as clay and silt. In this study, we focus on the transport of sediment and adsorbed Cesium in the watershed-scale hydrologic system to predict the long-term change of distribution of Cesium and its discharge to rivers and ocean. We coupled a physically-based distributed hydrological model with the modules of erosion and transport of sediments and adsorbed Cesium, and applied the coupled model to the Abukuma River watershed, which is located over the area of higher deposition of Cesium. In the model, complex land use and land cover distributions, and the effect of human activities such as irrigation, dam control and urban drainage system are taken into accounts. Simulation was conducted for the period of March 2011 until August 2012, with initial spatial distribution of Cesium-134 and Cesium-137 obtained by the airborne survey. Simulated flow rates and sediment concentrations agreed well with observed, and found that since the accident, two major storms in July and September 2011 transported about 50% of total sediments transported during the simulated periods. Cesium concentration in the sediment was reproduced well except for the difference in the initial periods. This difference is attributable to the uncertainty arisen from the initial distribution of Cesium in the soil and the transfer of Cesium from the forest canopy.

  16. An Experimental Study of the Fluorescence Spectrum of Cesium Atoms in the Presence of a Buffer Gas

    Davydov, V. G.; Kulyasov, V. N.


    A direct experiment is performed to determine the quantum efficiency of a cesium fluorescence filter. The fluorescence spectra of cesium atoms are recorded under excitation of the upper states of the second resonance doublet with a Bell-Bloom cesium lamp. Introduction of different noble gases into the cell with cesium leads to the appearance of additional fluorescence photons. It is found that a fluorescence filter based on atomic cesium vapor with addition of helium in the working cell has the highest efficiency and response rate of all known fluorescence filters based on alkali-metal atomic vapors.

  17. Mobility of radioactive cesium in soil originated from the Fukushima Daiichi nuclear disaster. Application of extraction experiments

    Yoshikazu Kikawada; Takao Oi; Katsumi Hirose; Masaaki Hirose; Atsushi Tsukamoto; Ko Nakamachi; Teruyuki Honda; Hiroaki Takahashi


    Extraction experiments on soil radioactively contaminated by the Fukushima Daiichi Nuclear Power Plant accident were conducted by using a variety of extractants to acquire knowledge on the mobility of radioactive cesium in soil. The experimental results revealed that cesium is tightly bound with soil particles and that radioactive cesium newly deposited on soil due to the accident had apparently a higher mobility than stable cesium commonly existing in soil. The results suggested that radioactive cesium deposited on soil hardly migrates via aqueous processes, although chemical and mineralogical conditions of soil affect their mobility. (author)

  18. A solution for cesium removal from high-salinity acidic or alkaline liquid waste: The crown calix[4]arenes

    Dozol, J.F.; Simon, N.; Lamare, V.; Rouquette, H.; Eymard, S.; Tournois, B.; Marc, D. de; Macias, R.M.


    Calix[4]arenes monocrown or biscrown, blocked in 1,3 alternative cone conformation, display an exceptional efficiency for cesium extraction, even from very acid or alkaline media. Moreover, they possess an important selectivity for cesium over sodium that makes possible the extraction of cesium from media containing high sodium nitrate loadings. Another advantage, since the extraction of cesium is reversible, is that the stripping of cesium can be carried out in deionized water, a property which leads to very high concentration factors. 79 refs., 10 figs., 6 tabs

  19. Morphological and electrical properties of zirconium vanadate doped with cesium

    Marwa F. Elkady


    Full Text Available Cesium doped zirconium vanadate ZrV2O7 with different Cs dopant content (Cs/Zr varied from 0 to 0.5 in weight ratio were fabricated by hydrothermal technique at 120 °C for 60 min. The synthesized materials are thermally treated using microwave technique. The structural and morphological properties of the synthesized materials and thermally treated samples were investigated using XRD and SEM respectively. It was evident that all synthesized specimens have cubic phase structural without any extra phase but after heat treatment Orthorhombic phase appear with doped samples. However, the morphological structure of the doped synthesized materials has transferred from nanoparticles into rods aspect with heat treatment for the different dopant ratio. Moreover, the electrical properties of both the synthesized and thermally treated materials are studied by AC impedance measurements. The results indicated that the ionic conductivity of Cs-doped ZrV2O7 materials decreased by increasing the dopant ratio while that thermally treated samples the ionic conductivity increase by increasing the dopant ratio. Finally, the concentration of cesium dopants is found to play crucial role in tuning the morphology and electrical properties of nanostructures.

  20. Kelvin probe studies of cesium telluride photocathode for AWA photoinjector

    Wisniewski, Eric E., E-mail: [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Velazquez, Daniel [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Yusof, Zikri, E-mail: [High Energy Physics Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States); Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Spentzouris, Linda; Terry, Jeff [Physics Department, Illinois Institute of Technology, 3300 South Federal Street, Chicago, IL 60616 (United States); Sarkar, Tapash J. [Rice University, 6100 Main, Houston, TX 77005 (United States); Harkay, Katherine [Accelerator Science Division, Argonne National Laboratory, 9700 S. Cass, Lemont, IL 60439 (United States)


    Cesium telluride is an important photocathode as an electron source for particle accelerators. It has a relatively high quantum efficiency (>1%), is sufficiently robust in a photoinjector, and has a long lifetime. This photocathode is grown in-house for a new Argonne Wakefield Accelerator (AWA) beamline to produce high charge per bunch (≈50nC) in a long bunch train. Here, we present a study of the work function of cesium telluride photocathode using the Kelvin probe technique. The study includes an investigation of the correlation between the quantum efficiency and the work function, the effect of photocathode aging, the effect of UV exposure on the work function, and the evolution of the work function during and after photocathode rejuvenation via heating. -- Highlights: ► The correlation between Quantum Efficiency (QE) and work function. ► How QE and work function evolve together. ► Rejuvenation of the photocathode via heating and the effect on work function. ► The effects on the work function due to exposure to UV light.

  1. Design alternatives report for the cesium removal demonstration

    Walker, J.F. Jr.; Youngblood, E.L.


    The Cesium Removal Demonstration (CRD) project will use liquid low-level waste (LLLW) stored in the Oak Ridge National Laboratory Melton Valley Storage Tanks to demonstrate cesium removal from sodium nitrate-based supernates. This report presents the results of a conceptual design study to scope the alternatives for conducting the demonstration at ORNL. Factors considered included (1) sorbent alternatives, (2) facility alternatives, (3) process alternatives, (4) process disposal alternatives, and (5) relative cost comparisons. Recommendations included (1) that design of the CRD system move forward based on information obtained to date from tests with Savannah River Resin, (2) that the CRD system be designed so it could use crystalline silicotitanates (CST) if an engineered form of CST becomes available prior to the CRD, (3) that the system be designed without the capability for resin regeneration, (4) that the LLLW solidification facility be used for the demonstration (5) that vitrification of the loaded resins from the CRD be demonstrated at the Savannah River Site, and (6) that permanent disposal of the loaded and/or vitrified resin at the Nevada Test Site be pursued.

  2. Computer simulation of liquid cesium using embedded atom model

    Belashchenko, D K; Nikitin, N Yu


    The new method is presented for the inventing an embedded atom potential (EAM potential) for liquid metals. This method uses directly the pair correlation function (PCF) of the liquid metal near the melting temperature. Because of the specific analytic form of this EAM potential, the pair term of potential can be calculated using the pair correlation function and, for example, Schommers algorithm. Other parameters of EAM potential may be found using the potential energy, module of compression and pressure at some conditions, mainly near the melting temperature, at very high temperature or in strongly compressed state. We used the simple exponential formula for effective EAM electronic density and a polynomial series for embedding energy. Molecular dynamics method was applied with L. Verlet algorithm. A series of models with 1968 atoms in the basic cube was constructed in temperature interval 323-1923 K. The thermodynamic properties of liquid cesium, structure data and self-diffusion coefficients are calculated. In general, agreement between the model data and known experimental ones is reasonable. The evaluation is given for the critical temperature of cesium models with EAM potential

  3. Sorption of cesium on montmorillonite and effect of salt concentration

    Atun, G.; Bilgin, B.; Mardinli, A.


    The sorption behavior of cesium on montmorillonite type[e clay was studied by using radioactivity measurements. Concentrations of Cs + ions ranged from 10 -6 to 10 -2 M. Cesium retention reduced with increasing salt concentration which was varied between 10 -4 and 10 -1 M. Selectivity coefficients K CsNa for the exchange between Cs and Na were calculated for different equivalent fractions of Cs on the solid phase. Using the K CsNa values, free energy change was found to be 7.8 kJ/mol. The data could be fitted to a Freundlich isotherm, and empirical Freundlich parameters enabled the generation of a site distribution function. By fitting the data to the Dubinin-Radushkevich (D-R) isotherm, a mean energy of sorption of 8.6kJ/mole was calculated which corresponds to the energy of ion exchange reactions. The values of energy changes calculated by using two different methods were in good agreement. (author)

  4. Design alternatives report for the cesium removal demonstration

    Walker, J.F. Jr.; Youngblood, E.L.


    The Cesium Removal Demonstration (CRD) project will use liquid low-level waste (LLLW) stored in the Oak Ridge National Laboratory Melton Valley Storage Tanks to demonstrate cesium removal from sodium nitrate-based supernates. This report presents the results of a conceptual design study to scope the alternatives for conducting the demonstration at ORNL. Factors considered included (1) sorbent alternatives, (2) facility alternatives, (3) process alternatives, (4) process disposal alternatives, and (5) relative cost comparisons. Recommendations included (1) that design of the CRD system move forward based on information obtained to date from tests with Savannah River Resin, (2) that the CRD system be designed so it could use crystalline silicotitanates (CST) if an engineered form of CST becomes available prior to the CRD, (3) that the system be designed without the capability for resin regeneration, (4) that the LLLW solidification facility be used for the demonstration (5) that vitrification of the loaded resins from the CRD be demonstrated at the Savannah River Site, and (6) that permanent disposal of the loaded and/or vitrified resin at the Nevada Test Site be pursued

  5. Lasing in robust cesium lead halide perovskite nanowires

    Eaton, Samuel W.; Lai, Minliang; Gibson, Natalie A.; Wong, Andrew B.; Dou, Letian; Ma, Jie; Wang, Lin-Wang; Leone, Stephen R.; Yang, Peidong


    The rapidly growing field of nanoscale lasers can be advanced through the discovery of new, tunable light sources. The emission wavelength tunability demonstrated in perovskite materials is an attractive property for nanoscale lasers. Whereas organic–inorganic lead halide perovskite materials are known for their instability, cesium lead halides offer a robust alternative without sacrificing emission tunability or ease of synthesis. Here, we report the low-temperature, solution-phase growth of cesium lead halide nanowires exhibiting low-threshold lasing and high stability. The as-grown nanowires are single crystalline with well-formed facets, and act as high-quality laser cavities. The nanowires display excellent stability while stored and handled under ambient conditions over the course of weeks. Upon optical excitation, Fabry–Pérot lasing occurs in CsPbBr3 nanowires with an onset of 5 μJ cm−2 with the nanowire cavity displaying a maximum quality factor of 1,009 ± 5. Lasing under constant, pulsed excitation can be maintained for over 1 h, the equivalent of 109 excitation cycles, and lasing persists upon exposure to ambient atmosphere. Wavelength tunability in the green and blue regions of the spectrum in conjunction with excellent stability makes these nanowire lasers attractive for device fabrication. PMID:26862172

  6. Accumulation and mobility of cesium in roots of tulip popular seedlings

    Cox, T.L.


    Tulip poplar, Liriodendron tulipifera L., seedlings were stem-well tagged with cesium, periodically harvested, and separated into root and shoot compartments to determine seasonal cesium distributions in different root-diameter classes and to delineate element pathways to forest soils. The cesium concentration (μCi/g) in roots less than 0.1 cm in diameter averaged 1.5 and 3.0 times greater than in roots in the 0.5- to 0.1-cm- and 1.0- to 0.5-cm-diameter classes, respectively. Roots contained 24 percent of the seedling pool of cesium in 1 week and about 40 percent in 7 weeks after inoculation. Sixty-five percent of the seedling content was in the root system 8 months after tagging. On an annual basis, roots of the less than 0.5-cm-diameter classes contained an average of 36 percent of the seedling pool (root and shoot) and 72 percent of the root pool of cesium. This is important because small roots constituted a considerable portion of the annual turnover in these root systems. Soil content of cesium (3.37 μCi) at the termination of the study and analysis of treatment effects (aboveground inputs to soil allowed or not allowed) indicated that root processes contributed twice as much cesium to the soil during the study period as the combined aboveground processes contributed

  7. Cesium-plasma-conductivity enhancement in the advanced thermionic energy converter. Final report

    Manikopoulos, C.N.

    Two methods of plasma conductivity enhancement in a cesium vapor thermionic energy converter have been studied. The first involved resonance photoabsorption of several cesium lines and the second utilized cesium plasma sustenance by application of microwave power. An extensive study of ionization processes in a cesium discharge in the presence of resonance ionization was made. Calculations were made of expected percentage excitation levels for several cesium resonance transitions for different values of neutral density and temperature as well as incident radiation power levels. The results of some of these computations were tabulated. Several ionization schemes were considered. A number of cesium transitions were investigated in the range of 799 to 870 nanometers for four different cesium reservoir temperatures, 467, 511, 550 and 591 K. The related absorption coefficients of the radiation lines in the plasma were deduced and tabulated. The resulting plasma conductivity increase was recorded and the associated ionization enhancement was deduced. A microwave cavity was built where the emitter and collector of a simple thermionic converter made up two of the cavity walls and resonant microwave power was externally applied. The I-V characteristics of the thermionic converter were studied under several microwave power levels in the range of 0 to 2 watts. Significant shifts to higher currents were observed as the microwave power levels were raised. In conclusion, both methods show promise as auxiliary ionization mechanisms for the thermionic energy converter, especially at low emitter temperatures

  8. Measurements of the cesium flow from a surface-plasma H- ion source

    Smith, H.V.; Allison, P.W.


    A surface ionization gauge (SIG) was constructed and used to measure the Cs 0 flow rate through the emission slit of a surface-plasma source (SPS) of H - ions with Penning geometry. The equivalent cesium density in the SPS discharge is deduced from these flow measurements. For dc operation the optimum H - current occurs at an equivalent cesium density of approx. 7 x 10 12 cm -3 (corresponding to an average cesium consumption rate of 0.5 mg/h). For pulsed operation the optimum H - current occurs at an equivalent cesium density of approx. 2 x 10 13 cm -3 (1-mg/h average cesium consumption rate). Cesium trapping by the SPS discharge was observed for both dc and pulsed operation. A cesium energy of approx. 0.1 eV is deduced from the observed time of flight to the SIG. In addition to providing information on the physics of the source, the SIG is a useful diagnostic tool for source startup and operation

  9. Fast concentration of dissolved forms of cesium radioisotopes from large seawater samples

    Jan Kamenik; Henrieta Dulaiova; Ferdinand Sebesta; Kamila St'astna; Czech Technical University, Prague


    The method developed for cesium concentration from large freshwater samples was tested and adapted for analysis of cesium radionuclides in seawater. Concentration of dissolved forms of cesium in large seawater samples (about 100 L) was performed using composite absorbers AMP-PAN and KNiFC-PAN with ammonium molybdophosphate and potassium–nickel hexacyanoferrate(II) as active components, respectively, and polyacrylonitrile as a binding polymer. A specially designed chromatography column with bed volume (BV) 25 mL allowed fast flow rates of seawater (up to 1,200 BV h -1 ). The recovery yields were determined by ICP-MS analysis of stable cesium added to seawater sample. Both absorbers proved usability for cesium concentration from large seawater samples. KNiFC-PAN material was slightly more effective in cesium concentration from acidified seawater (recovery yield around 93 % for 700 BV h -1 ). This material showed similar efficiency in cesium concentration also from natural seawater. The activity concentrations of 137 Cs determined in seawater from the central Pacific Ocean were 1.5 ± 0.1 and 1.4 ± 0.1 Bq m -3 for an offshore (January 2012) and a coastal (February 2012) locality, respectively, 134 Cs activities were below detection limit ( -3 ). (author)

  10. Preliminary Evaluation of Cesium Distribution for Wet Sieving Process Planned for Soil Decontamination in Japan - 13104

    Enokida, Y.; Tanada, Y.; Hirabayashi, D. [Graduate School of Engineering, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan); Sawada, K. [EcoTopia Science Institute, Nagoya University, 1 Furo-cho Nagoya-shi, Aichi-ken, 4648603 (Japan)


    For the purpose of decontaminating radioactive cesium from a huge amount of soil, which has been estimated to be 1.2x10{sup 8} m{sup 3} by excavating to a 5-cm depth from the surface of Fukushima Prefecture where a severe nuclear accident occurred at TEPCO's power generating site and has emitted a significant amount of radioactive materials, mainly radioactive cesium, a wet sieving process was selected as one of effective methods available in Japan. Some private companies have demonstrated this process for soil treatment in the Fukushima area by testing at their plants. The results were very promising, and a full-fledged application is expected to follow. In the present study, we spiked several aqueous samples containing soil collected from an industrial wet sieving plant located near our university for the recycling of construction wastes with non-radioactive cesium hydroxide. The present study provides scientific data concerning the effectiveness in volume reduction of the contaminated soil by a wet sieving process as well as the cesium distribution between the liquid phase and clay minerals for each sub-process of the full-scale one, but a simulating plant equipped with a process of coagulating sedimentation and operational safety fundamentals for the plant. Especially for the latter aspect, the study showed that clay minerals of submicron size strongly bind a high content of cesium, which was only slightly removed by coagulation with natural sedimentation (1 G) nor centrifugal sedimentation (3,700 G) and some of the cesium may be transferred to the effluent or recycled water. By applying ultracentrifugation (257,000 G), most of submicron clay minerals containing cesium was removed, and the cesium amount which might be transferred to the effluent or recycled water, could be reduced to less than 2.3 % of the original design by the addition of a cesium barrier consisting of ultracentrifugation or a hollow fiber membrane. (authors)

  11. Test procedures and instructions for single shell tank saltcake cesium removal with crystalline silicotitanate

    Duncan, J.B.


    This document provides specific test procedures and instructions to implement the test plan for the preparation and conduct of a cesium removal test, using Hanford Single Shell Tank Saltcake from tanks 24 t -BY- I 10, 24 1 -U- 108, 24 1 -U- 109, 24 1 -A- I 0 1, and 24 t - S-102, in a bench-scale column. The cesium sorbent to be tested is crystalline siticotitanate. The test plan for which this provides instructions is WHC-SD-RE-TP-024, Hanford Single Shell Tank Saltcake Cesium Removal Test Plan.

  12. Historical Cost Curves for Hydrogen Masers and Cesium Beam Frequency and Timing Standards

    Remer, D. S.; Moore, R. C.


    Historical cost curves were developed for hydrogen masers and cesium beam standards used for frequency and timing calibration in the Deep Space Network. These curves may be used to calculate the cost of future hydrogen masers or cesium beam standards in either future or current dollars. The cesium beam standards are decreasing in cost by about 2.3% per year since 1966, and hydrogen masers are decreasing by about 0.8% per year since 1978 relative to the National Aeronautics and Space Administration inflation index.

  13. Effects of mineralogy on sorption of strontium and cesium onto Calico Hills Tuff

    Meyer, R.E.; Arnold, W.D.; Case, F.I.; O'Kelley, G.D.; Land, J.F.


    The sorption properties of tuff formations at the proposed site for the high-level nuclear waste repository at Yucca Mountain, Nevada, have been extensively studied. Sorption and desorption measurements were made of strontium and cesium onto clinoptilolite and Calico Hills Tuff. The object was to see whether there was a correlation between sorption of strontium and cesium onto Calico Hills Tuff and the sorption of strontium and cesium onto clinoptilolite based on the content of clinoptilolite in the Calico Hills Tuff. 13 refs., 10 figs., 6 tabs

  14. Distribution of plutonium and cesium in alluvial soils of the Los Alamos environs

    Nyhan, J.W.; Miera, F.R. Jr.; Peters, R.J.


    The alluvial soils of three liquid waste disposal areas at Los Alamos were sampled to determine plutonium and cesium distributional relationships and correlations with soil physical-chemical properties. Radionuclide concentrations were determined for soil samples as a function of soil depth and distance from the waste outfall. The cesium-plutonium data were correlated with levels of organic carbon, carbonates, exchangeable and water-soluble cations, pH, cation exchange capacity, bulk density, surface area and geometric particle size of these soils. The distribution patterns of soil plutonium and cesium were also compared to the waste use history of the three study areas

  15. Sorption and desorption of cesium and strontium on TA-2 and TA-41 soils and sediments

    Kung, K. Stephen; Li, Benjamin W.; Longmire, P.A.; Fowler, M.M.


    Current environmental monitoring has detected radioactive contaminants in alluvial groundwater, soils, and sediments in the TA-2 and TA-41 areas along the north central edge of Los Alamos National Laboratory. Because of this contamination, this study was initiated. The objective of this study is to quantify the sorptivity of cesium and strontium onto TA-2 and TA-41 site specific soil samples under a controlled environment in the laboratory. The purposes of this work are to determine cesium and strontium sorption coefficient for these sit specific soils and to evaluate the potential transport of cesium and strontium. Based on this information, a risk assessment and remediation strategy can be developed

  16. High voltage holding in the negative ion sources with cesium deposition

    Belchenko, Yu.; Abdrashitov, G.; Ivanov, A.; Sanin, A.; Sotnikov, O., E-mail: [Budker Institute of Nuclear Physics, Siberian Branch of Russian Academy of Sciences, Novosibirsk (Russian Federation)


    High voltage holding of the large surface-plasma negative ion source with cesium deposition was studied. It was found that heating of ion-optical system electrodes to temperature >100 °C facilitates the source conditioning by high voltage pulses in vacuum and by beam shots. The procedure of electrode conditioning and the data on high-voltage holding in the negative ion source with small cesium seed are described. The mechanism of high voltage holding improvement by depletion of cesium coverage is discussed.

  17. Advance in the study of removal of cesium from radioactive wastewater by inorganic ion exchangers

    Wang Songping; Wang Xiaowei; Du Zhihui


    The excellent performance in the removal of cesium from radioactive wastewater by inorganic ion exchangers has received extensive attention due to their characteristic physico-chemical features. The paper summarized research progress of removal of cesium by different inorganic ion exchangers such as silicoaluminate, salts of hetero polyacid, hexacyanoferrate, insoluble salts of acid with multivalent metals, insoluble hydrous oxides of multivalent metals and silicotitanate and reviewed several removal systems of cesium by inorganic ion exchangers which might offer China some reference in treatment and disposal of radioactive wastewater. (authors)

  18. Summary report on partitioning cesium from the Chinese high level liquid waste(HLLW) by calixcrown

    Wang Jianchen; Chen Jing


    The partitioning of Cesium from the HLLW with a higher-salts liquid from PUREX is a better choice for its further treatment or disposal. In this work, the progress of partitioning Cesium from the Chinese HLLW by 25,27-bis(2-propyloxy) calix[4]-26,28-crown-6(iPr-C[4]C-6) were introduced, including the synthesis method of calixcrown, selection of diluents, extraction properties, the radiolytic stability, cold test and hot test of cascade extraction for removing cesium from HLLW. (author)

  19. Radioactive and Stable Cesium Distributions in Fukushima Forests

    Ioshchenko, V.; Kivva, S.; Konoplev, A.; Nanba, K.; Onda, Y.; Takase, T.; Zheleznyak, M.


    Fukushima Dai-ichi NPP accident has resulted in release into the environment of large amounts of 134Cs and 137Cs and in radioactive contamination of terrestrial and aquatic ecosystems. In Fukushima prefecture up to 2/3 of the most contaminated territory is covered with forests, and understanding of its further fate in the forest ecosystems is essential for elaboration of the long-term forestry strategy. At the early stage, radiocesium was intercepted by the trees' canopies. Numerous studies reported redistribution of the initial fallout in Fukushima forests in the followed period due to litterfall and leaching of radiocesium from the foliage with precipitations. By now these processes have transported the major part of deposited radiocesium to litter and soil compartments. Future levels of radiocesium activities in the aboveground biomass will depend on relative efficiencies of the radiocesium root uptake and its return to the soil surface with litterfall and precipitations. Radiocesium soil-to-plant transfer factors for typical tree species, soil types and landscape conditions of Fukushima prefecture have not been studied well; moreover, they may change in time with approaching to the equilibrium between radioactive and stable cesium isotopes in the ecosystem. The present paper reports the results of several ongoing projects carried out by Institute of Environmental Radioactivity of Fukushima University at the experimental sites in Fukushima prefecture. For typical Japanese cedar (Cryptomeria japonica) forest, we determined distributions of radiocesium in the ecosystem and in the aboveground biomass compartments by the end of 2014; available results for 2015 are presented, too, as well as the results of test application of D-shuttle dosimeters for characterization of seasonal variations of radiocesium activity in wood. Based on the radiocesium activities in biomass we derived the upper estimates of its incorporation and root uptake fluxes, 0.7% and 3% of the total

  20. 40 CFR 745.113 - Certification and acknowledgment of disclosure.


    ... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...

  1. 9 CFR 113.306 - Canine Distemper Vaccine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...

  2. 9 CFR 113.302 - Distemper Vaccine-Mink.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...

  3. 9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...

  4. 9 CFR 113.206 - Wart Vaccine, Killed Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...

  5. 7 CFR 760.113 - Refunds; joint and several liability.


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...

  6. 9 CFR 113.101 - Leptospira Pomona Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...

  7. 9 CFR 113.103 - Leptospira Canicola Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...

  8. 9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...

  9. 9 CFR 113.105 - Leptospira Hardjo Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...

  10. 21 CFR 211.113 - Control of microbiological contamination.


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...

  11. 9 CFR 113.315 - Feline Rhinotracheitis Vaccine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...

  12. 9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...

  13. 9 CFR 113.329 - Newcastle Disease Vaccine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...

  14. 9 CFR 113.106 - Clostridium Chauvoei Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...

  15. 9 CFR 113.107 - Clostridium Haemolyticum Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...

  16. 9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...

  17. 9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...

  18. 14 CFR 135.113 - Passenger occupancy of pilot seat.


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...

  19. 19 CFR 113.33 - Corporations as principals.


    ... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...

  20. 9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...

  1. 14 CFR 1221.113 - Use of the NASA Flags.


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...

  2. 9 CFR 113.209 - Rabies Vaccine, Killed Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...

  3. 9 CFR 113.312 - Rabies Vaccine, Live Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...

  4. 9 CFR 202.113 - Rule 13: Written hearing.


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...

  5. 9 CFR 113.317 - Parvovirus Vaccine (Canine).


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...

  6. 9 CFR 113.65 - Brucella Abortus Vaccine.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...

  7. 13 CFR 113.455 - Textbooks and curricular material.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...

  8. 9 CFR 113.123 - Salmonella Dublin Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

  9. 9 CFR 113.122 - Salmonella Choleraesuis Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...

  10. 9 CFR 113.120 - Salmonella Typhimurium Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...

  11. 9 CFR 113.38 - Guinea pig safety test.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...

  12. 13 CFR 113.520 - Job classification and structure.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...

  13. 40 CFR 600.113-78 - Fuel economy calculations.


    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...

  14. 40 CFR 600.113-88 - Fuel economy calculations.


    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...

  15. 40 CFR 600.113-93 - Fuel economy calculations.


    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...

  16. 37 CFR 11.3 - Suspension of rules.


    ... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...

  17. 49 CFR 215.113 - Defective plain bearing wedge.


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...

  18. 49 CFR 199.113 - Employee assistance program.


    ... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...

  19. 19 CFR 113.55 - Cancellation of export bonds.


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...

  20. Prompt and delayed excitation and photolysis of cesium dimers

    Davanloo, F.; Collins, C.B.; Inamdar, A.S.; Mehendale, N.Y.; Nagvi, A.S.


    In this work a time-delayed, double resonance technique was used for the study of the state selective photolysis of Cs 2 excited in the yellow range of visible wavelengths. Particular attention being placed on the production of the fine structure components of the 5 2 D and 6 2 P states of Cs and upon the lifetimes of the product populations in the cesium vapor. A quantitative model was constructed to fit the data and rate coefficients were extracted for processes tending to attenuate the product state selectivity. Reported here is what appears to be the first value for the fine-structure mixing cross section for Cs(5 2 D5/2 → 5 2 D 3 /sub 3/2/) of 17 A 2 +-50%, close to the geometric cross section

  1. Mass spectrometric study of vaporization of cesium tellurate and tellurite

    Semenov, G.A.; Fokina, L.A.; Mouldagalieva, R.A.


    The process of vaporization of cesium tellurate and tellurite was studied by the Knudsen effusion method with a mass spectrometric analysis of the vapor composition. The thermal dissociation of Cs 2 TeO 4 to Cs 2 TeO 3 and the congruent vaporization of Cs 2 TeO 3 were established. Thermodynamic functions for gaseous Cs 2 TeO 3 have been calculated. The standard enthalpy of sublimation Δ s H (298.15)=268.1±13.0 kJ mol -1 was determined by the 2nd and 3rd laws of thermodynamics. The enthalpy of formation Δ f H (298.15)=-725.1±13.0 kJ mol -1 for gaseous Cs 2 TeO 3 and the enthalpy of atomization Δ at H (298.15)=1841.3±15.0 kJ mol -1 have been computed. ((orig.))

  2. Cesium-137 accident lessons in Goiania, Goias State, Brazil


    This document relates the experience obtained by several professionals which had an important role in the cesium-137 accident occurred in Goiania, Goias State, Brazil in September, 1987. It's divided into chapters, according to the action area - medical, nursing, social assistance, odontological and psychological. At first, some notions of radioprotection are explained, followed by the accident history and by the doctors and nurses action during the emergency phase and the medical, odontological, social and psychological assistance to the victims. The social assistance report shows some statistical data about the economic, occupational and social conditions of the accident victims. It is shown some information about the health institutions and the sanitary care in the ionizing radiation and about the occupational radiological protection in Goiania

  3. Cesium-137 body burden in Japanese from 1967 to 1975

    Anzai, I; Ueda, K; Togo, M [Tokyo Univ. (Japan). Faculty of Medicine


    Cesium-137 concentrations in Japanese male adults were measured monthly during 1967 to 1975 by whole body counting. The /sup 137/Cs content decreased rapidly until 1968, then the reduction rate was considerably decelerated, being probably affected by the French and Chinese nuclear testing. A small rise was observed at the end of 1970, and its causes have been multilaterally studied from the radioecological viewpoints, which has not resulted in a clearcut conclusion. Daily intake estimated from body burden varies in a wide range but, on the average, agrees well with the reported values based on the radiochemical analyses of foods. The integrated absorbed dose from January 1967 to April 1975 is calculated to be 2.5 mrads. The authors re-emphasize the importance of the periodic measurement of human population.

  4. Trade study for the disposition of cesium and strontium capsules

    Claghorn, R.D.


    This trade study analyzes alternatives for the eventual disposal of cesium and strontium capsules currently stored at the Waste Encapsulation and Storage Facility as by-product. However, for purposes of this study, it is assumed that at some time in the future, the capsules will be declared high-level waste and therefore will require disposal at an offsite geologic repository. The study considered numerous alternatives and selected three for detailed analysis: (1) overpack and storage at high-level waste canister storage building, (2) overpack at the high-level waste vitrification facility followed by storage at a high-level waste canister storage building, and (3) blend capsule contents with other high-level waste feed streams and vitrify at the high-level waste vitrification facility

  5. Solution-Phase Synthesis of Cesium Lead Halide Perovskite Nanowires.

    Zhang, Dandan; Eaton, Samuel W; Yu, Yi; Dou, Letian; Yang, Peidong


    Halide perovskites have attracted much attention over the past 5 years as a promising class of materials for optoelectronic applications. However, compared to hybrid organic-inorganic perovskites, the study of their pure inorganic counterparts, like cesium lead halides (CsPbX3), lags far behind. Here, a catalyst-free, solution-phase synthesis of CsPbX3 nanowires (NWs) is reported. These NWs are single-crystalline, with uniform growth direction, and crystallize in the orthorhombic phase. Both CsPbBr3 and CsPbI3 are photoluminescence active, with composition-dependent temperature and self-trapping behavior. These NWs with a well-defined morphology could serve as an ideal platform for the investigation of fundamental properties and the development of future applications in nanoscale optoelectronic devices based on all-inorganic perovskites.

  6. Diffusion of water, cesium and neptunium in pores of rocks

    Puukko, E.; Heikkinen, T.; Hakanen, M.


    Teollisuuden Voima Oy (TVO) is investigating the feasibility to dispose of spent nuclear fuel within Finland. The present plan calls for the repository to be located in crystalline rock at a depth of several hundred meters. The safety assessment of the repository includes calculations of migration of waste nuclides. The flow of waste elements in groundwater will be retarded through sorption interaction with minerals and through diffusion into rock. Diffusion is the only mechanism retarding the migration of non-sorbing species and, it is expected to be the dominating retardation mechanism of many of the sorbing elements. In the investigation the simultaneous diffusion of tritiated water (HTO), cesium and neptunium in rocks of TVO investigation sites at Kivetty, Olkiluoto and Romuvaara were studied. (11 refs., 33 figs., 9 tabs.)

  7. Estimating soil erosion losses in Korea with fallout cesium-137

    Menzel, R.G.; Pilkyun Jung; Kwanshig Ryu; Kitai Um


    The contents of fallout 137 Cs in soil profiles were used to estimate erosion losses from steeply sloping croplands in Korea. Seven undisturbed sites with no apparent erosion or deposition, and 15 cropland sites were examined to a depth of 30 cm. The cropland sites had been cultivated for periods ranging from 5 to more than 80 y (median 10 y), and their slopes ranged from 5 to 26% (median 13%). All except one of the cropland sites contained less 137 Cs than undisturbed sites in the same area. Three cropland sites contained essentially no 137 Cs, indicating erosion of the entire cultivated layer of soil in from 6 to 10 years. Other cropland sites, particularly those with sandy texture, showed little loss of 137 Cs over longer periods of cultivation. Cesium-137 measurements may be useful in identifying site characteristics that reduce the vulnerability of sloping soils to erosion damage. (author)

  8. Photoinduced charge transfer phase transition in cesium manganese hexacyanoferrate

    Matsuda, Tomoyuki; Tokoro, Hiroko; Hashimoto, Kazuhito; Ohkoshi, Shin-ichi


    Cesium manganese hexacyanoferrate, Cs 1.51 Mn[Fe(CN) 6 ], shows a thermal phase transition between Mn II -NC-Fe III [high-temperature (HT) phase] and Mn III -NC-Fe II [low-temperature (LT) phase] with phase transition temperatures of 170 K (HT→LT) and 230 K (LT→HT). The LT phase shows ferromagnetism with Curie temperature of 7 K and coercive field of 60 Oe. Irradiating with 532 nm laser light converts the LT phase into the photoinduced (PI) phase, which does not have spontaneous magnetization. The electronic state of the PI phase corresponds to that of the HT phase and the relaxation temperature from the PI to the LT phase is observed at 90 K

  9. Hyperfine relaxation of an optically pumped cesium vapor

    Tornos, J.; Amare, J.C.


    The relaxation of hyperfine orientation indirectly induced by optical pumping with a σ-polarized D 1 -light in a cesium vapor in the presence of Ar is experimentally studied. The detection technique ensures the absence of quadrupole relaxation contributions in the relaxation signals. The results from the dependences of the hyperfine relaxation rate on the temperature and argon pressure are: diffusion coefficient of Cs in Ar, D 0 = 0.101 +- 0.010 cm 2 s -1 at 0 0 C and 760 Torr; relaxation cross section by Cs-Ar collisions, σ/sub c/ = (104 +- 5) x 10 -23 cm 2 ; relaxation cross section by Cs-Cs (spin exchange) collisions, σ/sub e//sub x/ = (1.63 +- 0.13) x 10 -14 cm 2

  10. Quality assurance program plan for cesium legacy project

    Tanke, J.M.


    This Quality Assurance Program Plan (QAPP) provides information on how the Quality Assurance Program is implemented for the Cesium Legacy Project. It applies to those items and tasks which affect the completion of activities identified in the work breakdown structure of the Project Management Plan (PMP). These activities include all aspects of cask transportation, project related operations within the 324 Building, and waste management as it relates to the specific activities of this project. General facility activities (i.e. 324 Building Operations, Central Waste Complex Operations, etc.) are covered in other appropriate QAPPs. The 324 Building is currently transitioning from being a Pacific Northwest National Laboratory (PNNL) managed facility to a B and W Hanford Company (BWHC) managed facility. During this transition process existing PNNL procedures and documents will be utilized until replaced by BWHC procedures and documents

  11. Decreasing radioactive cesium in lodged buckwheat grain after harvest

    Katashi Kubo


    Full Text Available This study assessed soil contamination with high radioactive cesium (R–Cs concentration in buckwheat grains by lodging, and assessed the possibility of R–Cs reduction in grain through post-harvest preparation. Analysis of buckwheat grain produced in farmers’ fields and reports from farmers indicated that grain from fields that had lodging showed higher R–Cs than grain from fields with no lodging. A field experiment demonstrated that R–Cs in grain after threshing and winnowing (TW was about six times higher in lodged plants than in nonlodged plants. In lodged plants, R–Cs in grain was decreased to about one-fourth by polishing, and was decreased to about one-seventh by ultrasonic cleaning, compared with R–Cs in grain after TW. These results demonstrate that R–Cs of buckwheat grain of lodged plants can be decreased by removing soil from the grain surface by polishing and winnowing.

  12. Norbadione A: synthetic approach and cesium complexation studies

    Desage - El Murr, M.


    This work was dedicated to the study of the synthesis and complexation studies of norbadione A: a pigment originating from a mushroom. A synthetic approach, based on a double Suzuki-Miyaura coupling, was developed. This strategy was applied with high yields to the synthesis of various norbadione A analogues, as well as to the synthesis of simple pulvinic acids. Access to functionalized precursors of the molecule was also studied and the final coupling remains to be done. Besides, a speciation study based on electro-spray ionization mass spectrometry was conducted with norbadione A and one of the analogues. This study allowed the assessment of the cesium complexation abilities of each molecule. Structural data was also obtained and complexation constants were calculated. Finally, norbadione A and various synthetic products have been tested via high-throughput screening methods and strong antioxidant properties were observed. Other biological results are also reported. (author)

  13. Vitrification of cesium-contaminated organic ion exchange resin

    Sargent, T.N. Jr.


    Vitrification has been declared by the Environmental Protection Agency (USEPA) as the Best Demonstrated Available Technology (BDAT) for the permanent disposal of high-level radioactive waste. Savannah River Site currently uses a sodium tetraphenylborate (NaTPB) precipitation process to remove Cs-137 from a wastewater solution created from the processing of nuclear fuel. This process has several disadvantages such as the formation of a benzene waste stream. It has been proposed to replace the precipitation process with an ion exchange process using a new resorcinol-formaldehyde resin developed by Savannah River Technical Center (SRTC). Preliminary tests, however, showed that problems such as crust formation and a reduced final glass wasteform exist when the resin is placed in the melter environment. The newly developed stirred melter could be capable of overcoming these problems. This research explored the operational feasibility of using the stirred tank melter to vitrify an organic ion exchange resin. Preliminary tests included crucible studies to determine the reducing potential of the resin and the extent of oxygen consuming reactions and oxygen transfer tests to approximate the extent of oxygen transfer into the molten glass using an impeller and a combination of the impeller and an external oxygen transfer system. These preliminary studies were used as a basis for the final test which was using the stirred tank melter to vitrify nonradioactive cesium loaded organic ion exchange resin. Results from this test included a cesium mass balance, a characterization of the semi-volatile organic compounds present in the off gas as products of incomplete combustion (PIC), a qualitative analysis of other volatile metals, and observations relating to the effect the resin had on the final redox state of the glass

  14. Ion-exchange properties of cesium and strontium into zeolites from sodium salt solutions

    Kanno, Takuji; Hashimoto, Hiroyuki; Ohtani, Tozo.


    The ion-exchange properties of cesium and strontium into zeolite from sodium salt solution has been studied in zeolite A, zeolite X, zeolite Y, mordenite and clinoptilolite. The distribution of cesium into mordenite from about 1 -- 2 M sodium chloride and sodium hydroxide solutions is considerably larger than that into zeolite A. The distribution coefficient for 2 M solution of sodium salts was about 300. Therefore, the separation of cesium from sodium salt solution is possible by using mordenite. The distribution of strontium into zeolites form 1 -- 2 M solutions of sodium chloride and sodium nitrate were in the order of zeolite A>zeolite X>zeolite Y asymptoticaly equals mordenite. The distribution coefficient of 230 was obtained for 1 M solutions of sodium salts. The anion in solutions had no effect on the distribution of cesium and strontium into zeolite from sodium salt solution. (author)

  15. Efficiency of Dry (Psidium guava) Leaves for The Removal of Cesium-137 from Aqueous Solutions

    Omar, H.A.; Abu-Kharda, S.A.; Abd El -Baset, L.A.; Abu-Shohba, R.M.


    Batch experiments for the removal of cesium-137 from aqueous solution onto guava leaves (psidium guava) and carbonized guava leaves were studied as a function of contact time, dosage, ph value and initial concentration ion. The sorption process was described by pseudo first-order, pseudo second-order, Morris and Elovich kinetic models. Cesium concentrations were ranged between 2x10 -5 - 1x10 -3 M. Sorption data have been interpreted in terms of Langmuir, Freundlich and Dubinin-Radushkevich isotherms. The maximum sorption capacity of carbonized guava leaves adsorbent for cesium removal was 8.02 mgg -1 . The results of the present study suggest that carbonized guava leaves can be used beneficially for cesium removal from aqueous solution.

  16. Strontium-90 and cesium-137 in milk (consuming districts) (from May. 1982 to Mar. 1983)


    Strontium-90 and cesium-137 in milk (consuming districts from May 1982 to Mar. 1983) were determined. Commercial milk was purchased in 25 consuming districts. The results are shown in a table. (J.P.N.)

  17. End-of-Life Indicators for NIMA's High-Performance Cesium Frequency Standards

    Brock, C; Tolman, B. W; Taylor, R. E


    .... The mean lifetime of the cesium-beam tube (CBT) is approximately 6 years; failure or end-of-life of the CBT is a significant cause in the reduction of data used to produce the NIMA GPS precise ephemeris...

  18. Biological effects of cesium-137 injected in beagle dogs of different ages

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C. [and others


    The toxicity of cesium-137 ({sup 137}Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of {sup 137}Cs are important to understand because {sup 137}Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy.


    Smith, F.; Hamm, Luther; Aleman, Sebastian; Michael, Johnston


    The performance of spherical Resorcinol-Formaldehyde ion-exchange resin for the removal of cesium from alkaline radioactive waste solutions has been investigated through computer modeling. Cesium adsorption isotherms were obtained by fitting experimental data using a thermodynamic framework. Results show that ion-exchange is an efficient method for cesium removal from highly alkaline radioactive waste solutions. On average, two 1300 liter columns operating in series are able to treat 690,000 liters of waste with an initial cesium concentration of 0.09 mM in 11 days achieving a decontamination factor of over 50,000. The study also tested the sensitivity of ion-exchange column performance to variations in flow rate, temperature and column dimensions. Modeling results can be used to optimize design of the ion exchange system

  20. Ability of phytoremediation for absorption of strontium and cesium from soils using Cannabis sativa

    Parisa Seyed Hoseini


    Conclusion: Our findings suggest that strontium can be absorbed by Cannabis sativa, with the highest absorption by the roots, stems, and leaves. However, cesium does not reach the plant because of its single capacity and inactive complex formation.

  1. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    Peterson, R.A.


    This report contains the results from a study requested by High Level Waste Division on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na+] increased the rate at which cesium tetraphenylborate (KTPB) in the presence of high [Na+] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice

  2. Total deposition of cesium-137 measured in Finland during the exercise 'RESUME 95' in August 1995

    Geer, L.E. De; Vintersved, I.; Arntsing, R.


    In the exercise called 'RESUME 95' the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au)

  3. New separation techniques of cesium by redox type ion exchange materials

    Tanihara, Koichi


    RIECS method, new cesium separation method, was developed in which a porous strong base anionic exchanger with copper ferrocyanide (CuFC) and inhibitor were used. Cesium could be separated from the high concentration nitric solution. By developing new impregnation method, large amount of CuFC was impregnated into the micropolar porous resin and silica gel pores. KFC adhered to outside of pores was recovered. Good complex with CuFC was prepared by use of copper chloride in ethyl alcohol solution. The adsorption ratio of cesium increased radically to 80% level in the very small range of hydrazine concentration 1.7 to 2.4x10 -4 M. The adsorption-desorption ratio of cesium did not decrease by repeating it seven times. The glassificated materials decreased large amount of γ-ray unless increase of volume could be produced by built RIECS method in the high level waste processing system. (S.Y.)

  4. Investigations of the sorption of cesium from acid solutions by various inorganic sorbents

    Suess, M.; Pfrepper, G.


    Studies have been made to investigate the suitability of various inorganic sorbents for separating and obtaining cesium from acid solutions. In greater details, the distribution coefficients of cesium from nitric acid and ammonium nitrate solution were determined. To determine the saturation capacities it was necessary to plot the isotherms of adsorption from 0.5 N and 3.1 N nitric acid. Experimental sorption from a model solution, of which the composition was equal to that of the liquid Purex waste, enabled the suitability of the various exchangers for obtaining cesium from fission product solutions to be determined. From the results obtained it is apparent that ammonium phosphomolybdate is best suited for obtaining cesium from acid fission product solutions. (orig.)

  5. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Geer, L.E. De; Vintersved, I.; Arntsing, R. [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)


    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  6. Efficient non-linear two-photon effects from the Cesium 6D manifold

    Haluska, Nathan D.; Perram, Glen P.; Rice, Christopher A.


    We report several non-linear process that occur when two-photon pumping the cesium 6D states. Cesium vapor possess some of the largest two-photon pump cross sections in nature. Pumping these cross sections leads to strong amplified spontaneous emission that we observe on over 17 lasing lines. These new fields are strong enough to couple with the pump to create additional tunable lines. We use a heat pipe with cesium densities of 1014 to 1016 cm-3 and 0 to 5 Torr of helium buffer gas. The cesium 6D States are interrogated by both high energy pulses and low power CW sources. We observe four-wave mixing, six-wave mixing, potential two-photon lasing, other unknown nonlinear processes, and the persistence of some processes at low thresholds. This system is also uniquely qualified to support two-photon lasing under the proper conditions.

  7. Studies on the synthesis and characterization of cesium-containing iron phosphate glasses

    Joseph, Kitheri; Govindan Kutty, K. V.; Chandramohan, P.; Vasudeva Rao, P. R.


    Isotopes of cesium and strontium can be utilized as radiation source for various industrial and medical applications after their separation from high level nuclear waste. However, these elements need to be immobilized in a suitable matrix. In the present work, a systematic approach has been made to immobilize inactive cesium into iron phosphate glass. Up to 36 mol% of Cs 2O has been loaded successfully without crystallization. The glass transition temperature of the cesium loaded glass was found to increase initially and then decrease as a function of Cs 2O content. Mössbauer studies show that the concentration of Fe 3+ ions in the cesium loaded glasses is >95%. Volatilization experiments at 1263 K show that the weight loss is >0.5% for a period of 4 h. The 36 mol% of Cs 2O loaded iron phosphate glass with high Fe 3+ content described in this paper is reported for the first time.

  8. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium.

    Hu, Baiyang; Fugetsu, Bunshi; Yu, Hongwen; Abe, Yoshiteru


    We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent. Copyright © 2012 Elsevier B.V. All rights reserved.

  9. Strontium-90 and cesium-137 in milk (consuming districts) (from May 1982 to Aug. 1982)


    Strontium-90 and cesium-137 in milk (consuming districts from May to Aug. 1982) were determined. Commercial milk was purchased in 20 consuming districts. The results are shown in a table. (Namekawa, K.)

  10. Biological effects of cesium-137 injected in beagle dogs of different ages

    Nikula, K.J.; Muggenburg, B.A.; Griffith, W.C.


    The toxicity of cesium-137 ( 137 Cs) in the Beagle dog was investigated at the Argonne National Laboratory (ANL) as part of a program to evaluate the biological effects of internally deposited radionuclides. The toxicity and health effects of 137 Cs are important to understand because 137 Cs is produced in large amounts in light-water nuclear reactors. Large quantities of cesium radioisotopes have entered the human food chain as a result of atmospheric nuclear weapons test, and additional cesium radioisotopes were released during the Chernobyl accident. Although the final analyses are not complete, three findings are significant: older dogs dies significantly earlier than juvenile and young adult dogs; greater occurrence of sarcomas in the cesium-137 injected dogs; the major nonneoplastic effect in dogs surviving beyond 52 d appears to be testicular atrophy

  11. IceBridge Scintrex CS-3 Cesium Magnetometer L1B Geolocated Magnetic Anomalies, Version 1

    National Aeronautics and Space Administration — The NASA IceBridge Scintrex CS-3 Cesium Magnetometer L1B Geolocated Magnetic Anomalies (IMCS31B) data set contains magnetic field readings taken over Greenland using...

  12. IceBridge Scintrex CS-3 Cesium Magnetometer L0 Raw Magnetic Field, Version 1

    National Aeronautics and Space Administration — The NASA IceBridge Scintrex CS-3 Cesium Magnetometer L0 Raw Magnetic Field data set contains magnetic field readings and fluxgate values taken over Greenland using...

  13. Total deposition of cesium-137 measured in Finland during the exercise `RESUME 95` in August 1995

    Geer, L.E. De; Vintersved, I; Arntsing, R [National Defence Research Establisment, Nuclear Detection Group, Stockholm (Sweden)


    In the exercise called `RESUME 95` the Nuclear Detection Group from the National Defence Research Establishment in Stockholm participated with field gamma ray measurements combined with soil sampling and profile measurements. The results are presented in this report for the measurements of cesium-137. We considered the measurements of cesium-137 at the airfield the most important part of the in-situ exercise. Data was of course collected also for cesium-134 and natural radionuclides but time has not permitted a full analysis of these radionuclides. The methodology would, however, be the same as applied for cesium-137. Less attention was paid for area II and due to limited personnel resources the search exercise was not fully carried out. (au).

  14. Cesium relocation in mixed-oxide fuel pins resulting from increased temperature reirradiation

    Lawrence, L.A.; Woodley, R.E.; Weber, E.T.


    Mixed-oxide fuel pins from EBR-II test subassemblies PNL-3 and PNL-4 were reirradiated in the GETR to study effects of increased fuel and cladding temperatures on chemical and thermomechanical behavior. Radial and axial distributions of cesium were obtained using postirradiation nondestructive precision gamma-scanning techniques. Data presented relate to the dependence of cesium distribution and transport processes on temperature gradients which were altered after substantial steady-state operation

  15. Contribution of the pectin in the cesium elimination in organism. results of analysis on Belarus children


    The results make appear that the cesium 137 would be eliminated less quick than what the ICRP considered for its models. Pectin would accelerate the cesium elimination but less quick than what is announced by its promotors. Politically speaking, the pectin is ignored by the officials of medicine and radiation protection at the pretext that its efficiency is not proved but no study is made. (N.C.)

  16. Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory

    Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.


    At Los Alamos National Laboratory, cesium-137 ({sup 137}Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles {<=}2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of {sup 137}Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of {sup 137}Cs.

  17. Characterization and immobilization of cesium-137 in soil at Los Alamos National Laboratory

    Lu, Ningping; Mason, C.F.V.; Turney, W.R.J.R.


    At Los Alamos National Laboratory, cesium-137 ( 137 Cs) is a major contaminant in soils of Technical Area 21 (TA-21) and is mainly associated with soil particles ≤2.00 mm. Cesium-137 was not leached by synthetic groundwater or acid rainwater. Soil erosion is a primary mechanism of 137 Cs transport in TA-21. The methodology that controls soil particle runoff can prevent the transport of 137 Cs

  18. Concentrating cesium-137 from seawater using resorcinol-formaldehyde resin for radioecological monitoring

    Egorin, Andrei; Tokar, Eduard; Tutov, Mikhail; Avramenko, Valentin [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation); Far Eastern Federal Univ., Vladivostok (Russian Federation); Palamarchuk, Marina; Marinin, Dmitry [Institute of Chemistry FEBRAS, Vladivostok (Russian Federation)


    A method of preconcentrating cesium-137 from seawater using a resorcinol-formaldehyde resin, which enables one to optimize the ecological monitoring procedure, has been suggested. Studies of sorption of cesium-137 from seawater by resorcinol-formaldehyde resin have been performed, and it has been demonstrated that the cation exchanger is characterized by high selectivity with respect to cesium-137. It was found that the selectivity depended on the temperature of resin solidification and the seawater pH value. The maximal value of the cesium-137 distribution coefficient is equal to 4.1-4.5 x 10{sup 3} cm{sup 3} g{sup -1}. Under dynamic conditions, the ion-exchange resin capacity is 310-910 bed volumes depending on the seawater pH, whereas the efficiency of cesium removal exceeds 95%. The removal of more than 95% of cesium-137 has been attained using 1-3 M solutions of nitric acid: here, the eluate volume was 8-8.4 bed volumes. Application of 3 M solution of nitric acid results in resin degradation with the release of gaseous products.

  19. Cesium absorption from acidic solutions using ammonium molybdophosphate on a polyacrylonitrile support (AMP-PAN)

    Miller, C.J.; Olson, A.L.; Johnson, C.K.


    Recent efforts at the Idaho Chemical Processing Plant (ICPP) have included evaluation of cesium removal technologies as applied to ICPP acidic radioactive waste streams. Ammonium molybdophosphate (AMP) immobilized on a polyacrylonitrile support (AMP-PAN) has been studied as an ion exchange agent for cesium removal from acidic waste solutions. Capacities, distribution coefficients, elutability, and kinetics of cesium-extraction have been evaluated. Exchange breakthrough curves using small columns have been determined from 1M HNO 3 and simulated waste solutions. The theoretical capacity of AMP is 213 g Cs/kg AMP. The average experimental capacity in batch contacts with various acidic solutions was 150 g Cs/kg AMP. The measured cesium distribution coefficients from actual waste solutions were 3287 mL/g for dissolved zirconia calcines, and 2679 mL/g for sodium-bearing waste. The cesium in the dissolved alumina calcines was analyzed for; however, the concentration was below analytical detectable limits resulting in inconclusive results. The reaction kinetics are very rapid (2-10 minutes). Cesium absorption appears to be independent of acid concentration over the range tested (0.1 M to 5 M HNO 3 )

  20. Review and assessment of technologies for the separation of cesium from acidic media

    Orth, R.J.; Brooks, K.P.; Kurath, D.E.


    A preliminary literature survey has been conducted to identify and evaluate methods for the separation of cesium from acidic waste. The most promising solvent extraction, precipitation, and ion exchange methods, along with some of the attributes for each method, are listed. The main criteria used in evaluating the separation methods were as follows: (1) good potential for cesium separation must be demonstrated (i.e., cesium decontamination factors on the order of 50 to 100). (2) Good selectivity for cesium over bulk components must be demonstrated. (3) The method must show promise for evolving into a practical and fairly simple process. (4) The process should be safe to operate. (5) The method must be robust (i.e., capable of separating cesium from various acidic waste types). (6) Secondary waste generation must be minimized. (7) The method must show resistance to radiation damage. The most promising separation methods did not necessarily satisfy all of the above criteria, thus key areas requiring further development are suggested for each method. The report discusses in detail these and other areas requiring further development, as well as alternative solvent extraction, precipitation, ion exchange, and {open_quote}other{close_quote} technologies that, based on current information, show less promise for the separation of cesium from acidic wastes because of significant process limitations. When appropriate, the report recommends areas of future development.

  1. Caustic-Side Solvent Extraction: Prediction of Cesium Extraction from Actual Wastes and Actual Waste Simulants

    Delmau, L.H.; Haverlock, T.J.; Sloop, F.V. Jr.; Moyer, B.A.


    This report presents the work that followed the CSSX model development completed in FY2002. The developed cesium and potassium extraction model was based on extraction data obtained from simple aqueous media. It was tested to ensure the validity of the prediction for the cesium extraction from actual waste. Compositions of the actual tank waste were obtained from the Savannah River Site personnel and were used to prepare defined simulants and to predict cesium distribution ratios using the model. It was therefore possible to compare the cesium distribution ratios obtained from the actual waste, the simulant, and the predicted values. It was determined that the predicted values agree with the measured values for the simulants. Predicted values also agreed, with three exceptions, with measured values for the tank wastes. Discrepancies were attributed in part to the uncertainty in the cation/anion balance in the actual waste composition, but likely more so to the uncertainty in the potassium concentration in the waste, given the demonstrated large competing effect of this metal on cesium extraction. It was demonstrated that the upper limit for the potassium concentration in the feed ought to not exceed 0.05 M in order to maintain suitable cesium distribution ratios

  2. Measurement of cesium emissions during the vitrification of simulated high level radioactive waste

    Zamecnik, J.R.; Miller, D.H.; Carter, J.T.


    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to eliminate a startup test that would involve adding small amounts of radioactive cesium-137 to simulated high-level waste. In order to eliminate this test, a reliable method for measuring non-radioactive cesium in the offgas system from the glass melter is required. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICPMS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. Typical particulate loadings ranged from 800 μg of cesium. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. The decontamination factors measured experimentally compared favorably with the process design basis values

  3. Prussian blue caged in spongiform adsorbents using diatomite and carbon nanotubes for elimination of cesium

    Hu, Baiyang [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Fugetsu, Bunshi, E-mail: [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Yu, Hongwen [Graduate School of Environmental Science, Hokkaido University, Sapporo 060-0810 (Japan); Abe, Yoshiteru [Kyoei Engineering Corporation, Niigata 959-1961 (Japan)


    Highlights: Black-Right-Pointing-Pointer Prussian blue was sealed in cavities of diatomite using carbon nanotubes. Black-Right-Pointing-Pointer The caged Prussian blue after being permanently immobilized in polyurethane spongy showed a 167 mg/g capability for absorbing cesium. Black-Right-Pointing-Pointer Cesium elimination was accomplished by simply adding the Prussian-blue based spongiform adsorbent to radioactive water. - Abstract: We developed a spongiform adsorbent that contains Prussian blue, which showed a high capacity for eliminating cesium. An in situ synthesizing approach was used to synthesize Prussian blue inside diatomite cavities. Highly dispersed carbon nanotubes (CNTs) were used to form CNT networks that coated the diatomite to seal in the Prussian blue particles. These ternary (CNT/diatomite/Prussian-blue) composites were mixed with polyurethane (PU) prepolymers to produce a quaternary (PU/CNT/diatomite/Prussian-blue), spongiform adsorbent with an in situ foaming procedure. Prussian blue was permanently immobilized in the cell walls of the spongiform matrix and preferentially adsorbed cesium with a theoretical capacity of 167 mg/g cesium. Cesium was absorbed primarily by an ion-exchange mechanism, and the absorption was accomplished by self-uptake of radioactive water by the quaternary spongiform adsorbent.

  4. Diffusion of cesium in sodium-borosilicate glasses for nuclear waste immobilisation. Diffusie van cesium in natrium borosilicaat glazen voor het immobiliseren van radioaktief afval

    Janssen, F.J.J.G.; Sengers, E.G.F. (Keuring van Electrotechnische Materialen NV, Arnhem (Netherlands)); Waal, H. de (TPD-TNO-Glass technology, Eindhoven (Netherlands))


    Diffusion of cesium in borosilicate glass for high-level radioactive waste is discussed. For this purpose model glasses with non-radioactive elements are being made, in accordance with the specifications of the reprocessing plants, from which concentration couples are composed. A concentration couple consists of two cylinders of borosilicate glass which contain different amounts of cesium. After heat treatment the couples are studied by means of the scanning electron microscopy and X-ray microanalysis. The model study will provide a basis for predictions of the containment achieved over a longer period of time. (author). 11 refs.; 2 figs.; 2 tabs.

  5. Investigations on the indium-113m isotope generators

    Oniciu, L.; Veglia, A.


    Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)

  6. 23 CFR 635.113 - Bid opening and bid tabulations.


    ... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.113 Bid opening and bid tabulations. (a) All bids... contractors, during the period following the opening of bids and before the award of the contract shall not be...

  7. 36 CFR 11.3 - Power to revoke.


    ... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...

  8. Small Column Ion Exchange Analysis for Removal of Cesium from SRS Low Curie Salt Solutions Using Crystalline Silicotitanate (CST) Resin



    Savannah River Technology Center (SRTC) researchers modeled ion exchange removal of cesium from dissolved salt waste solutions. The results assist in evaluating proposed configurations for an ion exchange process to remove residual cesium from low curie waste streams. A process for polishing (i.e., removing small amounts) of cesium may prove useful should supernate draining fail to meet the Low Curie Salt (LCS) target limit of 0.1 Ci of Cs-137 per gallon of salt solution. Cesium loading isotherms and column breakthrough curves for Low Curie dissolved salt solutions were computed to provide performance predictions for various column designs

  9. Formation, decomposition and cesium adsorption mechanisms of highly alkali-tolerant nickel ferrocyanide prepared by interfacial synthesis

    Ichikawa, Tsuneki; Yamada, Kazuo; Osako, Masahiro; Haga, Kazuko


    Highly alkali-tolerant nickel ferrocyanide was prepared as an adsorbent for preventing the leaching of radioactive cesium from municipal solid waste incinerator fly ash containing large amounts of calcium hydroxide and potassium chloride, which act as an alkaline source and the suppressor for cesium adsorption, respectively. Nickel ferrocyanide prepared by contacting concentrated nickel and ferrocyanide solutions without mixing adsorbed cesium ions in alkaline conditions even the concentration of coexisting potassium ions was more than ten thousand times higher than that of the cesium ions. Large particles of nickel ferrocyanide slowly grew at the interface between the two solutions, which reduced the surface energy of the particles and therefore increased the alkali tolerance. The interfacially-synthesized nickel ferrocyanide was possible to prevent the leaching of radioactive cesium from cement-solidified fly ash for a long period. The mechanisms of the formation, selective cesium adsorption, and alkali-induced decomposition of the nickel ferrocyanide were elucidated. Comparison of the cesium adsorption mechanism with that of the other adsorbents revealed that an adsorbent can selectively adsorb cesium ions without much interference from potassium ions, if the following conditions are fulfilled. 1) The adsorption site is small enough for supplying sufficient electrostatic energy for the dehydration of ions adsorbed. 2) Both the cesium and potassium ions are adsorbed as dehydrated ions. 3) The adsorption site is flexible enough for permitting the penetration of dehydrated ions with the size comparable to that of the site. (author)

  10. Quantitative analysis on dose to humans as a result of consuming tuna fish contaminated by cesium radionuclides

    Khani, J.; Donev, J.M.K.C.


    Quantitative empirical data is presented on the dose exposure to North Americans consuming tuna fish that have accumulated concentrations of radioactive isotopes. The two particular radioactive isotopes of interest are cesium-137 and cesium-134. Though biological effects of radiation are a widely debatable topic, the consumption of tuna fish does not support significant increased risk of cancer to humans. An important comparison is made between the elevated levels of radioactive cesium concentrations to naturally occurring radionuclides, namely potassium-40 and polonium-210. It is calculated that naturally occurring radioactive isotopes are in the orders of magnitude greater than the cesium radionuclides in tuna fish. (author)

  11. Quantitative analysis on dose to humans as a result of consuming tuna fish contaminated by cesium radionuclides

    Khani, J.; Donev, J.M.K.C., E-mail:, E-mail: [Univ. of Calgary, Calgary, AB (Canada)


    Quantitative empirical data is presented on the dose exposure to North Americans consuming tuna fish that have accumulated concentrations of radioactive isotopes. The two particular radioactive isotopes of interest are cesium-137 and cesium-134. Though biological effects of radiation are a widely debatable topic, the consumption of tuna fish does not support significant increased risk of cancer to humans. An important comparison is made between the elevated levels of radioactive cesium concentrations to naturally occurring radionuclides, namely potassium-40 and polonium-210. It is calculated that naturally occurring radioactive isotopes are in the orders of magnitude greater than the cesium radionuclides in tuna fish. (author)

  12. Retrospective radiation-hygienic assessment of cesium-137 intake with feeding in the organisms of the Altai Territory habitants

    Meshkov, N.A.; Val'tseva, E.A.


    Radioactive precipitations as the result of atmospheric nuclear tests on the Semipalatinsk test site turned to local soil contamination by cesium-137 on the territory of the Altai Territory and Gorny Altai. The distribution of long-lived radioisotopes, cesium-137 in particular, in the main food staffs for local population is investigated. The retrospective analysis of cesium-137 specific activity in food products produced on these territories is carried out. It is ascertained that cesium-137 in meat has the general contribution to intake with food into organisms of adult population [ru

  13. Modeling approach to various time and spatial scale environmental issues in Fukushima. Related to radioactive cesium migration in aquatic systems

    Kurikami, Hiroshi; Kitamura, Akihiro; Yamada, Susumu; Machida, Masahiko


    Several numerical models have been prepared to deal with various time- and spatial-scale issues related to radioactive cesium migration in environment in Fukushima area. The SACT (Soil and Cesium Transport) model developed by the Japan Atomic Energy Agency (JAEA) predicts middle- to long-term evolution of radioactive cesium distribution due to soil erosion, subsequent sediment transport and deposition, and radioactive cesium migration based on the Universal Soil Loss Equation (USLE). The TODAM (Time-dependent One-dimensional Degradation and Migration) model, iRIC/Nays2D and the FLESCOT (Flow, Energy, Salinity, Sediment, Contaminant Transport) model are one-, two- and three-dimensional river/reservoir/coastal models, respectively. Based on conservation equations of sediment and radioactive cesium, they treat advection and diffusion of suspended sediment and cesium, deposition of sediment to bed, re-suspension from bed and adsorption/desorption of radioactive cesium. These models are suitable for small and short time scale issues such as high discharges of sediment and radioactive cesium from rivers due to heavy rainfall events. This paper describes fragments of the JAEA’s approaches of modeling to deal with the issues corresponding to radioactive cesium migration in environment with some case studies. (author)

  14. Effect of electrolytes concentration on recovery of cesium from AMP-PAN by Electrodialysis-Ion Exchange (EDIX)

    Mahendra, Ch.; Rajan, K.K.; SatyaSai, P.M.; Anand Babu, C.


    Cesium from the simulated acidic waste solution was separated using Ammonium Molybdophosphate (AMP) - Polyacrylonitrile (PAN) ion exchange resin in column operations. Electrodialysis - Ion exchange (EDIX) has been tried for the recovery of cesium from the AMP-PAN which was saturated with cesium. The electrodialysis setup consists of three compartments; cesium loaded AMP-PAN is placed in the middle compartment and is separated from the anode and cathode compartments by cation exchange membranes. Ammonium sulphate was used as anolyte and HNO 3 as catholyte. 0.1N HNO 3 was circulated in the middle compartment containing AMP-PAN to keep the resin in acidic form. On application of potential, the ammonium ions from the anode compartment migrate towards cathode through the middle compartment where they exchange with cesium ions on the resin and the exchanged cesium ions migrate towards cathode to get concentrated. Some part of cesium is recovered in the middle compartment due to convection. Cesium recovery from the AMP-PAN in the electrodialysis setup was studied at different anolyte and catholyte concentrations. All the experiments were carried out at constant current density of 40 mA/cm 2 for 15h. It was found that more than 50% of cesium recovery was observed for all the experiments studied and recovery percentage increased with increasing the anolyte concentration. It was observed that the electrolytes concentration affects the voltage drop across the cell

  15. Engineered Materials for Cesium and Strontium Storage Final Technical Report

    Sean M. McDeavitt


    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at

  16. Engineered Materials for Cesium and Strontium Storage. Final Technical Report

    McDeavitt, Sean M.


    Closing the nuclear fuel cycle requires reprocessing spent fuel to recover the long-lived components that still have useful energy content while immobilizing the remnant waste fission products in stable forms. At the genesis of this project, next generation spent fuel reprocessing methods were being developed as part of the U.S. Department of Energy's Advanced Fuel Cycle Initiative. One of these processes was focused on solvent extraction schemes to isolate cesium (Cs) and strontium (Sr) from spent nuclear fuel. Isolating these isotopes for short-term decay storage eases the design requirements for long-term repository disposal; a significant amount of the radiation and decay heat in fission product waste comes from Cs-137 and Sr-90. For the purposes of this project, the Fission Product Extraction (FPEX) process is being considered to be the baseline extraction method. The objective of this project was to evaluate the nature and behavior of candidate materials for cesium and strontium immobilization; this will include assessments with minor additions of yttrium, barium, and rubidium in these materials. More specifically, the proposed research achieved the following objectives (as stated in the original proposal): (1) Synthesize simulated storage ceramics for Cs and Sr using an existing labscale steam reformer at Purdue University. The simulated storage materials will include aluminosilicates, zirconates and other stable ceramics with the potential for high Cs and Sr loading. (2) Characterize the immobilization performance, phase structure, thermal properties and stability of the simulated storage ceramics. The ceramic products will be stable oxide powders and will be characterized to quantify their leach resistance, phase structure, and thermophysical properties. The research progressed in two stages. First, a steam reforming process was used to generate candidate Cs/Sr storage materials for characterization. This portion of the research was carried out at Purdue

  17. Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113

    Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta


    Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765

  18. Preparation and characterization of cesium-137 aluminosilicate pellets for radioactive source applications

    Schultz, F.J.; Tompkins, J.A.; Haff, K.W.; Case, F.N.


    Twenty-seven fully loaded 137 Cs aluminosilicate pellets were fabricated in a hot cell by the vacuum hot pressing of a cesium carbonate/montmorillonite clay mixture at 1500 0 C and 570 psig. Four pellets were selected for characterization studies which included calorimetric measurements, metallography, scanning electron microscope and electron backscattering (SEM-BSE), electron microprobe, x-ray diffraction, and cesium ion leachability measurements. Each test pellet contained 437 to 450 curies of 137 Cs as determined by calorimetric measurements. Metallographic examinations revealed a two-phase system: a primary, granular, gray matrix phase containing large and small pores and small pore agglomerations, and a secondary fused phase interspersed throughout the gray matrix. SEM-BSE analyses showed that cesium and silicon were uniformly distributed throughout both phases of the pellet. This indicated that the cesium-silicon-clay reaction went to completion. Aluminum homogeneity was unconfirmed due to the high background noise associated with the inherent radioactivity of the test specimens. X-ray diffraction analyses of both radioactive and non-radioactive aluminosilicate pellets confirmed the crystal lattice structure to be pollucite. Cesium ion quasistatic leachability measurements determined the leach rates of fully loaded 137 Cs sectioned pollucite pellets to date to be 4.61 to 34.4 x 10 -10 kg m -2 s -1 , while static leach tests performed on unsectioned fully loaded pellets showed the leach rates of the cesium ion to date to be 2.25 to 3.41 x 10 -12 kg m -2 s -1 . The cesium ion diffusion coefficients through the pollucite pellet were calculated using Fick's first and second laws of diffusion. The diffusion coefficients calculated for three tracer level 137 Cs aluminosilicate pellets were 1.29 x 10 -16 m 2 s -1 , 6.88 x 10 -17 m 2 s -1 , and 1.35 x 10 -17 m 2 s -1 , respectively

  19. Co-precipitation and solubility studies of cesium, potassium and sodium tetraphenylborate

    Peterson, R.A.


    This report contains the results from a study requested by High Level Waste on the co-precipitation and solubility of cesium, potassium, and sodium tetraphenylborate. Co-precipitation of cesium (Cs), potassium (K), and sodium (Na) tetraphenylborate (TPB) helps determine the efficiency of reagent usage in the Small Tank Precipitation Process. This process uses NaTPB to remove cesium from waste by means of precipitation. Previous studies by McCabe suggested that if the sodium ion concentration [Na + ] increased the rate at which cesium tetraphenylborate (CsTPB) precipitates also increases. Serkiz also demonstrated that the precipitation of potassium tetraphenylborate (KTPB) in the presence of high [Na + ] (∼5M) appears to produce a mixed solid phase composed of NaTPB and KTPB together in the crystal lattice. In the crystallographic structure of these three tetraphenylborate salts (Cs,K,NaTPB), the tetraphenylborate ion dominates the size of the crystals. Also, note that the three crystals have nearly identical structures with the exception of two additional peaks in the cesium pattern. Given these similarities, TPB precipitation in the presence of Na + , Cs + and K + likely produces an impure isomorphic crystalline mixture of CsTPB, KTPB and NaTPB. The authors speculate that the primary crystalline structure resembles that of KTPB with NaTPB and CsTPB mixed throughout the crystal structure. The precipitation of NaTPB makes some of the anticipated excess tetraphenylborate relatively unavailable for precipitation of cesium. Thus, the amount of excess tetraphenylborate required to completely precipitate all of the potassium and cesium may increase significantly

  20. Strontium-90 and cesium-137 in sea sediments (from May 1984 to Sep 1984)


    Strontium-90 and cesium-137 monitoring results are presented for sea sediment samples of 12 sampling points located all over Japan from Tomari, Hokkaido to Kinnakagusuku Bay, Okinawa. The samples were collected by considering of enough sea water depth, no significant sedimental movement and sediment characteristics, and by employing a conventional sampling device. Approximately 4 kg-wet sample was dried and was passed through a 20 cm mesh sieve. After adding of strontium and cesium carriers, strontium-90 and cesium-137 were leached with a hot hydrochloric acid solution. The leachate was treated by ion exchange and coprecipitation to concentrate and isolate strontium-90 or cesium-137. Radiation counting was carried out by employing a low background beta counter usually for 60 minutes for the samples of strontium carbonate or cesium chloroplatinate. Determined strontium-90 contents in sea sediment were distributed from 0 +- 2.7 pCi/kg-dry (Mutsu Bay, Aomori, Yamaguchi Bay, Yamaguchi) to 14 +- 3.2 pCi/kg-dry (Mutsu Bay), and those of cesium-137 were from 9 +- 3.5 pCi/kg-dry (Mutsu Bay) to 250 +- 9 pCi/kg-dry (Off-Niigata Port, Niigata). Local variation of the contents of these radionuclides was very large, and for seasonal variation, it was also found large for the both nuclides content in the Mutsu Bay samples of May, 1984 and August 1984, as for strontium-90, 0 +- 2.7 pCi/kg and 14 +- 3.2 pCi/kg, for cesium-137, 9 +- 3.5 pCi/kg and 200 +- 8 pCi/kg, respectively. (Takagi, S.)

  1. Improvement of cesium retention in uranium dioxide by additional phases; Amelioration de la retention du cesium dans le dioxyde d`uranium au moyen de phases exogenes

    Gamaury Dubois, S


    The objective of this study is to improve the cesium retention in nuclear fuel. A bibliographic survey indicates that cesium is rapidly released from uranium dioxide in an accident condition. At temperatures higher than 1500 deg C or in oxidising conditions, our experiments show the difficulty of maintaining cesium inside simulated fuel. Two ternary systems are potentially interesting for the retention of cesium and to reduce the kinetics of release from the fuel: Cs{sub 2}O-Al{sub 2}O{sub 3}-SiO{sub 2} et Cs{sub 2}O-ZrO{sub 2}-SO{sub 2}. The compounds CsAISi{sub 2}O{sub 6} and Cs{sub 2}ZrSi{sub 6}O{sub 15} were studied from 1200 deg C to 2000 deg C by thermogravimetric analysis. The volumetric diffusion coefficients of cesium in these structures, in solid state as well as in liquid one, were measured. A fuel was sintered with (Al{sub 2}O{sub 3} + SiO{sub 2}) or (ZrO{sub 2} + SiO{sub 2}) and the intergranular phase was characterized. In the presence of (Al{sub 2}O{sub 3} + SiO{sub 2}), the sintering is realized at 1610 deg C in H{sub 2}. It is a liquid phase sintering. On the other end, with (ZrO{sub 2} + SiO{sub 2}), the sintering is a low temperature one in oxidising atmosphere. Finally, cesium containing simulated fuels were produced with these additives. According to the effective diffusion coefficients that were measured, the additives improved the retention of cesium. We have predicted the improvement that could be hoped for in a nuclear reactor, depending on the dispersion of the intergranular additives, the temperature and the degree of oxidation of the UO{sub 2+x}. We wait for a factor of 2 for x=0 and more than 8 for x=0.05, up to 2000 deg C. (author). 148 refs., 122 figs., 34 tabs.

  2. Slow hot carrier cooling in cesium lead iodide perovskites

    Shen, Qing; Ripolles, Teresa S.; Even, Jacky; Ogomi, Yuhei; Nishinaka, Koji; Izuishi, Takuya; Nakazawa, Naoki; Zhang, Yaohong; Ding, Chao; Liu, Feng; Toyoda, Taro; Yoshino, Kenji; Minemoto, Takashi; Katayama, Kenji; Hayase, Shuzi


    Lead halide perovskites are attracting a great deal of interest for optoelectronic applications such as solar cells, LEDs, and lasers because of their unique properties. In solar cells, heat dissipation by hot carriers results in a major energy loss channel responsible for the Shockley-Queisser efficiency limit. Hot carrier solar cells offer the possibility to overcome this limit and achieve energy conversion efficiency as high as 66% by extracting hot carriers. Therefore, fundamental studies on hot carrier relaxation dynamics in lead halide perovskites are important. Here, we elucidated the hot carrier cooling dynamics in all-inorganic cesium lead iodide (CsPbI3) perovskite using transient absorption spectroscopy. We observe that the hot carrier cooling rate in CsPbI3 decreases as the fluence of the pump light increases and the cooling is as slow as a few 10 ps when the photoexcited carrier density is 7 × 1018 cm-3, which is attributed to phonon bottleneck for high photoexcited carrier densities. Our findings suggest that CsPbI3 has a potential for hot carrier solar cell applications.

  3. ATLAS tile calorimeter cesium calibration control and analysis software

    Solovyanov, O; Solodkov, A; Starchenko, E; Karyukhin, A; Isaev, A; Shalanda, N


    An online control system to calibrate and monitor ATLAS Barrel hadronic calorimeter (TileCal) with a movable radioactive source, driven by liquid flow, is described. To read out and control the system an online software has been developed, using ATLAS TDAQ components like DVS (Diagnostic and Verification System) to verify the hardware before running, IS (Information Server) for data and status exchange between networked computers, and other components like DDC (DCS to DAQ Connection), to connect to PVSS-based slow control systems of Tile Calorimeter, high voltage and low voltage. A system of scripting facilities, based on Python language, is used to handle all the calibration and monitoring processes from hardware perspective to final data storage, including various abnormal situations. A QT based graphical user interface to display the status of the calibration system during the cesium source scan is described. The software for analysis of the detector response, using online data, is discussed. Performance of the system and first experience from the ATLAS pit are presented

  4. Primary standardization of cesium-137 for international intercomparison

    Srivastava, P.K.


    Primary standards of cesium-137 are of great importance for precise radiation measurements because, due to its simple decay-scheme and long half-life, it is widely used for the calibration of radiation detectors. Also 137 Cs is used for the measurement of fission-yield and uranium burn-up in reactor engineering studies. In view of these, an international intercomparison was organised on a limited scale to correlate the standards established at the Bhabha Atomic Research Centre (BARC), Bombay(India) and Physikalisch-Technische Bundesanstalt (PTB), West Germany. The ''efficiency tracing technique'' was developed at BARC for the primary standardization of 137 Cs for this intercomparison. Two tracers, namely 82 Br and 60 Co, were employed to trace the beta efficiency of the 4 πβ-γ coincidence counting system. It is shown that this technique offers high accuracy and inherent reliability. The ''tracing-technique'' for 137 Cs standardization is briefly described. The gravimetric method of dilution and preparation of mixed sources of 137 Cs - 82 Br and 137 Cs - 60 Co are given. The various counting parameters and settings are included. Data reduction and the estimation of systematic and statistical errors are discussed. The results of the intercomparison, which are also included, show that the agreement between the measurments of BARC and PTB is within 0.5%. (author)

  5. Proton tunneling in low dimensional cesium silicate LDS-1

    Matsui, Hiroshi; Iwamoto, Kei; Mochizuki, Dai; Osada, Shimon; Asakura, Yusuke; Kuroda, Kazuyuki


    In low dimensional cesium silicate LDS-1 (monoclinic phase of CsHSi2O5), anomalous infrared absorption bands observed at 93, 155, 1210, and 1220 cm-1 are assigned to the vibrational mode of protons, which contribute to the strong hydrogen bonding between terminal oxygen atoms of silicate chain (O-O distance = 2.45 Å). The integrated absorbance (oscillator strength) for those modes is drastically enhanced at low temperatures. The analysis of integrated absorbance employing two different anharmonic double-minimum potentials makes clear that proton tunneling through the potential barrier yields an energy splitting of the ground state. The absorption bands at 93 and 155 cm-1, which correspond to the different vibrational modes of protons, are attributed to the optical transition between the splitting levels (excitation from the ground state (n = 0) to the first excited state (n = 1)). Moreover, the absorption bands at 1210 and 1220 cm-1 are identified as the optical transition from the ground state (n = 0) to the third excited state (n = 3). Weak Coulomb interactions in between the adjacent protons generate two types of vibrational modes: symmetric mode (93 and 1210 cm-1) and asymmetric mode (155 and 1220 cm-1). The broad absorption at 100-600 cm-1 reveals an emergence of collective mode due to the vibration of silicate chain coupled not only with the local oscillation of Cs+ but also with the proton oscillation relevant to the second excited state (n = 2).

  6. Cesium immobilization in (Ba,Cr)-hollandites: Effects on structure

    Tumurugoti, Priyatham; Sundaram, S. K.; Misture, Scott T.


    Hollandites with compositions Ba1.15-xCs2xCr2.3Ti5.7O16 (0 ≤ x ≤ 1.15) intended for the immobilization of cesium (Cs) from nuclear waste have been prepared, characterized, and analyzed for Cs retention properties. Sol-gel synthesized powders were used for structural characterization using a combination of X-ray, neutron, and electron diffraction techniques. Phase-pure hollandites adopting tetragonal (I4/m) or monoclinic symmetry (I2/m) were observed to form in the compositional range 0 ≤ x ≤ 0.4. Structural models for the compositions, x = 0, 0.15, and 0.25 were developed from Rietveld analysis of powder diffraction data. Refined anisotropic displacement parameters (βij) for the Ba and Cs ions in the hollandite tunnels indicate local disorder of Ba/Cs along the tunnel direction. In addition, weak superlattice reflections were observed in X-ray and electron diffraction patterns that were due to the compositional modulation i.e., ordering of ions and vacancies along tunnel direction. Our overall observations suggest the phase-pure hollandites studied assumed supercell structures with ordered tunnel cations, which in turn have positional disorder in individual supercells.

  7. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)



    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  8. Sorption Coefficients for Iodine, Silver, and Cesium on Dust Particles

    Stempniewicz, M.M.; Goede, P.


    This paper describes the work performed to find relevant experimental data and find the sorption coefficients that represent well the available data for cesium, iodine, and silver on dust particles. The purpose of this work is to generate a set of coefficients that may be recommended for the computer code users. The work was performed using the computer code SPECTRA. Calculations were performed for the following data: • I-131 on AVR dust; • Ag-110m on AVR dust; • Cs-13 and Cs-137 on AVR dust. Available data was matched using the SPECTRA Sorption Model. S = A(T) · C_V-B(T) · C_d. The results are summarized as follows: • The available data can be correlated. The data scatter is about 4 orders of magnitude. Therefore the coefficients of the Langmuir isotherms vary by 4 orders of magnitude. • Sorption rates are higher at low temperatures and lower at high temperatures. This tendency has been observed in the data compiled at Oak Ridge. It is therefore surmised that the highest value of the sorption coefficients are appropriate for the low temperatures and the lowest value of the sorption coefficients are appropriate for the high temperatures. The recommended sorption coefficients are presented in this paper. • The present set of coefficients is very rough and should be a subject for future verification against experimental data. (author)

  9. ATLAS tile calorimeter cesium calibration control and analysis software

    Solovyanov, O; Solodkov, A; Starchenko, E; Karyukhin, A; Isaev, A; Shalanda, N [Institute for High Energy Physics, Protvino 142281 (Russian Federation)], E-mail:


    An online control system to calibrate and monitor ATLAS Barrel hadronic calorimeter (TileCal) with a movable radioactive source, driven by liquid flow, is described. To read out and control the system an online software has been developed, using ATLAS TDAQ components like DVS (Diagnostic and Verification System) to verify the hardware before running, IS (Information Server) for data and status exchange between networked computers, and other components like DDC (DCS to DAQ Connection), to connect to PVSS-based slow control systems of Tile Calorimeter, high voltage and low voltage. A system of scripting facilities, based on Python language, is used to handle all the calibration and monitoring processes from hardware perspective to final data storage, including various abnormal situations. A QT based graphical user interface to display the status of the calibration system during the cesium source scan is described. The software for analysis of the detector response, using online data, is discussed. Performance of the system and first experience from the ATLAS pit are presented.

  10. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)


    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department's mission as stated in that document. ''The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.''

  11. Thermal Analysis of Lampung Zeolite as Ion Cesium Replacement

    Aslina-Br-Ginting; Dian-Anggraini; Arif-Nugroho


    Zeolite have the cation can move freely and as exchangeable partly or totally with other cations. Therefore, it can serve the purpose of ion exchanger very selectively to ion cesium which is present in fuel waste. In this research analysis of pore surface area, radius pore, and adsorption have been done. After the characters of Lampung zeolite is known and then analysis of cation exchange capacity (CEC) toward ion 137 Cs is conducted, analysis of Lampung zeolite adsorption to ion 137 Cs in waste of fissile product and in research waste is subsequently done. Result of analysis show Lampung zeolite has surface area of 10,0478 m 2 , specific surface area of 47,0841 m 2 /g, pore radius of 19,3020 o A and adsorption of 24,500 cc/g. For application as a ion exchange, Lampung zeolite can adsorb ion 137 Cs reaching maximum at concentration of CsCl 0,5 N with the contact time 1 day and the optimum KTK value is 0,8360 m eq/g. While Lampung zeolite is able to adsorb 86,4 % ion Cs in waste of fission product. (author)

  12. Removal of cesium from simulated liquid waste with countercurrent two-stage adsorption followed by microfiltration

    Han, Fei; Zhang, Guang-Hui [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China); Gu, Ping, E-mail: [School of Environmental Science and Engineering, Tianjin University, Tianjin, 300072 (China)


    Highlights: Black-Right-Pointing-Pointer The adsorption isotherm of cesium by copper ferrocyanide followed a Freundlich model. Black-Right-Pointing-Pointer Decontamination factor of cesium was higher in lab-scale test than that in jar test. Black-Right-Pointing-Pointer A countercurrent two-stage adsorption-microfiltration process was achieved. Black-Right-Pointing-Pointer Cesium concentration in the effluent could be calculated. Black-Right-Pointing-Pointer It is a new cesium removal process with a higher decontamination factor. - Abstract: Copper ferrocyanide (CuFC) was used as an adsorbent to remove cesium. Jar test results showed that the adsorption capacity of CuFC was better than that of potassium zinc hexacyanoferrate. Lab-scale tests were performed by an adsorption-microfiltration process, and the mean decontamination factor (DF) was 463 when the initial cesium concentration was 101.3 {mu}g/L, the dosage of CuFC was 40 mg/L and the adsorption time was 20 min. The cesium concentration in the effluent continuously decreased with the operation time, which indicated that the used adsorbent retained its adsorption capacity. To use this capacity, experiments on a countercurrent two-stage adsorption (CTA)-microfiltration (MF) process were carried out with CuFC adsorption combined with membrane separation. A calculation method for determining the cesium concentration in the effluent was given, and batch tests in a pressure cup were performed to verify the calculated method. The results showed that the experimental values fitted well with the calculated values in the CTA-MF process. The mean DF was 1123 when the dilution factor was 0.4, the initial cesium concentration was 98.75 {mu}g/L and the dosage of CuFC and adsorption time were the same as those used in the lab-scale test. The DF obtained by CTA-MF process was more than three times higher than the single-stage adsorption in the jar test.

  13. Development program for magnetically assisted chemical separation: Evaluation of cesium removal from Hanford tank supernatant

    Nunez, L.; Buchholz, B.A.; Ziemer, M.; Dyrkacz, G.; Kaminski, M.; Vandegrift, G.F.; Atkins, K.J.; Bos, F.M.; Elder, G.R.; Swift, C.A.


    Magnetic particles (MAG*SEP SM ) coated with various absorbents were evaluated for the separation and recovery of low concentrations of cesium from nuclear waste solutions. The MAG*SEP SM particles were coated with (1) clinoptilolite, (2) transylvanian volcanic tuff, (3) resorcinol formaldehyde, and (4) crystalline silico-titanate, and then were contacted with a Hanford supernatant simulant. Particles coated with the crystalline silico-titanate were identified by Bradtec as having the highest capacity for cesium removal under the conditions tested (variation of pH, ionic strength, cesium concentration, and absorbent/solution ratio). The MAG*SEP SM particles coated with resorcinol formaldehyde had high distribution ratios values and could also be used to remove cesium from Hanford supernant simulant. Gamma irradiation studies were performed on the MAG*SEP SM particles with a gamma dose equivalent to 100 cycles of use. This irradiation decreased the loading capacity and distribution ratios for the particles by greater than 75%. The particles demonstrated high sensitivity to radiolytic damage due to the degradation of the polymeric regions. These results were supported by optical microscopy measurements. Overall, use of magnetic particles for cesium separation under nuclear waste conditions was found to be marginally effective

  14. Strontium-90 and cesium-137 in sea water (from Jul 1984 to Sep 1984)


    Monitoring results are presented on strontium-90 and cesium-137 contents in sea water of 11 sampling points all over Japan from Hokkaido to Okinawa coast. Sampling points were selected by the criterion that the effect of terrestrial fresh water and atmospheric precipitation was expected to be ignorable. Sample collection was carried out in the Period from July to September, 1984. With a special care for prevention of any contamination. The collected sea water samples were acidified immediately and they were served for radiochemical separation and purification of strontium-90 and cesium-137. Radiation counting was made for yttrium-90 hydroxide sample and cesium chloroplatinate sample with a low background beta counter normally for 60 minutes. As for strontium-90 contents in sea water, they were ranged from 0.07 +- 0.010 pCi/l (Mutsu Bay, Aomori) to 0.11 +- 0.012 pCi/l (Off Niigata Port, Niigata) and the average value was 0.09 pCi/l. As for cesium-137 contents, they were ranged from 0.08 +- 0.011 pCi/l (Ise Bay, Aichi) to 0.14 +- 0.012 pCi/l (Yamaguchi Bay, Yamaguchi) and the average value was 0.106 pCi/l. It is clarified that no abnormal values were determined for strontium-90 or cesium-137 contents in coastal sea water around Japan from a fallout origin. (Takagi, S.)

  15. Preparation of Modified Kaolin Filler with Cesium and Its Application in Security Paper

    Houssni El-Saied


    Full Text Available In this study, cesium was added intentionally during paper manufacture for protecting the papers against forgery and counterfeiting by sorbing cesium ions (Cs+ on kaolin, used as special filler in papermaking. The sorption of cesium from aqueous solution by kaolin was studied as a function of pH, shaking time, cesium initial concentration, and mass of kaolin using batch technique. The results showed that a solution containing 10 mg/L Cs+ and 250 mg of kaolin at pH 6 can be used to modify the kaolin. Paper handsheets were prepared containing various percentages of the modified kaolin. The mechanical and optical properties of paper handsheets were studied. The prepared paper handsheets were irradiated by gamma irradiation using different doses. Fourier transform infrared (FTIR spectroscopy was used to study the effect of kaolin modification by cesium and gamma irradiation on paper handsheets properties. The results indicated that modified kaolin enhanced the mechanical and optical properties of paper handsheets. Electron spin resonance (ESR spectroscopy and laser-induced breakdown spectroscopy (LIBS were also used. They provided rapid, sensitive and nondestructive techniques in differentiating between different questioned documents. This study presents a new concept in manufacturing security papers and anticounterfeiting applications.

  16. Hybrid micro-particles as a magnetically-guidable decontaminant for cesium-eluted ash slurry

    Namiki, Yoshihisa; Ueyama, Toshihiko; Yoshida, Takayuki; Watanabe, Ryoei; Koido, Shigeo; Namiki, Tamami


    Decontamination of the radioactive cesium that is widely dispersed owing to a nuclear power station accident and concentrated in fly ash requires an effective elimination system. Radioactive fly ash contains large amounts of water-soluble cesium that can cause severe secondary contamination and represents a serious health risk, yet its complete removal is complicated and difficult. Here it is shown that a new fine-powder formulation can be magnetically guided to eliminate cesium after being mixed with the ash slurry. This formulation, termed MagCE, consists of a ferromagnetic porous structure and alkaline- and salt-resistant nickel ferrocyanide. It has potent cesium-adsorption- and magnetic-separation-properties. Because of its resistance against physical and chemical attack such as with ash particles, as well as with the high pH and salt concentration of the ash slurry, MagCE simplifies the decontamination process without the need of the continued presence of the hazardous water-soluble cesium in the treated ash.

  17. Measurement of cesium and mercury emissions from the vitrification of simulated high level radioactive waste

    Zamecnik, J.R.


    In the Defense Waste Processing Facility at the Savannah River Site, it is desired to measure non-radioactive cesium in the offgas system from the glass melter. From a pilot scale melter system, offgas particulate samples were taken on filter paper media and analyzed by Inductively Coupled Plasma-Mass Spectrometry (ICP-MS). The ICP-MS method proved to be sufficiently sensitive to measure cesium quantities as low as 0.135 μg, with the sensitivity being limited by the background cesium present in the filter paper. This sensitivity allowed determination of cesium decontamination factors for four of the five major components of the offgas system. In addition, total particulate measurements were also made. Measurements of mercury decontamination factors were made on the same equipment; the results indicate that most of the mercury in the offgas system probably exists as elemental mercury and HgCl 2 , with some HgO and Hg 2 Cl 2 . The decontamination factors determined for cesium, total particulate, and mercury all compared favorably with the design values

  18. Local mat-forming cyanobacteria effectively facilitate decontamination of radioactive cesium in rice fields

    Yamamoto, Atsushi; Yoshida, Shigeru; Okumura, Hiroshi; Inagaki, Masayo; Yamanishi, Hirokuni; Ito, Tetsuo; Furukawa, Michio


    The most effective and widespread method to decontaminate radioactive cesium from the Fukushima Daiichi Nuclear Power Plant Disaster was peeling topsoil. But the method had problems, such as large amounts of discarded soil and large-scale work. In nature, cyanobacteria formed biomats on the ground surface and facilitated peeling topsoil when the biomats dried. The cyanobacteria-facilitating peeling decontamination method utilized these cyanobacterial properties. Cyanobacteria are located all over Japan and 'local' cyanobacteria could be used for decontamination without introducing new species. Utilizing cyanobacteria could decrease the amount of discarded soil to about 30% and downsize the execution-scale to individual locations. Cyanobacterial biomats were easily cultivated, especially in rice fields, by maintaining wet conditions and exposure to 100 - 83% solar radiation. Shading by a thin net was helpful in maintaining an environment suitable for cyanobacteria. Nowadays, to prevent uptake of radioactive cesium into rice, K + is usually added to fertilizer in rice fields. The K + fertilization in rice fields might also enhance cyanobacterial capture of radioactive cesium, because high concentrations of K + enhanced cyanobacterial uptake of Cs + . Cyanobacteria could also mitigate the risk of radioactive cesium moving away from a decontaminating rice field. Therefore, the cyanobacteria-facilitating peeling decontamination method was proposed as an easy and safe 'D.I.Y.' method for both farmers and the environment. Besides, plowing rice fields with water before peeling improved the efficiency of this method, because plowing increased the radioactive cesium concentration in the topsoil. (author)

  19. Efficiency of fly ash belite cement and zeolite matrices for immobilizing cesium

    Goni, S.; Guerrero, A.; Lorenzo, M.P.


    The efficiency of innovative matrices for immobilizing cesium is presented in this work. The matrix formulation included the use of fly ash belite cement (FABC-2-W) and gismondine-type Na-P1 zeolite, both of which are synthesized from fly ash of coal combustion. The efficiency for immobilizing cesium is evaluated from the leaching test ANSI/ANS 16.1-1986 at the temperature of 40 deg. C, from which the apparent diffusion coefficient of cesium is obtained. Matrices with 100% of FABC-2-W are used as a reference. The integrity of matrices is evaluated by porosity and pore-size distribution from mercury intrusion porosimetry, X-ray diffraction and nitrogen adsorption analyses. Both matrices can be classified as good solidify systems for cesium, specially the FABC-2-W/zeolite matrix in which the replacement of 50% of belite cement by the gismondine-type Na-P1 zeolite caused a decrease of two orders of magnitude of cesium mean Effective Diffusion Coefficient (D e ) (2.8e-09 cm 2 /s versus 2.2e-07 cm 2 /s, for FABC-2-W/zeolite and FABC-2-W matrices, respectively)

  20. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences; Localisation moleculaire de l'americium, du technetium et du cesium chez des animaux marins comestibles leur comportement metabolique et ses consequences

    Pieri, J; Goudard, F; Milcent, M C [Laboratoire de Biochimie et Radiochimie, Faculte des Sciences et des Techniques, Nantes Cedex (France)


    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  1. Cesium-137 in soil texture fractions and its impact on Cesium-137 soil-to-plant transfer

    Gerzabek, M.H.; Mohamad, S.A.; Mueck, K.


    Field studies at two sites contaminated by the Chernobyl fallout showed 137 Cesium (Cs) soil-to-plant transfer factors in wheat, rye and potato. Transfer values ranged from 0.0017 (potato tuber) to 0.07 (wheat straw). Generally transfer coefficients in cereal grains and potato tubers were significantly below the values of the shoots. A comparison of the two sites led to the conclusion that for all plants investigated 137 Cs transfer factors were higher in Lower Austria (Calcic Chernozem) than in Upper Austria (Eutric Cambisol). The specific activities of the texture fractions of the two soil types increased from sand to silt and clay. In the Calcic Chernozem the ratio of the 137 Cs activity in the silt fraction to the total activity in the soil was considerably higher than in the Eutric Cambisol. At the same time extractability of 137 Cs from the silt fraction of the latter soil was clearly lower. Both results mainly were attributed to the differences between the soils according to the organic matter content of the silt fractions, the Calcic Chernozem being seven times higher. Therefore, the differences in the 137 Cs-soil-to-plant transfer can be attributed partly to these soil characteristics. (authors)

  2. Sympathetic cooling in a rubidium cesium mixture: Production of ultracold cesium atoms; Sympathetisches Kuehlen in einer Rubidium-Caesium-Mischung: Erzeugung ultrakalter Caesiumatome

    Haas, M.


    This thesis presents experiments for the production of ultracold rubidium cesium mixture in a magnetic trap. The long-termed aim of the experiment is the study of the interaction of few cesium atoms with a Bose-Einstein condensate of rubidium atoms. Especially by controlled variation of the cesium atom number the transition in the description of the interaction by concepts of the one-particle physics to the description by concepts of the many-particle physics shall be studied. The rubidium atoms are trapped in a magneto-optical trap (MOT) and from there reloaded into a magnetic trap. In this the rubidium atoms are stored in the state vertical stroke f=2,m{sub f}=2 right angle of the electronic ground state and evaporatively cooled by means of microwave-induced transitions into the state vertical stroke f=1,m{sub f}=1] (microwave cooling). The cesium atoms are also trppaed in a MOT and into the same magnetic trap reloaded, in which they are stored in the state vertical stroke f=4,m{sub f}=4 right angle of the electronic ground state together with rubidium. Because of the different hyperfine splitting only rubidium is evaporatively cooled, while cesium is cooled jointly sympathetically - i.e. by theramal contact via elastic collisions with rubidium atoms. The first two chapters contain a description of interatomic interactions in ultracold gases as well as a short summary of theoretical concepts in the description of Bose-Einstein condensates. The chapters 3 and 4 contain a short presentation of the methods applied in the experiment for the production of ultracold gases as well as the experimental arrangement; especially in the framework of this thesis a new coil system has been designed, which offers in view of future experiments additionally optical access for an optical trap. Additionally the fourth chapter contains an extensive description of the experimental cycle, which is applied in order to store rubidium and cesium atoms together into the magnetic trap. The

  3. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences

    Pieri, J.; Goudard, F.; Milcent, M.C.


    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  4. Modeling the fate transport of cesium in crushed granite

    Lee, C.B.; Kuo, Y.M.; Hsu, C.N.; Li, M.H.; Cheng, H.P.; Teng, S.P.


    Full text of publication follows: In order to assess the safety of a underground radwaste repository, reactive transport models suitable for evaluating the fate and transport of radionuclides need to be established based on experimental observation and analysis. The goal of this study is to construct adequate models simulating the reactive transport of cesium (Cs) in crushed granite through a systematic analysis, where synthetic groundwater (SGW) and synthetic seawater (SSW) were employed as the liquid phase. To build such models, this study applied N 2 -BET, x-ray diffraction (XRD), polar-microscopy/ auto-radiography, and solid-phase digestion for the analysis of granite, kinetic batch tests for the characterization of sorption/desorption of Cs, and multi-stage advection-dispersion column tests for the determination of major transport processes and the calibration/validation of hypothesized reactive transport models. Based on the results of solid phase analysis and batch tests, a two-site Langmuir kinetic model has been determined capable of appropriately describing Cs sorption/desorption under test conditions. From the results of non-reactive HTO column tests, a mobile/immobile transport model was proposed to capture the major transport processes in our column system. However, the combination of the two-site Langmuir model and the mobile/immobile transport model failed to provide numerical breakthrough curves matching the Cs experimental breakthroughs. It implied that our model needs to be further refined. To achieve this, the setup of our column test needs to be modified first to reduce the volume of column connecting space, so that the effect of extra diffusion/dispersion on breakthroughs would be minimized and major transport characteristics can be clearly revealed. Moreover, more investigations on the reaction mechanisms and transport processes of the reactive transport system must be conducted. (authors)

  5. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    Klein, M.; Weyers, C.; Goossens, W.R.A.


    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103 Ru, 134 Cs and 124 Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10 -3 to 5.10 -5 % of the Ru fed, for Cs the corresponding release fraction ranges between 3.10 -3 to 10 -4 % and for Sb the release fraction ranges between 1.7 10 -4 to 1.7 10 -5 %. The same experiments were performed at a throughput of 1 to 2 1 h -1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103 Ru and 134 Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  6. 3D Planetary Data Visualization with CesiumJS

    Larsen, K. W.; DeWolfe, A. W.; Nguyen, D.; Sanchez, F.; Lindholm, D. M.


    Complex spacecraft orbits and multi-instrument observations can be challenging to visualize with traditional 2D plots. To facilitate the exploration of planetary science data, we have developed a set of web-based interactive 3D visualizations for the MAVEN and MMS missions using the free CesiumJS library. The Mars Atmospheric and Volatile Evolution (MAVEN) mission has been collecting data at Mars since September 2014. The MAVEN3D project allows playback of one day's orbit at a time, displaying the spacecraft's position and orientation. Selected science data sets can be overplotted on the orbit track, including vectors for magnetic field and ion flow velocities. We also provide an overlay the M-GITM model on the planet itself. MAVEN3D is available at the MAVEN public website at: The Magnetospheric MultiScale Mission (MMS) consists of one hundred instruments on four spacecraft flying in formation around Earth, investigating the interactions between the solar wind and Earth's magnetic field. While the highest temporal resolution data isn't received and processed until later, continuous daily observations of the particle and field environments are made available as soon as they are received. Traditional `quick-look' static plots have long been the first interaction with data from a mission of this nature. Our new 3D Quicklook viewer allows data from all four spacecraft to be viewed in an interactive web application as soon as the data is ingested into the MMS Science Data Center, less than one day after collection, in order to better help identify scientifically interesting data.

  7. Strontium-90 and cesium-137 in freshwater (from Sept. 1983 to Dec. 1983)


    Fresh water, 100 l each, was collected, and to which the carriers of strontium and cesium were added immediately after the sampling. The sample was vigorously stirred and filtered, and passed through a cation exchange column. Strontium and cesium were eluted with hydrochloric acid from the cation exchange column. The eluate was used for radiochemical analysis. The chemical separation of strontium-90 and cesium-137 was carried out, and the chemical yields were determined. The precipitates were counted for the activity using low background beta counters normally for 60 min. The net sample counting rate was corrected for the counter efficiency, recovery, self-absorption and decay, to obtain the radioactivity per sample aliquot, and the concentrations of these nuclides in the original samples were calculated. The data at six sampling locations in Japan from September to December, 1983, on fresh water are reported. (Kako, I.)

  8. Studies of cesium and strontium migration in unconsolidated Canadian geological materials

    Gillham, R.W.; Lindsay, L.E.; Reynolds, W.D.; Kewen, T.J.; Cherry, J.A.; Reddy, M.R.


    Distribution coefficients (Ksub(d)) were measured for cesium and strontium in 16 samples of Canadian unconsolidated geological materials. The samples were collected to cover a wide range of grain size, clay-mineral composition, cation exchange capacity and carbonate mineral content. Distribution coefficients ranged between 10 2 and 2.0 x 10 4 ml/g for cesium and between 2.5 and 10 2 ml/g for strontium, indicating that most unconsolidated geological materials have a substantial ability to retard the migration of cesium, while strontium could generally be expected to be somewhat more mobile. The measured K values were not significantly correlated with the measured soil properties, but appeared to be significantly affected by the background concentration of stable isotopes of the respective radionuclides

  9. Effect of K-fertilization, liming and placement on crop uptake of cesium and strontium

    Haak, E.


    remedial measures to reduce crop uptake of cesium and strontium under Swedish field conditions have been investigated in micro plot experiments. For cesium the effect of K-fertilization was studied on three soils with oats, peas and mustard and, in combination with placement, on two other soils with wheat, barley and rape. For strontium the effect of liming was studied on three soils with oats, barley and peas and, in combination with placement, on two other soils with wheat, oats, barley and peas. In this paper results are summarized for the grain products. Deep placement of nuclides in combination with K-fertilization and liming reduced the crop uptake of cesium and strontium by a factor of 10 and 4, respectively. On the basis of the experimental results, the practical advantages of K-fertilization and liming, as well as deep ploughing of surface contaminated land are discussed

  10. Reduction of cesium levels in the diet through management of food

    Gerzabek, M.H.


    Several processes influence the radionuclide concentration of food products during processing: dilution, losses, concentration. Boiling of leaf vegetables yields a decontamination effect of up to 80% in the case of radioiodine. Peeling of potato tubers results in a reduction of the cesium concentration of 30%. The cesium and strontium concentration of flour is a factor of two lower as compared to the corresponding cereal grain due to the milling process. Significant discrimination occurs during the milk processing. The skimmed milk is significantly richer in cesium, iodine and especially in strontium than the cream. It follows that butter is depleted in its radionuclide contents as compared to other milk produce. Strontium is concentrated in the casein. Pressurized cooking in combination with salting or a treatment with acetic acid results in an Cs-activity loss of beef, veal and lamb meat of 50 to 90%. (Author) 3 figs., 7 tabs., 13 refs

  11. Decontamination of Radioactive Cesium Released from Fukushima Daiichi Nuclear Power Plant - 13277

    Parajuli, Durga; Minami, Kimitaka; Tanaka, Hisashi; Kawamoto, Tohru [Nanosystem Research Institute, National Institute of Advanced Industrial Science and Technology - AIST (Japan)


    Peculiar binding of Cesium to the soil clay minerals remained the major obstacle for the immediate Cs-decontamination of soil and materials containing clay minerals like sludge. Experiments for the removal of Cesium from soil and ash samples from different materials were performed in the lab scale. For soil and sludge ash formed by the incineration of municipal sewage sludge, acid treatment at high temperature is effective while washing with water removed Cesium from ashes of plants or burnable garbage. Though total removal seems a difficult task, water-washing of wood-ash or garbage-ash at 40 deg. C removes >90% radiocesium, while >60% activity can be removed from soil and sludge-ash by acid washing at 95 deg. C. (authors)

  12. Effect of Cesium and Xenon Seeding in Negative Hydrogen Ion Sources

    Bacal, M.; Brunteau, A.M.; Deniset, C.; Elizarov, L.I.; Sube, F.; Tontegode, A.Y.; Whealton, J.H.


    It is well known that cesium seeding in volume hydrogen negative ion sources leads to a large reduction of the extracted electron current and in some cases to the enhancement of the negative ion current. The cooling of the electrons due to the addition of this heavy impurity was proposed as a possible cause of the mentioned observations. In order to verify this assumption, the authors seeded the hydrogen plasma with xenon, which has an atomic weight almost equal to that of cesium. The plasma properties were studied in the extraction region of the negative ion source Camembert III using a cylindrical electrostatic probe while the negative ion relative density was studied using laser photodetachment. It is shown that the xenon mixing does not enhance the negative ion density and leads to the increase of the electron density, while the cesium seeding reduces the electron density

  13. Use of cesium-137 to assess soil erosion rates under soybean, coffee and pasture

    Andrello, A.C.; Appoloni, C.R.; Guimaraes, M.F.


    The methodology cesium-137 was used to assess soil erosion and deposition rates in a small watershed with varied crops, at 23 deg 16' S and 51 deg 17' W, in a district of Cambe, Parana State, Brazil. A theoretical equation which considers soil loss or gain directly proportional to the cesium-137 redistribution was utilized in this study. In the watershed, soil redistribution was assessed by transect sampling, and the regional input of cesium-137 by radioactive rainfall determined based on samples from a point in the native forest. Most sampled pasture points presented soil loss, as well as the points in the soybean area under conventional tillage, while in the coffee crop there was neither soil loss nor gain. (author)

  14. Crown bridged thiacalix[4]arenes as cesium-selective ionophores in solvent polymeric membrane electrodes

    Bereczki, Robert; Csokai, Viktor; Gruen, Alajos; Bitter, Istvan; Toth, Klara


    Novel 1,3-alternate thiacalix[4]mono- and biscrown-6 ethers were studied as ionophores in poly(vinyl chloride) membrane electrodes. Their selectivity behavior was characterized with respect to large number of cations, including potential interferents in environmental samples, and the membrane composition was optimized for cesium ion response. Among the ionophores, 1,3-alternate thiacalix[4]mono(crown-6) ether showed, especially high selectivity for cesium over other alkali-metal ions. Transition and heavy metal ions did not interfere seriously with the electrode response, which indicates that the bridging sulfur atoms do not take part in the ion recognition process. The potentiometric cesium responses of all electrodes involved in this study were found close to Nernstian and the detection limits were lower than 10 -7 M. The Cs + /Na + selectivity of the different ionophore-based sensors and the solvent extraction ability of the ligands were interpreted based on the respective constants of complex formation

  15. Studies on synthesis of some composites and their uses for cesium separation

    Someda, H.H.; El-Zahhar, A.A.; Shehata, M.K.K.; El-Naggar, H.A.


    In this study some composite sorbents were prepared by supporting hexacyanoferrate complexes of some transition metals like Co, Ni, Fe and Zn on some different solid supports e.g. cellulose and other natural materials as wood powder. These composites were used for cesium sorption and showed that the highest sorption capacity is for zinc composite and the lowest is for cobalt composite. Also the factors affecting the sorption capacity like acid concentration, competing ions and cesium ion concentration were studied. The release of the sorbed cesium from the composite materials was also studied under different concentrations of different solutions like sodium nitrate, silver nitrate, ammonium nitrate and a mixture of ammonium nitrate and silver nitrate solutions

  16. Phase equilibria and critical phenomena in the cesium nitrate-water-diethylamine ternary system

    Il'in, K.K.; Kurskij, V.F.; Cherkasov, D.G.


    Phase equilibria and critical events in ternary cesium nitrate-water-diethylamine system, where border binary liquid system is characterized by aliquation with lower critical temperature of solution (LCTS), have been investigated by visual-polythermal method in the 60-150 Deg C range. Interaction of cesium nitrate in the water-diethylamine system leads to lowering of its LCTS from 146.1 to 69.3 Deg C and decrease of mutual solubility. Distribution ratios of diethylamine between water and organic phases of monotectic equilibrium are calculated at different temperatures. Diethylamine salting out from aqueous solutions by cesium nitrates becomes stronger with rising temperature. Plotted isotherms of phase confirms generalized scheme of topological transformations of ternary systems phase diagrams: salt-binary solvent with salting out

  17. Physical Property Modeling of Concentrated Cesium Eluate Solutions, Part I - Derivation of Models

    Choi, A.S.; Pierce, R. A.; Edwards, T. B.; Calloway, T. B.


    Major analytes projected to be present in the Hanford Waste Treatment Plant cesium ion-exchange eluate solutions were identified from the available analytical data collected during radioactive bench-scale runs, and a test matrix of cesium eluate solutions was designed within the bounding concentrations of those analytes. A computer model simulating the semi-batch evaporation of cesium eluate solutions was run in conjunction with a multi-electrolyte aqueous system database to calculate the physical properties of each test matrix solution concentrated to the target endpoints of 80% and 100% saturation. The calculated physical properties were analyzed statistically and fitted into mathematical expressions for the bulk solubility, density, viscosity, heat capacity and volume reduction factor as a function of temperature and concentration of each major analyte in the eluate feed. The R{sup 2} of the resulting physical property models ranged from 0.89 to 0.99.

  18. Cesium Ion Exchange Program at the Hanford River Protection Project Waste Treatment Plant



    The River Protection Project - Hanford Tank Waste Treatment and Immobilization Plant will use cesium ion exchange to remove 137Cs from Low Activity Waste down to 0.3 Ci/m3 in the Immobilized LAW, ILAW product. The project baseline for cesium ion exchange is the elutable SuperLig, R, 644, SL-644, resin registered trademark of IBC Advanced Technologies, Inc., American Fork, UT or the Department of Energy approved equivalent. SL-644 is solely available through IBC Advanced Technologies. To provide an alternative to this sole-source resin supply, the RPP--WTP initiated a three-stage process for selection and qualification of an alternative ion exchange resin for cesium removal in the RPPWTP. It was recommended that resorcinol formaldehyde RF be pursued as a potential alternative to SL-644

  19. Characterization of pollucite as a material for the long term storage of cesium-137

    Strachan, D.M.; Schulz, W.W.


    Storage of nuclear waste requires materials which are thermodynamically stable. Pollucite (Cs 2 O . Al 2 O 3 . 4SiO 2 ) may be an acceptable material for the long-term storage of the purified 137 CsCl. Pollucite is made at near theoretical yields when CsCl (or any cesium salt) reacts at about 970 0 K with a montmorillonite-containing clay. Pollucite dissolves in deionized water at rates which are less than 2 x 10 -9 kg/(m 2 . s) based on cesium. Microstructural analyses show that cesium reacts with the montmorillonite clay to form ill-defined pollucite crystals which contain low concentrations of the impurities found in the clay. Although further work needs to be done, pollucite is considered to be an excellent material for the long-term storage of 137 Cs

  20. Ab Initio investigation of cesium monoxide of CsO and CsO+

    Zialenina, M.; Kelloe, V.; Cernusak, I.


    Cesium is material with a low work function and, accordingly, atomic Cs has a low value of ionization energy. Therefore cesium is regarded as a good source material for electrons in plasma heating module. One of plasma heating technologies using Cs grid is foreseen as a candidate for the tokamak within the framework of project ITER. Among the possible impurities that can coexist in this module are CsO or CsO + , due to presence of oxygen traces in the heating chamber. We conducted CCSD(T) energy calculations of the cesium oxide (X 2 Σ + ) and its cation (X 3 Σ - ). Here are presented the bond lengths and spectroscopic parameters of both species and ionization energy (IE). Our IE (6.88 eV) is in good agreement with previous theoretical results, experiment indicates substantially lower value (6.22 eV). (authors)

  1. Use of cesium-137 methodology in the evaluation of superficial erosive processes

    Andrello, Avacir Casanova; Appoloni, Carlos Roberto; Guimaraes, Maria de Fatima; Nascimento Filho, Virgilio Franco do


    Superficial erosion is one of the main soil degradation agents and erosion rates estimations for different edaphic climate conditions for the conventional models, as USLE and RUSLE, are expensive and time-consuming. The use of cesium- 137 anthropogenic radionuclide is a new methodology that has been much studied and its application in the erosion soil evaluation has grown in countries as USA, UK, Australia and others. A brief narration of this methodology is being presented, as the development of the equations utilized for the erosion rates quantification through the cesium- 137 measurements. Two watersheds studied in Brazil have shown that the cesium- 137 methodology was practicable and coherent with the survey in field for applications in erosion studies. (author)

  2. Determination of the cesium distribution coeficient in Goiania and Abadia de Goias cities soils

    Marumo, J.T.; Suarez, A.A.


    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias's city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57 th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficient for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author) [pt

  3. Determination of the cesium distribution coefficient in Goiania and Abadia de Goias cities soils

    Marumo, J.T.; Suarez, A.A.


    In September, 1987, an unauthorized removal of a cesium-therapy unit and its violation caused an accident, where several places of Goiania's city, capital of Goias, Brazil, were contaminated. The removal of the radioactive wastes generated from decontamination process, was made to Abadia de Goias city (near Goiania), where an interim storage was constructed. Soil samples collected from the 57 th Street (Goiania) and from the interim storage permitted to determine, through static method, the cesium distribution coefficent for different cesium solution concentrations. Those results allows for some migration/retention evaluations in disposal site selection. Some soils parameters (water content, density, granulometric analysis etc) as well as clay minerals constituents were also determined. (author) [pt

  4. Cesium removal from liquid acidic wastes with the primary focus on ammonium molybdophosphate as an ion exchanger: A literature review

    Miller, C.J.


    Many articles have been written concerning the selective removal of cesium from both acidic and alkaline defense wastes. The majority of the work performed for cesium removal from defense wastes involves alkaline feed solutions. Several different techniques for cesium removal from acidic solutions have been evaluated such as precipitation, solvent extraction, and ion exchange. The purpose of this paper is to briefly review various techniques for cesium removal from acidic solutions. The main focus of the review will be on ion exchange techniques, particularly those involving ammonium molybdophosphate as the exchanger. The pertinent literature sources are condensed into a single document for quick reference. The information contained in this document was used as an aid in determining techniques to evaluate cesium removal from the acidic Idaho Chemical Processing Plant waste matrices. 47 refs., 2 tabs

  5. A distribution of adsorbed forms of cesium 137 and strontium 90 in flood-plain formations of Sozh river

    Kuznetsov, V.A.; Generalova, V.A.


    The distribution of strontium 90 and cesium 137 forms in flood-plain geochemical system 'alluvial deposits - flood-plain turf - humus horizon - soil-source rock', where sorption and colloidal processes play main role in the isotopes migration, was studied. The bulk amount of strontium 90 is presented in adsorbed form in all investigated objects, whereas only 6% of cesium 137 amount in alluvial deposits, flood-plain turf and humus horizon is in adsorbed form. The content of exchange forms of cesium 137 and strontium 90 increases with the depth of the layer. The race of this increase for strontium 90 is large than for cesium 137. The distribution of radionuclides through the different parts of flood-plain of Sozh river has some distinctions due to more lability of adsorbed strontium 90 forms in comparison with cesium 137 ones

  6. 13 CFR 113.535 - Effect of state or local law or other requirements.


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...

  7. Scintigraphy of the Placenta With {sup 113m}In

    Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)


    The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)

  8. Metabolism of 137cesium, 137barium in the rat. Therapeutics of the contamination

    Remy, J.; Philippon, A.; Lafuma, J.; Walter, C.


    The authors carry out research into the distribution kinetics, the metabolism and the excretion of 137 Cs - 137 Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors) [fr

  9. Chernobyl cesium in the soil of Montenegro, eight years after the accident

    Borisov, G. I.; Kuzmic, V. V.; Vukotic, P.; Dapcevic, S.; Antovic, N.; Mirkovic, M.; Fustic, B.


    Radioactive cesium contamination of the territory of Montenegro is measured by in situ method of semiconductor gamma-spectrometry at the end of the end of the year 1994. On basis of geological and pedological characteristics of the region, 42 measurement sites are chosen, which are representative for large area and uniformly distributed over the territory of Republic. It is found that degree of contamination varies strongly from region to region. Surface activities of 137 Cs span 3700 to 74000 Bq/m 2 range. Radioactive cesium is mostly remained in the surface part of uncultivated soil. 14 refs.; 3 figs

  10. Recent advances of numerical simulation studies for radioactive cesium adsorption on soil materials

    Okumura, Masahiko; Nakamura, Hiroki; Machida, Masahiko


    Radiocesium (Cesium 134 and 137) emitted from destroyed Fukushima Daiichi Nuclear Power Production Station is known mostly to remain for a long time on earth's surfaces and to become sources of radiation exposure to habitants. Large scale decontamination work carried out by national and local governments inevitably produces tremendous amount of radioactive wastes of soils whose volume must be effectively and economically reduced based on a scientifically reliable technique. This paper employs the atomic and molecular simulation method applied to adsorption mechanism of soils and cesium ions and presents the examples of proposals with the results of this field. (S. Ohno)

  11. Transfer of radio-cesium from forest soil to woodchips using fungal activities

    Kaneko, Nobuhiro; Huang, Yao; Tanaka, Yoichiro; Fujiwara, Yoshihiro; Sasaki, Michiko; Toda, Hiroto; Takahashi, Terumasa; Kobayashi, Tatsuaki; Harada, Naoki; Nonaka, Masahiro


    Raido-cesium released to terrestrial ecosystems by nuclear accidents is know to accumulate forest soil and organic layer on the soil. Forests in Japan are not exceptions. Practically it is impossible to decontaminate large area of forests. However, there is a strong demand from local people, who has been using secondary forests (Satoyama) around croplands in hilly areas, to decontaminate radio-cesium, because those people used to collect wild mushrooms and edible plants, and there are active cultures of mushrooms using logs and sawdusts. These natural resource uses consist substantial part of their economical activities, Therefore it is needed to decontaminate some selected part of forests in Japan to local economy. Clear cutting and scraping surface soil and organic matter are common methods of decontamination. However the efficiency of decontamination is up to 30% reduction of aerial radiation, and the cost to preserve contaminated debris is not affordable. In this study we used wood chips as a growth media for saprotrophic fungi which are known to accumulate redio-cesium. There are many studies indicated that mushrooms accumulated redio-cesium from forest soil and organic layer. It is not practical to collect mushrooms to decontaminate redio-cesium, because biomass of mushrooms are not enough to collect total contaminants. Mushrooms are only minor part of saprotrophic fungi. Fungal biomass in forest soil is about 1% of dead organic matter on forest floor. Our previous study to observe Cs accumulation to decomposing leaf litter indicated 18% absorption of total soil radio-Cs to litter during one year field incubation (Kaneko et al., 2013), and Cs concentration was proportional to fungal biomass on litter. This result indicated that fungi transferred radio-cesium around newly supplied leaf litter free of contamination. Therefore effective decontamination will be possible if we can provide large amount of growth media for saprotrophic fungi, and the media can be

  12. Fallout cesium-137 and mineral-element distribution in food chains of granitic-outcrop ecosystems

    Crossley, D.A. Jr.; Duke, K.M.; Waide, J.B.


    Fallout 137 Cs movement is described for arthropod food chains on Panola and Arabia mountains, granite monadnocks in the Georgia Piedmont region. Food chains on mountain slopes had significant 137 Cs in herbivore and predator trophic levels. Food bases were identified from observation and from cesium to potassium ratios in vegetation and arthropods. Lichens are major accumulators of fallout 137 Cs but do not appear to be important food sources for arthropods. Cesium-137 concentrations decrease in the food chains; these decreases resemble those reported for other terrestrial arthropod chains. Aspects of 137 Cs movement and nutrient-element dynamics in granitic-outcrop ecosystems are discussed

  13. Behaviour of cesium in contaminated soils with and without agricultural practices

    Arapis, G.; Martinez, A.; Millan, R.; Gutierrez, J.


    The migration of cesium into affected agricultural soils, five years after the Chernobyl accident, is examined in this study. Samples of soil were taken from an undisturbed non-cultivated rural area in the north of Greece, where an important contamination has been detected. The migration of 137 Cs into these soils was measured by γ spectrometry. Slight movement of 137 Cs was observed during the five year period following the accident. The agricultural practices, used in this area from 1986 up to now, have diluted the contamination into the 0-40 cm horizon and thus only low concentration of cesium in the cultivated soils was detected. (orig.)

  14. Psychological and mobile evaluation of intra-uterus children exposed to the radiation with cesium-137

    Ferreira, Celia Marly


    The presented work had as objective the accomplishment of a comparative study of cesium-137 radioactive element effects in the psychological and motor development of children which were going submitted the intra-uterus irradiation during the chronological age of three years. The comparison of the results of study is done through a group-control composed for five children without any involvement with the cesium-137 accident - occurred in 1987 in Goiania, Brazil - of same social, economic and cultural level and with the same age of the reached

  15. Results from annual testing of ARECO cesium capsules from 1990-1994

    Lundeen, J.E.


    The purpose of this report is to compile the results of the cesium capsule inspections and testing at the Applied Radiant Energy Corporation (ARECO) facility in Lynchburg, VA, performed in 1990, 1991, 1992, 1993, and 1994. The 25 cesium capsules at the ARECO facility were visually identified and clunk tested. A Go/No Go gauge test was required for capsules failing the clunk test. A visual inspection of capsules was required for the initial testing (1990). All 25 capsules passed the inspections and testing each year.

  16. Development of a solvent extraction process for cesium removal from SRS tank waste

    Leonard, R.A.; Conner, C.; Liberatore, M.W.; Sedlet, J.; Aase, S.B.; Vandegrift, G.F.; Delmau, L.H.; Bonnesen, P.V.; Moyer, B.A.


    An alkaline-side solvent extraction process was developed for cesium removal from Savannah River Site (SRS) tank waste. The process was invented at Oak Ridge National Laboratory and developed and tested at Argonne National Laboratory using singlestage and multistage tests in a laboratory-scale centrifugal contactor. The dispersion number, hydraulic performance, stage efficiency, and general operability of the process flowsheet were determined. Based on these tests, further solvent development work was done. The final solvent formulation appears to be an excellent candidate for removing cesium from SRS tank waste.

  17. Release of tellurium and cesium from UO2 in LWR fuel rods during irradiation

    Malen, K.A.


    In this paper the release of tellurium (Te-132) and cesium (Cs-134 and Cs-137) from UO 2 -fuel is analyzed. The basis for the analysis is the experimental results from the S176 series of experiments performed at Studsvik. It seems that the model developed earlier for release of iodine applies also to tellurium and cesium. This model assumes sweeping up of the species in question by moving grain boundaries and subsequent release through grain boundary porosity. An interesting extra feature is deposition of tellurium at temperatures in the range 1500-2000 K believed to be due to condensation. (author)

  18. Deviation from local thermodynamic equilibrium in a cesium-seeded argon plasma

    Stefanov, B.; Zarkova, L.


    The possibility of deviations from local thermodynamic equilibrium of a cesium seeded argon plasma has been analyzed. A four level model of cesium has been employed. Overpopulations of the ground state and the first excited state as well as the corresponding reduction of the electron density are calculated for cylindrical discharge structures by solving stationary rate equations. Numerical results are presented. These results indicate that in a large regime of plasma conditions the LTE assumption is valid for electron temperatures larger than 3000 K. (orig.)

  19. Separation of cesium from simulated active waste using zinc hexacyanoferrate supported composite

    Somida, H.H.; El Zahhar, A.A.; Shehata, M.K.; El Naggar, H.A.


    Potassium zinc hexacyanoferrate (KZnHCF) was prepared and supported on polyacrylonitrile (PAN) binding polymer. This composite was characterized and used to study the elimination of cesium from acidic radioactive waste containing Sr(II), Eu(II), Am(II), Zr(IV), Hf(IV) and Nb(V) using batch and column techniques. The sorption capacity of this composite for cesium was found to be 1.14 meq/g for column technique. The effect of presence of NH 4 SCN, NaNo 3 and other complexing agents in the aqueous solutions was studied

  20. Heat Transfer During Evaporation of Cesium From Graphite Surface in an Argon Environment

    Bespala Evgeny


    Full Text Available The article focuses on discussion of problem of graphite radioactive waste formation and accumulation. It is shown that irradiated nuclear graphite being inalienable part of uranium-graphite reactor may contain fission and activation products. Much attention is given to the process of formation of radioactive cesium on the graphite element surface. It is described a process of plasma decontamination of irradiated graphite in inert argon atmosphere. Quasi-one mathematical model is offered, it describes heat transfer process in graphite-cesium-argon system. Article shows results of calculation of temperature field inside the unit cell. Authors determined the factors which influence on temperature change.

  1. Distribution Coefficient Kd of Cesium in Soils from Areas in Perak

    Azian Hashim; Mohd Suhaimi Hamzah; Shamsiah Abdul Rahman; Nazaratul Ashifa Abdullah Salim; Md Suhaimi Elias; Shakirah Shukor; Muhd Azfar Azman; Siti Aminah Omar


    This is the paper reports on the study of distribution coefficient or Kd value in soil collected from the Western of Perak, which is Manjung, Setiawan, and Lahat with two different depths using lab batch method. Particle sizes were analyzed using the conventional technique known as pipette method. pH of the sample were 2-3. Determinations for cesium were performed using Inductively Coupled Plasma-Mass (ICP-MS). From the results, distribution factor for cesium, Kd value, was found to be influenced by the particle size of soil. (author)

  2. Sensitivity of cesium chemistry to the O/U radio in UO2+x

    McFarlane, J.; LeBlanc, J.C.; Owen, D.G.


    The effect of O/U ratio on chemical reactivity was investigated in a cesium-iodide/uranium/tungsten system at temperatures up to 2200 K. It was found that slight changes in the oxidation of the urania had a large effect on reactivity. Crushed fresh fuel samples showed little reaction with CsI; however, slightly hyperstoichiometric fuel showed considerable reaction. The tungsten participated in the reaction by removing excess oxygen from the urania, eventually leading to a cesium tungstate species that was analyzed by Fourier Transform Infrared (FTIR) and X-ray diffraction (XRD) techniques. (author)

  3. A preliminary deposit model for lithium-cesium-tantalum (LCT) pegmatites

    Bradley, Dwight; McCauley, Andrew


    This report is part of an effort by the U.S. Geological Survey to update existing mineral deposit models and to develop new ones. We emphasize practical aspects of pegmatite geology that might directly or indirectly help in exploration for lithium-cesium-tantalum (LCT) pegmatites, or for assessing regions for pegmatite-related mineral resource potential. These deposits are an important link in the world’s supply chain of rare and strategic elements, accounting for about one-third of world lithium production, most of the tantalum, and all of the cesium.

  4. Alkali-iodide/urania systems at high temperatures. 1. Cesium uranate chemistry

    McFarlane, J.; LeBlanc, J.C.


    Uranate compounds are likely to form in irradiated fuel from the reaction between UO 2 and fission products along UO 2 grain boundaries and in the fuel-cladding gap. Literature on the high-temperature chemistry of cesium and rubidium uranates was reviewed. Results from Knudsen cell experiments from 900 to 2600 K on cesium uranates are discussed. These studies indicate that the uranate phases formed depend on the oxygen potential of the system, which varies with the composition of the condensed phase. 62 refs., 12 figs., 6 tabs., 2 appendices

  5. Study of the removal of cesium from aqueous solutions by graphene oxide

    Bueno, Vanessa N.; Rodrigues, Debora F.; Vitta, Patricia B. Di


    Graphene oxide, used in this work, was synthesized from the oxidation of graphite by Hummer method. The experiments were performed in batch and analyzed for the following parameters: contact time, pH, cesium ion concentration in aqueous solution and removing capacity of the graphene oxide. After the experiments the samples were vacuum filtered and the remaining cesium in solution was quantified by Inductively Coupled Plasma Optical Emission Spectrometry (ICP-OES). The equilibrium was reached after 60 minutes of contact in neutral solution. The percentage of removal was around 80%

  6. 26 CFR 509.113 - Government wages, salaries, and pensions.


    ... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Government wages, salaries, and pensions. 509...) REGULATIONS UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.113 Government wages, salaries, and pensions. (a) General. Under Article XI of the convention any wage, salary, or similar compensation, or any...

  7. 9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus... REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper Vaccine... canine distemper susceptible dogs (20 vaccinates and 5 controls) shall be used as test animals. Blood...

  8. 9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis Vaccine...

  9. 9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease Vaccine...

  10. 9 CFR 113.213 - Pseudorabies Vaccine, Killed Virus.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pseudorabies Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.213 Pseudorabies Vaccine, Killed Virus. Pseudorabies Vaccine, Killed...

  11. 9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...

  12. 9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...

  13. 14 CFR 152.113 - Application requirements: Airport planning.


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Application requirements: Airport planning....113 Application requirements: Airport planning. (a) Application for Federal assistance. An eligible sponsor or planning agency that desires to obtain Federal aid for eligible airport master planning or...

  14. 9 CFR 113.328 - Fowl Laryngotracheitis Vaccine.


    ... REQUIREMENTS Live Virus Vaccines § 113.328 Fowl Laryngotracheitis Vaccine. Fowl Laryngotracheitis Vaccine shall be prepared from virus-bearing cell culture fluids or embryonated chicken eggs. Only Master Seed... each serial of modified live virus vaccine shall be tested for safety as provided in this paragraph...

  15. 9 CFR 113.30 - Detection of Salmonella contamination.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Salmonella contamination... REQUIREMENTS Standard Procedures § 113.30 Detection of Salmonella contamination. The test for detection of Salmonella contamination provided in this section shall be conducted when such a test is prescribed in an...

  16. 9 CFR 113.32 - Detection of Brucella contamination.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Brucella contamination... REQUIREMENTS Standard Procedures § 113.32 Detection of Brucella contamination. The test for detection of Brucella contamination provided in this section shall be conducted when such a test is prescribed in an...

  17. 9 CFR 113.28 - Detection of mycoplasma contamination.


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of mycoplasma contamination... REQUIREMENTS Standard Procedures § 113.28 Detection of mycoplasma contamination. The heart infusion test, using... for mycoplasma contamination is prescribed in an applicable Standard Requirement or in the filed...

  18. 20 CFR 726.113 - Disclosure of confidential information.


    ... MINE OPERATOR'S INSURANCE Authorization of Self-Insurers § 726.113 Disclosure of confidential... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Disclosure of confidential information. 726... authorized self-insurer or applicant for the authorization of self-insurance obtained by the Office shall be...

  19. 9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).


    ... REQUIREMENTS Killed Virus Vaccines § 113.214 Parvovirus Vaccine, Killed Virus (Canine). Parvovirus Vaccine... antibody against canine parvovirus to determine susceptibility. A constant virus-varying serum... vaccinates and the controls shall be challenged with virulent canine parvovirus furnished or approved by...

  20. 24 CFR 3280.113 - Glass and glazed openings.


    ... glazing material is considered to be any glazing material capable of passing the requirements of Safety... URBAN DEVELOPMENT MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS Planning Considerations § 3280.113... shall meet the requirements of § 3280.403 the “Standard for Windows and Sliding Glass Doors Used in...