
Sample records for cervus elaphus elaphus

  1. A Novel Polypeptide from Cervus elaphus Linnaeus

    Institute of Scientific and Technical Information of China (English)

    LiangWENG; QiuLiZHOU; 等


    A novel polypeptide having stimulant effect on some cell proliferation was isolated from the velvet antler (Cervus elaphus Linnaeus). The velvet antler polypeptide consists of a single chain of 32 amino acid residues. Amino acid sequence of the polypeptide was identified as:VLSAADKSNVKAAWGKVGGNAPAFGAEALLRM.

  2. Genetic structure of the Danish red deer (Cervus elaphus)

    DEFF Research Database (Denmark)



    The red deer (Cervus elaphus) population in Denmark became almost extinct in recent historical times due to over-hunting. The species has subsequently recovered within remote areas, but non-Danish individuals have been introduced at several localities. To assess genetic structure, past demographi...

  3. Lactation curves in captive Iberian red deer (Cervus elaphus hispanicus)


    García Díaz, Andrés; Landete Castillejos, Tomás; Molina Casanova, Ana María; Albiñana, Bernardo; Fernández, Carlos; Garde López-Brea, José Julián; Gallego Martínez, Laureano


    This study examines milk production and the effect of milk production and sex of calf on body weights and gains of red deer calves and hinds of the Iberian subspecies (Cervus elaphus hispanicus). Milk production was assessed in 14 hinds by weighing calves before and after suckling and by adjusting these values to the Gamma function. Gamma estimates of total milk production up to d 105 were similar to the amounts computed directly from double weighing. Hinds showed two types of lactation cu...

  4. Susceptibility of European red deer (Cervus elaphus elaphus to alimentary challenge with bovine spongiform encephalopathy.

    Directory of Open Access Journals (Sweden)

    Mark P Dagleish

    Full Text Available European red deer (Cervus elaphus elaphus are susceptible to the agent of bovine spongiform encephalopathy, one of the transmissible spongiform encephalopathies, when challenged intracerebrally but their susceptibility to alimentary challenge, the presumed natural route of transmission, is unknown. To determine this, eighteen deer were challenged via stomach tube with a large dose of the bovine spongiform encephalopathy agent and clinical signs, gross and histological lesions, presence and distribution of abnormal prion protein and the attack rate recorded. Only a single animal developed clinical disease, and this was acute with both neurological and respiratory signs, at 1726 days post challenge although there was significant (27.6% weight loss in the preceding 141 days. The clinically affected animal had histological lesions of vacuolation in the neuronal perikaryon and neuropil, typical of transmissible spongiform encephalopathies. Abnormal prion protein, the diagnostic marker of transmissible encephalopathies, was primarily restricted to the central and peripheral nervous systems although a very small amount was present in tingible body macrophages in the lymphoid patches of the caecum and colon. Serial protein misfolding cyclical amplification, an in vitro ultra-sensitive diagnostic technique, was positive for neurological tissue from the single clinically diseased deer. All other alimentary challenged deer failed to develop clinical disease and were negative for all other investigations. These findings show that transmission of bovine spongiform encephalopathy to European red deer via the alimentary route is possible but the transmission rate is low. Additionally, when deer carcases are subjected to the same regulations that ruminants in Europe with respect to the removal of specified offal from the human food chain, the zoonotic risk of bovine spongiform encephalopathy, the cause of variant Creutzfeldt-Jakob disease, from consumption of

  5. Experimental transmission of bovine spongiform encephalopathy to European red deer (Cervus elaphus elaphus

    Directory of Open Access Journals (Sweden)

    Reid Hugh W


    Full Text Available Abstract Background Bovine spongiform encephalopathy (BSE, a member of the transmissible spongiform encephalopathies (TSE, primarily affects cattle. Transmission is via concentrate feed rations contaminated with infected meat and bone meal (MBM. In addition to cattle, other food animal species are susceptible to BSE and also pose a potential threat to human health as consumption of infected meat products is the cause of variant Creutzfeldt-Jakob disease in humans, which is invariably fatal. In the UK, farmed and free ranging deer were almost certainly exposed to BSE infected MBM in proprietary feeds prior to legislation banning its inclusion. Therefore, although BSE has never been diagnosed in any deer species, a possible risk to human health remains via ingestion of cervine products. Chronic wasting disease (CWD, also a TSE, naturally infects several cervid species in North America and is spreading rapidly in both captive and free-ranging populations. Results Here we show that European red deer (Cervus elaphus elaphus are susceptible to intra-cerebral (i/c challenge with BSE positive cattle brain pool material resulting in clinical neurological disease and weight loss by 794–1290 days and the clinical signs are indistinguishable to those reported in deer with CWD. Spongiform changes typical of TSE infections were present in brain and accumulation of the disease-associated abnormal prion protein (PrPd was present in the central and peripheral nervous systems, but not in lymphoid or other tissues. Western immunoblot analysis of brain material showed a similar glycosylation pattern to that of BSE derived from infected cattle and experimentally infected sheep with respect to protease-resistant PrP isoforms. However, the di-, mono- and unglycosylated bands migrated significantly (p Conclusion This study shows that deer are susceptible to BSE by intra-cerebral inoculation and display clinical signs and vacuolar pathology that are similar to those

  6. Babesias of red deer (Cervus elaphus in Ireland

    Directory of Open Access Journals (Sweden)

    Zintl Annetta


    Full Text Available Abstract Blood samples were obtained from 38 wild red deer (Cervus elaphus at two sites in Ireland and subjected to PCR analysis of the 18S rRNA gene followed by sequencing. Two fragments of the 18S rRNA gene were generated by two different PCR protocols and subsequent sequencing suggested that at least six of the deer were infected by a babesia that, in those loci, is indistinguishable from Babesia divergens, an important tick-borne pathogen of cattle and of zoonotic significance. Additionally, a B. odocoilei-like parasite was detected in three samples and a babesia that did not match any sequences in the GenBank database was found in five samples. Neither B. capreoli nor B. venatorum (EU1 were found. There have been several reports of B. divergens occurring in deer species, including red deer, roe deer (Capreolus capreolus and reindeer (Rangifer tarandus. However, in view of recent re-sequencing of bovine-origin samples deposited previously in GenBank, it is unlikely that any of these sequences from deer are B. divergens. The present study describes the only deer piroplasm detected so far that shows complete identity with B. divergens, in just over half of the 18S rRNA gene. The entire gene of this deer parasite should be analysed and transmission experiments undertaken before the infectivity of B. divergens for red deer can be confirmed.

  7. Hybridisation and introgression of exotic Cervus (nippon and canadensis) with red deer (Cervus elaphus) in the British Isles


    Smith, Stephanie Lindsay


    Europe’s largest population of wild red deer (Cervus elaphus) resides in the British Isles and has been present since the end of the last ice age, c. 11,000BP. Since the mid-19th century, multiple introductions of Japanese sika (Cervus nippon) and wapiti (Cervus canadensis) have taken place across the British Isles. While wapiti introductions have generally gone extinct, sika have thrived and expanded and now often live in sympatry with red deer. Hybridisation between these spe...

  8. Sarcocystosis in Cervus elaphus: Comparison of diagnostic methods

    Directory of Open Access Journals (Sweden)

    Mónica Luzón


    Full Text Available Red deer (Cervus elaphus from a National Wildlife Reserve near Toledo in central Spain were surveyed for Sarcocystis infection. A total of 61 deer were examined. Tissue compression and histology were used to examine samples from diaphragm and heart from each animal included in the study, and results from the two techniques and the two tissues were compared to determine the tissue and technique that provide the most accurate measure of prevalence and intensity. Prevalence and intensity were then compared between calves, yearlings and adults. Sarcocystis was detected in 59 (97% of the 61 deer. Comparison between tissues showed that (a prevalence based on histology was similar for heart and diaphragm, (b prevalence based on compression was significantly higher for heart than for diaphragm and (c intensity was significantly higher for heart than for diaphragm, regardless of the technique used. Comparison between techniques showed that (a both techniques rendered similar prevalences and intensities of Sarcocystis infection with heart samples and (b both techniques were not comparable with diaphragm samples (compression rendered lower prevalence but higher intensity than histology. Together these data suggest that heart is the preferable tissue for estimating prevalence and intensity, regardless of the technique used. A preliminary species identification of isolated cysts from three animals showed two morph types, corresponding to Sarcocystis cervicanis (syn. S. cf. grueneri; S. wapiti in the heart and diaphragm of three animals and S. hjorti, only in the diaphragm of two animals. Given the different location of those morph types, both heart and diaphragm should be sampled and preferably assessed using histology to most reliably detect infection. Based on histology of heart, prevalence and intensity of Sarcocystis were significantly lower in calves than in yearlings or adults.

  9. Sarcocystosis in Cervus elaphus: Comparison of diagnostic methods. (United States)

    Luzón, Mónica; Domínguez-González, Julia; Soto-Carrión, Ana María; Alunda, José María; Fuente, Concepción de la


    Red deer (Cervus elaphus) from a National Wildlife Reserve near Toledo in central Spain were surveyed for Sarcocystis infection. A total of 61 deer were examined. Tissue compression and histology were used to examine samples from diaphragm and heart from each animal included in the study, and results from the two techniques and the two tissues were compared to determine the tissue and technique that provide the most accurate measure of prevalence and intensity. Prevalence and intensity were then compared between calves, yearlings and adults. Sarcocystis was detected in 59 (97%) of the 61 deer. Comparison between tissues showed that (a) prevalence based on histology was similar for heart and diaphragm, (b) prevalence based on compression was significantly higher for heart than for diaphragm and (c) intensity was significantly higher for heart than for diaphragm, regardless of the technique used. Comparison between techniques showed that (a) both techniques rendered similar prevalences and intensities of Sarcocystis infection with heart samples and (b) both techniques were not comparable with diaphragm samples (compression rendered lower prevalence but higher intensity than histology). Together these data suggest that heart is the preferable tissue for estimating prevalence and intensity, regardless of the technique used. A preliminary species identification of isolated cysts from three animals showed two morph types, corresponding to Sarcocystis cervicanis (syn. S. cf. grueneri; S. wapiti) in the heart and diaphragm of three animals and S. hjorti, only in the diaphragm of two animals. Given the different location of those morph types, both heart and diaphragm should be sampled and preferably assessed using histology to most reliably detect infection. Based on histology of heart, prevalence and intensity of Sarcocystis were significantly lower in calves than in yearlings or adults. PMID:26767167

  10. Effect of lunar phase on summer activity budgets of Rocky Mountain elk (Cervus elaphus nelsonii) (United States)

    Rocky Mountain elk (Cervus elaphus) exist in a complex biological and social environment that is marked by necessary diurnal activities such as foraging, ruminating, and resting. It has long been understood that elk demonstrate circadian rhythms. One of the most predictable variables that could af...

  11. Effect of lunar phase on diurnal activity of Rocky Mountain Elk (Cervus Elaphus Nelsonii) (United States)

    Rocky Mountain elk (Cervus elaphus nelsonii) are important components in many ecosystems across the western US and are integral with both Native American and contemporary western culture. They are prized by hunters and are the object of countless works of art. These magnificent creatures are studi...

  12. Sedici anni di censimenti del cervo sardo (Cervus elaphus corsicanus) nella riserva naturale WWF di Monte Arcosu


    Murgia, Carlo; Murgia, Andrea; Deiana, Anna Maria


    This paper describes data collected about consistence, density and social structure of Sardinian deer (Cervus elaphus corsicanus Erxleben, 1777) subspecies of European deer (Cervus elaphus Linnaeus, 1758) from 1989 to 2004. The study area is located in the WWF Faunal Park of Monte Arcosu (south-western of Sardinia). The flora of the Reserve is typical Mediterranean vegetation. The data have been collected with two different methods, using both roaring census and direct observations. Results s...

  13. Seasonal habitat selection of the red deer (Cervus elaphus alxaicus) in the Helan Mountains, China


    Mingming Zhang; Zhensheng Liu; Liwei Teng


    We studied the seasonal habitat selection of the red deer, Cervus elaphus alxaicus Bobrinskii & Flerov, 1935, in the Helan Mountains, China, from December 2007 to December 2008. Habitat selection varied widely by season. Seasonal movements between high and low elevations were attributed to changes in forage availability, alpine topography, the arid climate of the Helan Mountains, and potential competition with blue sheep, Pseudois nayaur (Hodgson, 1833). The use of vegetation types varied sea...

  14. Differential Immune Responses of Red Deer (Cervus elaphus) following Experimental Challenge with Mycobacterium avium subsp. paratuberculosis▿


    Robinson, Mark; O'Brien, Rory; Mackintosh, Colin; Griffin, Frank


    Immune responses of red deer (Cervus elaphus) that presented with different levels of paucibacillary pathology were profiled to detail immune changes during the progression of Johne's disease. Immune responses were monitored using an immunoglobulin G1 (IgG1) antibody enzyme-linked immunosorbent assay (ELISA), a gamma interferon (IFN-γ) ELISA, and flow cytometry. Animals in the study were divided into outcome groups postmortem according to disease severity. All animals mounted IgG1 antibody an...

  15. Seasonal habitat selection of the red deer (Cervus elaphus alxaicus in the Helan Mountains, China

    Directory of Open Access Journals (Sweden)

    Mingming Zhang


    Full Text Available We studied the seasonal habitat selection of the red deer, Cervus elaphus alxaicus Bobrinskii & Flerov, 1935, in the Helan Mountains, China, from December 2007 to December 2008. Habitat selection varied widely by season. Seasonal movements between high and low elevations were attributed to changes in forage availability, alpine topography, the arid climate of the Helan Mountains, and potential competition with blue sheep, Pseudois nayaur (Hodgson, 1833. The use of vegetation types varied seasonally according to food availability and ambient temperature. Red deer used montane coniferous forest and alpine shrub and meadow zones distributed above 2,000 m and 3,000 m in summer, alpine shrub and meadows above 3,000 m in autumn, being restricted to lower elevation habitats in spring and winter. The winter habitat of C. elaphus alxaicus was dominated by Ulmus glaucescens Franch. and Juglans regia Linnaeus, deciduous trees, and differed from the habitats selected by other subspecies of red deer. Cervus elaphus alxaicus preferred habitats with abundant vegetation coverage to open habitats in winter, but the reverse pattern was observed in summer and autumn. Red deer preferred gentle slopes (<10° but the use of slope gradient categories varied seasonally. Red deer avoidance of human disturbance in the Helan Mountains varied significantly by season. Information on red deer habitat selection can help understand the factors affecting seasonal movements and also support decision making in the management and conservation of red deer and their habitats.

  16. Cervus elaphus Foraging Impacts on Plants and Soils at an Ungrazed Desert Grass/Shrubland in Northwestern New Mexico, USA

    Directory of Open Access Journals (Sweden)

    Louis C. Bender


    Full Text Available We evaluated Cervus elaphus herbivory and trampling impacts on plants and soils on Chaco Culture National Historical Park (Chaco, a desert grass/shrubland in northwestern New Mexico, USA, most (63% of which has been protected from grazing by domestic livestock since 1948. We conducted grazing, browse, and water infiltration surveys in areas which received different amounts of C. elaphus use (use and control, 2004–2007. Browse utilization was <32% on monitored species and Odocoileus hemionus use accounted for the majority of browsing. Live plant cover was greater on areas receiving more C. elaphus use, and no grass species were used above recommended levels. Stubble heights of Bouteloua spp. were positively related to relative C. elaphus use on some areas, suggesting possible stimulation of grassland productivity by C. elaphus grazing. Water infiltration rates either did not differ among use or control sites or were faster in use sites, indicating no impacts of C. elaphus use on soil compaction. At current C. elaphus densities (0.2–0.4/km2, negative impacts to plants and soils were not seen on Chaco, and some evidence suggests that light grazing is optimizing desert grasslands of Chaco.

  17. Late Quaternary distribution dynamics and phylogeography of the red deer ( Cervus elaphus) in Europe (United States)

    Sommer, R. S.; Zachos, F. E.; Street, M.; Jöris, O.; Skog, A.; Benecke, N.


    Here we present spatial-temporal patterns for European late Quaternary red deer (Cervus elaphus), based on radiocarbon-supported evidence derived mainly from archaeological sites. This is followed by an overview of the recent phylogeography of this species using haplogroup studies of recent molecular data. The implications of the synthesis of palaeontological and genetic data are discussed and we propose that present day European red deer haplogroup distributions are best explained against the history of late Quaternary population contractions into and expansions from glacial refugia. Around 800 records of Cervus elaphus were assigned to the period covering the later part of the Last Glacial and the Early to Middle Holocene. Red deer becomes increasingly visible in faunal assemblages dated to late OIS-3 (<40.0 ka 14C BP). The species persisted throughout the LGM on the Iberian Peninsula, in adjacent regions of South-Western France (Gascony, Dordogne, Languedoc), on the Italian Peninsula, in the Balkans and Greece, and east of the Carpathians in Moldavia. We suggest that genetic exchange between the populations of the Balkans and the East of the Carpathians remained uninterrupted during the LGM. The expansion of red deer from its southern refugia into Central and Northern Europe begins rapidly at 12,500 14C BP. The expansion of red deer coincides with the sudden rise in temperature at the onset of Greenland Interstadial 1e and the dispersion of open birch woodland into the northern half of Europe. Radiocarbon supported records show a more or less universal distribution of Cervus elaphus across Europe following the Pleistocene/Holocene climatic change at 10.0 ka 14C BP for the first time. Molecular data and fossil record combined provide a clearer temporal and spatial pattern for the Lateglacial recolonisation process of the northern part of Europe.

  18. Complete mitochondrial genome sequence of tarim red deer (Cervus elaphus yarkandensis). (United States)

    Shao, Yuanchen; Xing, Xiumei; Zha, Daiming; Yang, Fuhe


    The complete mitochondrial genome of the tarim red deer, Cervus elaphus yarkandensis, was determined by accurate polymerase chain reaction. The entire genome was 16,351 bp in length and contained 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region, all of which were arranged in a typical vertebrate manner. The overall base composition of the northeast sika deer's mitochondrial genome was 33.3% of A, 24.4% of C, 28.9% of T and 13.4% of G. A termination-associated sequence and several conserved central sequence block domains were discovered within the control region. PMID:24438284

  19. Isolation and characterization of Babesia pecorum sp. nov. from farmed red deer (Cervus elaphus)


    Jouglin, Maggy; Fernández-de-Mera, Isabel G.; de la Cotte, Nathalie; Ruiz-Fons, Francisco; Gortázar, Christian; Moreau, Emmanuelle; Bastian, Suzanne; de la Fuente, José; Malandrin, Laurence


    The diversity of Babesia species infecting cervids in parts of central and southern Spain was analyzed by collecting blood from farmed red deer (Cervus elaphus). Babesia sp. was isolated in vitro from two red deer herds in Cádiz and Ciudad Real. The number of Babesia sp. carriers differed between the two herds: 36/77 in Cádiz and 1/35 in Ciudad Real. Hyalomma lusitanicum was the most prevalent tick species identified on the Cádiz farm vegetation and on sampled animals, and is therefore a cand...

  20. Immunohistochemical and biochemical characteristics of BSE and CWD in experimentally infected European red deer (Cervus elaphus elaphus

    Directory of Open Access Journals (Sweden)

    Dagleish Mark P


    Full Text Available Abstract Background The cause of the bovine spongiform encephalopathy (BSE epidemic in the United Kingdom (UK was the inclusion of contaminated meat and bone meal in the protein rations fed to cattle. Those rations were not restricted to cattle but were also fed to other livestock including farmed and free living deer. Although there are no reported cases to date of natural BSE in European deer, BSE has been shown to be naturally or experimentally transmissible to a wide range of different ungulate species. Moreover, several species of North America's cervids are highly susceptible to chronic wasting disease (CWD, a transmissible spongiform encephalopathy (TSE that has become endemic. Should BSE infection have been introduced into the UK deer population, the CWD precedent could suggest that there is a danger for spread and maintenance of the disease in both free living and captive UK deer populations. This study compares the immunohistochemical and biochemical characteristics of BSE and CWD in experimentally-infected European red deer (Cervus elpahus elaphus. Results After intracerebral or alimentary challenge, BSE in red deer more closely resembled natural infection in cattle rather than experimental BSE in small ruminants, due to the lack of accumulation of abnormal PrP in lymphoid tissues. In this respect it was different from CWD, and although the neuropathological features of both diseases were similar, BSE could be clearly differentiated from CWD by immunohistochemical and Western blotting methods currently in routine use. Conclusion Red deer are susceptible to both BSE and CWD infection, but the resulting disease phenotypes are distinct and clearly distinguishable.

  1. Successful low dose insemination of flow cytometrically sorted Sika (Cervus nippon) sperm in Wapiti (Cervus elaphus). (United States)

    Gao, Q H; Wei, H J; Han, C M; Du, H Z; Zhang, Z G; Zhao, W G; Zhang, Y; Li, S


    The purpose of this study was to determine a practical method in Wapiti (Cervus elaphus) of using predetermined sexed Sika (Cervus nippon) semen. Semen was collected by electro-ejaculation from one stag of proven fertility and transported to the laboratory where it was retained as unsorted (control) or was separated into X- and Y-chromosome-bearing sperm using a modified high-speed cell sorter. Wapiti hinds (n=81) were inseminated into the uterus by rectum manipulation with 1 x 10(6) (X1 and Y1 group, respectively) or 2 x 10(6) (X2 and Y2 group, respectively) of sorted frozen-thawed and 1 x 10(7) non-sorted frozen-thawed (a commercial dose control) Sika motile sperm 60-66h after removal of intra-vaginal progesterone-impregnated CIDR devices and administration of 700IU of PMSG at the time of CIDR removal. The percentage of hinds calving after insemination was similar for X1 (38.5%), X2 (41.7%), Y1 (44.4%), Y2 (38.9%) groups (P>0.05), but higher for control (75%) treatment (PSika and Wapiti-hybrid calves produced by Wapiti hinds inseminated with Y-sorted sperm were male (93.7%) and 10/10 (100%) Sika and Wapiti-hybrid calves from hinds inseminated with X-sorted sperm were female. The sex ratio of the Sika and Wapiti-hybrid calves born to hinds inseminated with sex-sorted sperm deviated significantly (PSika and Wapiti-hybrid calves were born between 237 and 250d of gestation. Male and female calves in the control group had similar birth weights and weaning weights as calves from hinds inseminated with X- or Y-sorted sperm. In conclusion it can be said that normal Sika and Wapiti-hybrid calves of predicted sex can be produced after artificial insemination of Wapiti does with low numbers of sex-sorted cryopreserved Sika sperm. PMID:19619965

  2. Sarcocystosis in wild red deer (Cervus elaphus) in Patagonia, Argentina. (United States)

    Reissig, Elizabeth Chang; Moré, Gastón; Massone, Adriana; Uzal, Francisco A


    Sarcocystis spp. are protozoan parasites with a heteroxenous life cycle, which produce cysts in the muscle of herbivorous animals. In these animal species, sarcocystosis is frequently asymptomatic, although it may occur with high prevalence. Seven Sarcocystis spp. have been described in red deer (Cervus elephus). The aim of this study was to determine the prevalence of sarcocystosis, and to perform the morphological and molecular characterization of Sarcocystis spp. found in wild red deer of the Nahuel Huapi National Park (NHNP), Patagonia, Argentina. Full necropsies of 62 red deer killed by hunters in the NHNP and neighboring areas were performed. Samples of heart and skeletal muscle were examined histologically and selected samples were also examined by transmission electron microscopy (TEM), PCR and sequencing. Sarcocystis spp. thin walled cysts were detected in 62 % (38/62) of heart, and in 22 % (3/14) of skeletal muscle samples examined histologically. TEM revealed a smooth and thin cyst wall (≤1 μm), with scarce and separated ribbon-like protrusions. A total of three partial and one full 18S ribosomal RNA (rRNA) gene sequences were obtained, and showed the highest identity (≥99 %) with Sarcocystis taeniata, a species described in moose (Alces alces). The morphological and molecular results indicate that red deer in Argentina are frequently infected with S. taeniata, a species for which the definitive host is unknown. The present results also confirm that Sarcocystis spp. using cervids as intermediate host are not host-specific. Further studies are needed to improve the epidemiological knowledge of Sarcocystosis in red deer. PMID:26779923

  3. Oral vaccination with microencapsuled strain 19 vaccine confers enhanced protection against Brucella abortus strain 2308 challenge in red deer (Cervus elaphus elaphus). (United States)

    Arenas-Gamboa, Angela M; Ficht, Thomas A; Davis, Donald S; Elzer, Philip H; Kahl-McDonagh, Melissa; Wong-Gonzalez, Alfredo; Rice-Ficht, Allison C


    Bison (Bison bison) and elk (Cervus elaphus nelsoni) in the Greater Yellowstone Area (GYA), USA, are infected with Brucella abortus, the causative agent of bovine brucellosis, and they serve as a wildlife reservoir for the disease. Bovine brucellosis recently has been transmitted from infected elk to cattle in Montana, Wyoming, and Idaho and has resulted in their loss of brucellosis-free status. An efficacious Brucella vaccine with a delivery system suitable for wildlife would be a valuable tool in a disease prevention and control program. We evaluated Strain 19 (S19) in a sustained release vehicle consisting of alginate microspheres containing live vaccine. In a challenge study using red deer (Cervus elaphus elaphus) as a model for elk, alginate, a naturally occurring polymer combined with a protein of Fasciola hepatica vitelline protein B was used to microencapsulate S19. Red deer were orally or subcutaneously immunized with 1.5 x 10(10) colony-forming units (CFUs) using microencapsulated S19. Humoral and cellular profiles were analyzed bimonthly throughout the study. The vaccinated red deer and nonvaccinated controls were challenged 1 yr postimmunization conjunctivally with 1 x 10(9) CFUs of B. abortus strain 2308. Red deer vaccinated with oral microencapsulated S19 had a statistically significant lower bacterial tissue load compared with controls. These data indicate for the first time that protection against Brucella-challenge can be achieved by combining a commonly used vaccine with a novel oral delivery system such as alginate-vitelline protein B microencapsulation. This system is a potential improvement for efficacious Brucella-vaccine delivery to wildlife in the GYA. PMID:19901378

  4. Diets of Hangul Deer Cervus elaphus hanglu (Cetartiodactyla: Cervidae in Dachigam National Park, Kashmir, India

    Directory of Open Access Journals (Sweden)

    G.M. Shah


    Full Text Available Seasonal variations in the diets of Hangul Deer Cervus elaphus hanglu in Dachigam National Park (DNP were determined by analyzing 95 freshly collected pellet samples. The pellets were collected along well defined transects during a two year study from January 2005 to December 2006. The diets showed marked seasonal variations. The spring diet was constituted by forbs (45.2%, shrubs (24%, grasses (20% and climbers (10.7%. In summer forbs accounted for 42.7% of the diet, trees 38%, grasses 14.3% and shrubs 4.8%. Except the lone representation of forb species (5.6% the autumn diet was mainly represented by shrubs (75% and trees (19.4%. The winter diet was constituted by trees (35.6%, shrubs (28.6%, forbs (21.3%, grasses (8.6% and climbers (5.8%.

  5. Nutritional evaluation of the lipid fraction of Iberian red deer (Cervus elaphus hispanicus) tenderloin. (United States)

    Quaresma, M A G; Trigo-Rodrigues, I; Alves, S P; Martins, S I V; Barreto, A S; Bessa, R J B


    The meat lipid fraction of psoas major muscle from 20 adult (10 males and 10 females) feral Iberian red deer (Cervus elaphus hispanicus) was characterized by quantification of total fat, total cholesterol, vitamin E and fatty acid (FA) composition, including detailed trans octadecenoate isomers and conjugated linoleic acid (CLA) isomeric profile. The total lipid content revealed a very lean meat (0.99 g/100g of meat), with total cholesterol content averaging 55.6 mg/100g of muscle. The FA profile displayed a very high PUFA level for ruminant meat (30.2g/100g FA). The 18:2 cis-9,trans-11 content was fairly low (0.26% of total FA) compared with other ruminant meats. The comparison of stags and hinds showed more similarities than differences. Nevertheless, hinds displayed superior contents of α-tocopherol and trans MUFA and a better n-6/n-3 ratio than stags. PMID:22695295

  6. Complete mitochondrial genome of Cervus elaphus songaricus (Cetartiodactyla: Cervinae) and a phylogenetic analysis with related species. (United States)

    Li, Yiqing; Ba, Hengxing; Yang, Fuhe


    Complete mitochondrial genome of Tianshan wapiti, Cervus elaphus songaricus, is 16,419 bp in length and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region. The phylogenetic trees were reconstructed with the concatenated nucleotide sequences of the 13 protein-coding genes using maximum parsimony (MP) and Bayesian inference (BI) methods. MP and BI phylogenetic trees here showed an identical tree topology. The monopoly of red deer, wapiti and sika deer was well supported, and wapiti was found to share a closer relationship with sika deer. Tianshan wapiti shared a closer relationship with xanthopygus than yarkandensis. Rusa unicolor and Rucervus eldi were given a basal phylogenetic position. Our phylogenetic analysis provided a robust phylogenetic resolution spanning the entire evolutionary relationship of the subfamily Cervinae. PMID:24725059

  7. Spatial Ecology and Population Dynamics of Tule Elk (Cervus elaphus nannodes) at Point Reyes National Seashore, California


    Cobb, McCrea Andrew


    The tule elk (Cervus elaphus nannodes) was reintroduced to Point Reyes National Seashore, California in 1978. After exhibiting irruptive growth for 20 years, elk abundances have fluctuated. Three subpopulations of elk currently inhabit Pt. Reyes: a fenced subpopulation at high density; a free-ranging subpopulation in designated wilderness at low density; and a free-ranging subpopulation on active ranchland at low density. Little is known about the spatial ecology and population dynamics of...

  8. Haematological and serum biochemical reference values in free-ranging red deer (Cervus elaphus atlanticus

    Directory of Open Access Journals (Sweden)

    Olav Rosef


    Full Text Available Analyses of haematological and biochemical constituents were carried out on the Norwegian subspecies of free-ranging red deer (Cervus elaphus atlanticus. All animals were captured from January to March by using a mixture of xylazine and tiletamin-zolazepam. Immobilisation was performed with plastic projectile syringes fired from a dart gun. Fourteen haematological parameters were analysed. There were no differences in the values between hinds and stags and between adults and calves (P > 0.01. Of the 22 biochemical compounds investigated there was a significant difference (P < 0.01 between calves and adults for lactate dehydrogenase (LD, globulin, beta globulin, gamma globulin, and the minerals Na, K, Mg, Zn, Ca, and P. Differences (P < 0.01 between hinds and stags were found in cholesterol, gamma glutamyl transferase (GGT, alpha-1 globulin, alpha-2 globulin and Cu. The blood values determined in this study can be used as reference values for this red deer subspecies immobilised with a mixture of xylazine-tiletamin-zolazepam for health control and diagnosis of diseases.Abstract in Norwegian /Sammendrag:Hematologiske og biokjemiske parametere er analysert på norsk frittlevende hjort (Cervus elaphus atlanticus. Hjorten ble immobilisert i tidsrommet januar til mars ved hjelp av et spesialgevær ladet med plast kanyler som inneholdt en blanding av xylazin og tiletamin-zolazepam. Det var ingen forskjeller i de14 undersøkte hematologiske verdiene mellom hinder, kalver og bukker (P>0,01. Av de 22 biokjemiske parametrene som ble undersøkt var det en signifikant forskjell mellom kalver og voksne (P<0,01 når det gjelder laktat dehydrogenase, globulin, beta globulin, gamma globulin og mineralene Na, K, Mg, Zn, Ca og P. Det var en signifikant forskjell mellom hinder og bukker (P<0.01 på parametrene kolesterol, gamma glutamyl transferase, alfa-1 globulin, alfa-2 globulin og Cu. Blodverdiene som ble målt i dette studiet kan bli brukt som referanseverdier

  9. Prevalence of Dermatophytes in Red Deer (Cervus elaphus in The Stelvio National Park, Italy

    Directory of Open Access Journals (Sweden)

    Roberta Perego


    Full Text Available Dermatophytosis has been described in wildlife, but the literature reporting dermatophyte prevalence in deer is incomplete. To determine the prevalence of dermatophytes and to evaluate the hypothetical role of asymptomatic carriers hair samples were collected from 30 legally hunted wild red deer (Cervus elaphus in the Stelvio National Park, Italy. All deer were visually examined for dermatologic lesions and the coat was brushed using a modified Mackenzie collection method. A small sample of hair was used for direct microscopical examination and subsequently fungal culture was performed on the hair samples. Macroscopic and microscopic examinations were used to identify dermatophytes, saprophytic fungi and yeasts. None of the deer had visible cutaneous lesions. No dermatophyte spores or hyphae were found on direct microscopical examination and, when hair samples were cultured, dermatophytes were not demonstrated in any sample. Only saprophytic fungi were grown, predominantly Alternaria spp., Mucor spp., Cladosporium spp. These results did not reveal the presence of asymptomatic carriers of dermatophytes in the deer sample population of Stelvio National Park and suggest that it is unlikely that, at least in the investigated geographical area, the red deer act a reservoir for transmission of dermatophytes to other wild animals, livestock or people living locally

  10. Do red deer stags (Cervus elaphus use roar fundamental frequency (F0 to assess rivals?

    Directory of Open Access Journals (Sweden)

    Maxime Garcia

    Full Text Available It is well established that in humans, male voices are disproportionately lower pitched than female voices, and recent studies suggest that this dimorphism in fundamental frequency (F0 results from both intrasexual (male competition and intersexual (female mate choice selection for lower pitched voices in men. However, comparative investigations indicate that sexual dimorphism in F0 is not universal in terrestrial mammals. In the highly polygynous and sexually dimorphic Scottish red deer Cervus elaphus scoticus, more successful males give sexually-selected calls (roars with higher minimum F0s, suggesting that high, rather than low F0s advertise quality in this subspecies. While playback experiments demonstrated that oestrous females prefer higher pitched roars, the potential role of roar F0 in male competition remains untested. Here we examined the response of rutting red deer stags to playbacks of re-synthesized male roars with different median F0s. Our results show that stags' responses (latencies and durations of attention, vocal and approach responses were not affected by the F0 of the roar. This suggests that intrasexual selection is unlikely to strongly influence the evolution of roar F0 in Scottish red deer stags, and illustrates how the F0 of terrestrial mammal vocal sexual signals may be subject to different selection pressures across species. Further investigations on species characterized by different F0 profiles are needed to provide a comparative background for evolutionary interpretations of sex differences in mammalian vocalizations.

  11. First description of Onchocerca jakutensis (Nematoda: Filarioidea) in red deer (Cervus elaphus) in Switzerland. (United States)

    Bosch, Felix; Manzanell, Ralph; Mathis, Alexander


    Twenty-seven species of the genus Onchocerca (Nematoda; Filarioidea) can cause a vector-borne parasitic disease called onchocercosis. Most Onchocerca species infect wild and domestic ungulates or the dog, and one species causes river blindness in humans mainly in tropical Africa. The European red deer (Cervus e. elaphus) is host to four species, which are transmitted by blackflies (simuliids) or biting midges (ceratopogonids). Two species, Onchocerca flexuosa and Onchocerca jakutensis, produce subcutaneous nodules, whereas Onchocerca skrjabini and Onchocerca garmsi live free in the hypodermal serous membranes. During the hunting season, September 2013, red deer (n = 25), roe deer (Capreolus c. capreolus, n = 6) and chamois (Rupicapra r. rupicapra, n = 7), all shot in the Grisons Region (Switzerland) were investigated for the presence of subcutaneous nodules which were enzymatically digested, and the contained Onchocerca worms were identified to species by light and scanning electron microscopy as well as by PCR/sequencing. In addition, microfilariae from skin samples were collected and genetically characterized. Neither nodules nor microfilariae were discovered in the roe deer and chamois. Adult worms were found in 24% of red deer, and all of them were identified as O. jakutensis. Two morphologically different microfilariae were obtained from five red deer, and genetic analysis of a skin sample of one red deer indicated the presence of another Onchocerca species. This is the first report of O. jakutensis in Switzerland with a prevalence in red deer similar to that in neighbouring Germany. PMID:27617204

  12. Response of red deer stags ( Cervus elaphus) to playback of harsh versus common roars (United States)

    Garcia, Maxime; Wyman, Megan T.; Charlton, Benjamin D.; Tecumseh Fitch, W.; Reby, David


    Red deer stags ( Cervus elaphus) give two distinct types of roars during the breeding season, the "common roar" and the "harsh roar." Harsh roars are more frequent during contexts of intense competition, and characterized by a set of features that increase their perceptual salience, suggesting that they signal heightened arousal. While common roars have been shown to encode size information and mediate both male competition and female choice, to our knowledge, the specific function of harsh roars during male competition has not yet been studied. Here, we investigate the hypothesis that the specific structure of male harsh roars signals high arousal to competitors. We contrast the behavioral responses of free ranging, harem-holding stags to the playback of harsh roars from an unfamiliar competitor with their response to the playback of common roars from the same animal. We show that males react less strongly to sequences of harsh roars than to sequences of common roars, possibly because they are reluctant to escalate conflicts with highly motivated and threatening unfamiliar males in the absence of visual information. While future work should investigate the response of stags to harsh roars from familiar opponents, our observations remain consistent with the hypothesis that harsh roars may signal motivation during male competition, and illustrate how intrasexual selection can contribute to the diversification of male vocal signals.

  13. Effects of supplemental feeding on gastrointestinal parasite infection in Rocky Mountain Elk (Cervus elaphus) (United States)

    Hines, Alicia M.; Ezenwa, Vanessa O.; Cross, Paul C.; Rogerson, Jared D.


    The effects of management practices on the spread and impact of parasites and infectious diseases in wildlife and domestic animals are of increasing concern worldwide, particularly in cases where management of wild species can influence disease spill-over into domestic animals. In the Greater Yellowstone Ecosystem, USA, winter supplemental feeding of Rocky Mountain elk (Cervus elaphus) may enhance parasite and disease transmission by aggregating elk on feedgrounds. In this study, we tested the effect of supplemental feeding on gastrointestinal parasite infection in elk by comparing fecal egg/oocyst counts of fed and unfed elk. We collected fecal samples from fed and unfed elk at feedground and control sites from January to April 2006, and screened all samples for parasites. Six different parasite types were identified, and 48.7% of samples were infected with at least one parasite. Gastrointenstinal (GI) nematodes (Nematoda: Strongylida), Trichuris spp., and coccidia were the most common parasites observed. For all three of these parasites, fecal egg/oocyst counts increased from January to April. Supplementally fed elk had significantly higher GI nematode egg counts than unfed elk in January and February, but significantly lower counts in April. These patterns suggest that supplemental feeding may both increase exposure and decrease susceptibility of elk to GI nematodes, resulting in differences in temporal patterns of egg shedding between fed and unfed elk.

  14. Chemical capture of free-ranging red deer (Cervus elaphus with medetomidine-ketamine

    Directory of Open Access Journals (Sweden)

    J.M. Arnemo


    Full Text Available Seventeen free-ranging red deer (Cervus elaphus (12 calves and 5 yearling hinds were immobilized with a combination of medetomidine hydrochloride (MED and ketamine hydrochloride (KET in winter (January-March. Immobilizations were performed with plastic projectile syringes fired from a dart gun. Mean (SD doses of 0.147 (0.024 mg MED/kg and 2.5 (0.4 mg KET/kg induced recumbency in 5.0 (2.0 minutes in the calves and all of them were completely immobilized. The initial doses in the yearling hinds were 0.099 (0.016 mg MED/kg and 1.9 (0.2 mg KET/kg but three of them required addirional dosing for induction of reliable restraint. The distance covered by the animals between darting and recumbency ranged from 40-250 m for calves and 100-300 m for yearling hinds. The animals were translocated to deer farms for breeding purposes and were given 12.5-25.0 mg of atipamezole hydrochloride before transportation. All animals recovered completely. Haematological and serum biochemical comparisons between free-ranging calves immobilized with medetomidine-ketamine (n=3 and captive unmedicated calves (n=4 showed that chemical capture induce very little stress in red deer.

  15. Antlers of Cervus elaphus as biomonitors of {sup 90}Sr in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Baeza, A.; Vallejo, I. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain); Guillen, J., E-mail: fguillen@unex.e [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain); Salas, A.; Corbacho, J.A. [LARUEX, Dpt. Applied Physics, Faculty of Veterinary Sciences, University of Extremadura, Avda, 10003 Caceres (Spain)


    Adequate radioprotection of the environment requires the identification of biomonitors sensitive to the variation of its radionuclide content. Due to the chemical similarities between calcium and strontium, calcified tissues of mammals are considered to be good {sup 90}Sr biomonitors. This work considered Cervus elaphus antlers which, being shed annually, can give information about the importance of radiostrontium contamination in an ecosystem in the time period required for the growth of the antler. The samples were collected at various points of W and SW Spain. The mean value of their {sup 90}Sr content was (70 {+-} 43 (S.D.)) Bq/kg d.w., range (16-218) Bq/kg d.w., and the radionuclide was evenly distributed in the different parts of the antler. There was a good correlation between the antlers' {sup 90}Sr content and the {sup 90}Sr deposited in the soil. The antlers' content of {sup 226}Ra (from the natural uranium series) and the contents of some stable elements (Ca, Mg, Sr, and K) were also determined. The values for these stable elements were practically constant in the analyzed samples, and the concentrations measured decreased in the following order: Ca > Mg > K > Sr > {sup 90}Sr > {sup 226}Ra - Research highlights: {yields} There was a good correlation between the antlers' {sup 90}Sr content and the {sup 90}Sr deposited in the soil. {yields} The content of stable elements (Ca, Mg, Sr, K) in the analyzed antlers were practically constant. {yields} The concentrations measured decreased in the following order: Ca > Mg > K > Sr >{sup 90}Sr >{sup 226}Ra.

  16. Colonization of the Scottish islands via long-distance Neolithic transport of red deer (Cervus elaphus). (United States)

    Stanton, David W G; Mulville, Jacqueline A; Bruford, Michael W


    Red deer (Cervus elaphus) have played a key role in human societies throughout history, with important cultural significance and as a source of food and materials. This relationship can be traced back to the earliest human cultures and continues to the present day. Humans are thought to be responsible for the movement of a considerable number of deer throughout history, although the majority of these movements are poorly described or understood. Studying such translocations allows us to better understand ancient human-wildlife interactions, and in the case of island colonizations, informs us about ancient human maritime practices. This study uses DNA sequences to characterise red deer genetic diversity across the Scottish islands (Inner and Outer Hebrides and Orkney) and mainland using ancient deer samples, and attempts to infer historical colonization events. We show that deer from the Outer Hebrides and Orkney are unlikely to have originated from mainland Scotland, implying that humans introduced red deer from a greater distance. Our results are also inconsistent with an origin from Ireland or Norway, suggesting long-distance maritime travel by Neolithic people to the outer Scottish Isles from an unknown source. Common haplotypes and low genetic differentiation between the Outer Hebrides and Orkney imply common ancestry and/or gene flow across these islands. Close genetic proximity between the Inner Hebrides and Ireland, however, corroborates previous studies identifying mainland Britain as a source for red deer introductions into Ireland. This study provides important information on the processes that led to the current distribution of the largest surviving indigenous land mammal in the British Isles. PMID:27053752

  17. Natural diet and food habitat use of the Tarim red deer, Cervus elaphus yarkandensis

    Institute of Scientific and Technical Information of China (English)

    QIAO Jianfang; YANG Weikang; GAO Xingyi


    In order to determine the natural diet and food habitat use of Tarim red deer (Cervus elaphus yarkandensis), a study was carried out in Qiemo, Xinjiang, China from October 2000 to June 2001. Direct observation combined with faecal analysis method was used to determine the natural diet of red deer. 15 different species of plant were identified as food items. Among them, 13 species of plants were identified in winter diet and 9 species in summer. Red deer consumed a wider range of species in winter because of their nutrient requirement as well as the shortage of food and the scarcity of high-quality forage in the study area. Phragmites communis, Glycyrrhiza inflata and populus diversifolia were frequently present in the deer's diet whenever in winter and summer. Among them, Phragmites communis was the most abundant plant in the area and was included in the deer's diet. Observation on food selection frequency of captive Tarim red deer showed that Populus diversifolia was the first preferred species. However, this food was limited in the study area. Five food habitat types were found in the study area according to plant association: (1)Phragmites communis-Tamarix ramosissima association, (2) Tamarix ramosissima-Halostachys caspica association, (3) Tamarix ramosissima-Phragmites communis association, (4) Populus diversifoliaPhragmites communis association, (5) Burned area.Among them, Phragmites communis-Tamarix ramosissima association (reed meadow and reed marsh)was preferred to other types within the study area whenever in summer and winter. Dense reed cover could reduce the chance of detection from predator and obstruct attack from predator. Furthermore, under the cover of the reed, Tarim red deer was protected from direct solar radiation during the hours of www. hot day in summer. The reed meadow and marsh was preferred, presumably because the red deer could minimize their movements while searching for food, water and cover.

  18. Gastrointestinal tract development in red deer (Cervus elaphus) calves from 1 to 12 months of age. (United States)

    Hammond, K J; Hoskin, S O; Jopson, N B; Mackintosh, C G; Hofstra, G; Thompson, B R; Stevens, D R


    This study provides a detailed description of the development of the gastrointestinal tract (GIT) of farmed red deer (Cervus elaphus) calves over the first 12 months of age. GIT development was measured using a combination of computerised tomography (CT) scanning and traditional slaughter plus dissection techniques. Red deer calves of a known birth date were randomly assigned to two treatment groups. A group of five animals were repeatedly CT scanned at 31, 63, 92, 135, 207, 275 and 351 days of age to identify GIT organs and determine their volume. From a group of 20 animals, subsets of four individuals were also scanned at corresponding ages (except 135 days of age). They were immediately euthanised and dissected after CT scanning to compare CT-scanned results with actual anatomical measurements. Individual organ weights were compared with their respective organ volumes determined by CT scanning and were found to have a strong, positive relationship. The combined rumen and reticulum (RR) CT-scanned volume was compared with its volume determined by the water-displacement technique and this also showed good correlation between the two techniques (R = 0.92). The allometric growth rates of organs, relative to animal live weight gains, in descending order, were the rumen, omasum, reticulum, abomasum, caecum blind sac, kidneys, spleen and liver. The red deer GIT was continuing to grow and develop when the last measurement was taken at 351 days of age. The greatest growth of the RR, when expressed in terms of empty weight, was between 31 and 92 days of age. Compared with sheep and cattle, it appears that the red deer have a similar or greater rate of RR development up until approximately 60 to 90 days of age; however, the final increments of GIT maturity in deer may take longer to complete, with the empty weight of the RR gaining 7.5 g/day between 275 and 351 days of age. CT scanning was validated in this study as a viable technique to follow GIT development in the same

  19. Relations between nutritional condition and survival of North American elk Cervus elaphus (United States)

    Bender, L.C.; Cook, J.G.; Cook, R.C.; Hall, P.B.


    We related annual and seasonal survival of four populations of elk Cervus elaphus in the Pacific Northwest, USA, to measures and indices of individual nutritional condition. Among populations, for all mortality (human and non-human causes) sources inclusive, annual survival of adult females was correlated with a rump body condition score (rs = 0.627, P = 0.071), and survival over spring-summer-autumn (SSA) was correlated with mean ingesta-free body fat (IFBF; rs = 0.567, P = 0.088) and rump body condition score (rBCS; rs = 0.615, P = 0.050). For non-human mortality sources only, survival through SSA was correlated with IFBF (rs = 0.567, P = 0.088) and rBCS (rs = 0.615, P = 0.050), and survival over winter was correlated with withers body condition score (rs = 0.677, P = 0.045). For human-caused mortality sources only, survival over SSA was correlated with rBCS (rs = 0.696, P = 0.036) and IFBF (rs = 0.696, P = 0.036). For individuals, logistic analysis found that individual likelihood of dying from all mortality sources inclusive was best predicted (??2 = 8.3, P = 0.004, ?? = -1.24) by longissimus dorsi (loin) muscle thickness, a measure of protein catabolism. For only non-human mortality sources, a model (??2 = 16.1, P = 0.0003) containing both loin muscle thickness (??2 = 5.7, P = 0.017, ??= -1.02) and percent ingesta-free body fat (??2 = 4.9, P = 0.027, ?? = -0.35) best predicted individual susceptibility to mortality. Odds ratios indicated that odds of dying increased approximately 3X for each centimeter of loin muscle catabolized and 1.4X for each percent less body fat. No condition indices at the individual level were related to survival from human-caused mortality sources. Our study populations were characterized by low-marginal condition (i.e. mean ingesta-free body fat levels of 5.9-12.3% for lactating cows in late autumn); this likely increased the prominence of measures of muscle catabolism relative to fat accretion in influencing individual elk survival

  20. Observations on rutting behaviour of Hangul Deer Cervus elaphus hanglu (Cetartiodactyla: Cervidae in Dachigam National Park, Kashmir, India

    Directory of Open Access Journals (Sweden)

    B.A. Bhat


    Full Text Available Observations on seasonal rutting behaviour of Hangul Deer Cervus elaphus hanglu were recorded in Dachigam National Park (DNP during the years 2005 to 2007. A total of 24 breeding herds were seen. The size of the herd varied from 2-5, and usually comprised of one large stag and one or more hinds. The rutting season commenced in the main valley of lower Dachigam by late September and extended up to the first week of November. The peak was from October 9 to 20. The stags in rut became intolerant of each other and separated. The most conspicuous feature of the rut was the reverberating resonant roars by stags. The courtship behaviour was observed on six occasions and only mature stags (8-tined and above were involved in courtship. Various anthropogenic activities in the habitat were found to impair the rutting behaviour of deer.

  1. Predisposition assessment of mountainous forests to bark peeling by red deer (Cervus elaphus L.) as a strategy in preventive forest habitat management


    Friedrich Reimoser; Ursula Nopp-Mayr; Friedrich Voelk


    This paper presents a method to assess the predisposition of mountainous forests to bark peeling by red deer (Cervus elaphus), which illustrates options in preventive forest habitat management. We developed an expert system, based on expert interviews and literature analyses. We selected the most important site- and stand-related predisposing factors for bark peeling of red deer, considering the relation of food dependent and food independent settling stimuli. Within the mechanistic expert sy...

  2. Molecular survey on the presence of zoonotic arthropod-borne pathogens in wild red deer (Cervus elaphus). (United States)

    Ebani, Valentina Virginia; Rocchigiani, Guido; Bertelloni, Fabrizio; Nardoni, Simona; Leoni, Alessandro; Nicoloso, Sandro; Mancianti, Francesca


    To estimate the prevalence of some zoonotic tick-borne pathogens in red deer (Cervus elaphus) living in Italian areas with high risk of arthropod exposure, blood samples from 60 red deer were tested by PCR for A. phagocytophilum, Borrelia burgdorferi s.l., Coxiella burnetii, Francisella tularensis, and piroplasms. Thirty-four (56.67%) animals resulted positive for one or more pathogens. In particular, 24 (40%) red deer were positive for A. phagocytophilum, 16 (26.67%) for Babesia divergens, 6 (10%) for C. burnetii, 2 (3.33%) for B. burgdorferi s.l. No positive reaction was observed for F. tularensis. Thirteen (21.67%) animals resulted co-infected by two or three pathogens. Red deer is confirmed as competent reservoir of A. phagocytophilum and B. divergens, but not of B. burgdorferi. This is the first report of C. burnetii-positive red deer in central Italy. Hunters may be at risk of infection both through infected ticks and during the infected cervids carcasses dressing. PMID:27477510

  3. Movement and Activity Patterns of Translocated Elk (Cervus elaphus Nelsoni on an Active Coal Mine in Kentucky

    Directory of Open Access Journals (Sweden)

    Widén, P.


    Full Text Available Monitoring activity and movements of newly translocated wildlife is necessary for identifying factors that may hinder population establishment. We documented movements and activity of 6 radio-collared Rocky Mountain elk (Cervus elaphus nelsoni translocated to Kentucky from the 4th of March 1999 until the 17th of July 1999. Seventy three percent of daily activity occurred during crepuscular hours, a period that accounted for only 33% of the day. Elk tended to be more active at dawn (39% than dusk (32%. Elk spent most of their time feeding (49.4% and resting-ruminating (44.6%, with little time spent walking or standing (6.0%. Elk were disturbed 9 times by humans and once by dogs during 702 hours of monitoring. Eight of these disturbance events occurred in reclaimed grassland. During each disturbance, elk moved farther (892 m than during the same hours when undisturbed (282 m. Disturbances altered elk movement and activity patterns, and fragmented social groups. Wildlife managers should identify sources of disturbance at release sites and implement plans that minimize their impacts on reintroduced animals.

  4. Genetic Structure and Effective Population Sizes in European Red Deer (Cervus elaphus) at a Continental Scale: Insights from Microsatellite DNA. (United States)

    Zachos, Frank E; Frantz, Alain C; Kuehn, Ralph; Bertouille, Sabine; Colyn, Marc; Niedziałkowska, Magdalena; Pérez-González, Javier; Skog, Anna; Sprĕm, Nikica; Flamand, Marie-Christine


    We analyzed more than 600 red deer (Cervus elaphus) from large parts of its European distribution range at 13 microsatellite loci, presenting the first continent-wide study of this species using nuclear markers. Populations were clearly differentiated (overall F ST = 0.166, Jost's D est = 0.385), and the BAPS clustering algorithm yielded mainly geographically limited and adjacent genetic units. When forced into only 3 genetic clusters our data set produced a very similar geographic pattern as previously found in mtDNA phylogeographic studies: a western group from Iberia to central and parts of Eastern Europe, an eastern group from the Balkans to Eastern Europe, and a third group including the threatened relict populations from Sardinia and Mesola in Italy. This result was also confirmed by a multivariate approach to analyzing our data set, a discriminant analysis of principal components. Calculations of genetic diversity and effective population sizes (linkage disequilibrium approach) yielded the lowest results for Italian (Sardinia, Mesola; N e between 2 and 8) and Scandinavian red deer, in line with known bottlenecks in these populations. Our study is the first to present comparative nuclear genetic data in red deer across Europe and may serve as a baseline for future analyses of genetic diversity and structuring in this widespread ungulate. PMID:26912909

  5. Characteristics of Antioxidant Systems of Yellow Fraction of Red Deer's (Cervus elaphus L.) Semen During the Rutting Period. (United States)

    Koziorowska-Gilun, M; Szurnicka, M; Dziekonska, A; Kordan, W; Giżejewski, Z; Filipowicz, K


    The objective of this study was to make the preliminary characterization of the antioxidant defence systems of the yellow fraction (YF) of red deer's (Cervus elaphus L.) semen during the rutting period. The semen was collected using artificial vagina (AV). The studies included spectrophotometric determination of antioxidant enzymes activities such as superoxide dismutase (SOD), catalase (CAT) and glutathione peroxidase (GPx). We also analysed the contents of low-molecular antioxidants such as L-glutathione (GSH + GSSG), L-ascorbate (ASC) and total antioxidant status (TAS). Additionally, the samples were subjected to PAGE and stained for SOD and GPx activities. It was demonstrated that the yellow fraction exhibited activities of SOD and GPx, with the highest activities in September and October. CAT activity was not detected. Staining for the SOD and GPx activities confirmed three protein bands with SOD activity and one protein band with GPx activity. The content of GSH + GSSG was similar in trials dating from October to December contrary to the content of ASC which was high in samples from September and October. The stable rate of TAS was observed during the whole rutting period. The results of this study showed that the YF of red deer semen is equipped with basic battery of antioxidant enzymes comprising SOD and GPx, with the supporting role of GSH + GSSG and ASC. Moreover, the samples obtained at the peak of the rutting period occurring from September to October had the highest enzymatic activity in comparison with remaining months of the rutting period, which contributed to the high quality of the semen by preventing it from the formation of oxidative stress during the short period of intense sexual activity of male red deer. The better understanding of the mechanisms of antioxidant defence systems in the YF of deer's semen may contribute to the potential use of this fraction in technology of wild ruminant semen preservation. PMID:26854018

  6. Mercury and selenium binding biomolecules in terrestrial mammals (Cervus elaphus and Sus scrofa) from a mercury exposed area. (United States)

    Ropero, M J Patiño; Fariñas, N Rodríguez; Krupp, E; Mateo, R; Nevado, J J Berzas; Martín-Doimeadios, R C Rodríguez


    Mercury (Hg) is likely bound to large biomolecules (e.g. proteins) in living organisms, and in order to assess Hg metabolic pathways and possible toxicological effects, it is essential to study these Hg containing biomolecules. However, the exact nature of most metal binding biomolecules is unknown. Such studies are still in their infancy and information on this topic is scarce because the analysis is challenging, mainly due to their lability upon digestion or extraction from the tissue. New analytical methods that allow complex Hg-biomolecules to be analysed intact are needed and only few very recent studies deal with this approach. Therefore, as an initial step towards the characterization of Hg containing biomolecules, an analytical procedure has been optimised using size-exclusion chromatography (SEC) with inductively coupled plasma mass spectrometry (ICP-MS) detection. We applied this technique to elucidate the distribution and elution profile of Hg and Se, and some physiological important elements such as Fe, Ni, Zn and Cu, to assess metal binding profiles in liver and kidney samples of red deer (Cervus elaphus) and wild boar (Sus scrofa) who roam freely within the largest Hg mining district on Earth, Almadén in Spain. Elemental fractionation profiles of the extracts from different tissues were obtained using two different SEC columns (BioSep-SEC-S2000 GL 300-1kDa and Superdex 75 10/300 GL 70-3kDa). Similar profiles of Hg were observed in red deer and wild boar; however, significant differences were evident for liver and kidney. Moreover, the profiles of Se showed a single peak at high-medium molecular weight in all investigated tissues, while co-elution of Hg with Fe, Ni, Zn and Cu was observed. PMID:27093497


    Scala, Christopher; Duffard, Nicolas; Beauchamp, Guy; Boullier, Séverine; Locatelli, Yann


    Deer are sensitive to clostridial diseases, and vaccination with clostridial toxoids is the method of choice to prevent these infections in ruminants. The purpose of this study was to evaluate the serologic responses in red deer (Cervus elaphus) over a 13-mo period after vaccination with a multivalent clostridial vaccine, containing an aluminium hydroxide adjuvant. Antibody production to the Clostridium perfringens type D epsilon toxin component of the vaccine was measured using an indirect enzyme-linked immunosorbent assay. Animals from group 1 (9 mo old; n = 6) were naïve and received an initial vaccination with a booster vaccine 4 wk apart and one annual booster. Animals from group 2 (21 mo old; n = 10) had been previously vaccinated 12 mo prior and received a first annual booster at the beginning of this study and a second annual booster 12 mo later. The multivalent clostridial vaccine induced a high antibody response that peaked after each injection and then slowly decreased with time. In group 1, a booster vaccine was required to obtain an initial high humoral response. The annual booster injection induced a strong, rapid, and consistent anamnestic response in both groups. The serologic responses persisted significantly over the baseline value for 9-12 mo in group 1, but more than 12 mo in group 2. It is unknown whether the measured humoral immune responses would have been protective as no challenge studies were performed. Further investigation is needed to determine the protective antibody titers to challenge and how long this immunity might persist after vaccination. PMID:27010263

  8. Hybridisation between red deer (Cervus elaphus) and Japanese sika (C. nippon) on the Kintyre Peninsula, Scotland


    Senn, Helen V.


    Hybridisation between introduced and endemic species causes conservation concerns, but also provides us with an opportunity to study the dynamics of gene flow between two species as they first meet. Japanese sika deer (Cervus nippon) were introduced to the British Isles at a number of locations at the beginning of the 20th century. In the intervening time, sika have spread and their range now extends across approximately 40% of Scotland, where they overlap with that of native red ...

  9. Glycolytic potential and ultimate muscle pH values in red deer (Cervus elaphus and fallow deer (Dama dama

    Directory of Open Access Journals (Sweden)

    Eva Wiklund


    Full Text Available The ultimate pH value of meat (measured at approx. 24 hours post slaughter gives information about the technological quality, i.e. shelf life, colour, water-holding properties and tenderness and is a direct consequence of muscle glycogen (energy levels at slaughter. It may therefore also indicate whether or not the animal has been exposed to stressful energy depleting events prior to slaughter. In the present study, 141 animals (130 red deer (Cervus elaphus and 11 fallow deer (Dama dama were included to investigate the relationship between ultimate pH and residual glycogen concentration in red deer and fallow deer M. longissimus. In addition, the muscle glycogen content and ultimate pH values in three red deer muscles (Mm. triceps brachii, longissimus and biceps femoris were studied. M. triceps brachii had higher ultimate pH and lower glycogen content compared with the other two studied muscles. The frequency of intermediate DFD (5.8≤ pH<6.2 was 5.4% in red deer M. longissimus, compared with 9.1% in fallow deer, while the frequency of DFD (pH≥ 6.2 was much lower in red deer (3.8% than in fallow deer (54.5%. A curvilinear relationship between ultimate pH and total glucose concentration (glycogen and glucose 30 min post slaughter in red deer and fallow deer M. longissimus was found. The relationship between muscle pH and lactic acid concentration however, was indicated to be linear. A significant variation in total glucose concentration at ultimate pH below 5.80 was observed, including values in the range from 18 to 123 mmol/kg wet tissue. It was concluded that further studies are needed to further explore the relationship between muscle glycogen content and technological and sensory quality attributes of meat from different deer species.Abstract in Swedish / Sammanfattning:Köttets pH-värde (mätt ca 24 timmar efter slakt har stor betydelse för den teknologiska kvaliteten som t. ex. hållbarhet, färg, vattenhållande förmåga och m

  10. Authenticity control of game meat products--a single method to detect and quantify adulteration of fallow deer (Dama dama), red deer (Cervus elaphus) and sika deer (Cervus nippon) by real-time PCR. (United States)

    Druml, Barbara; Grandits, Stephanie; Mayer, Walter; Hochegger, Rupert; Cichna-Markl, Margit


    This contribution presents a single real-time PCR assay allowing the determination of the deer content (the sum of fallow deer (Dama dama), red deer (Cervus elaphus) and sika deer (Cervus nippon)) in meat products to detect food adulteration. The PCR assay does not show cross-reactivity with 20 animal species and 43 botanical species potentially contained in game meat products. The limit of quantification is 0.5% for fallow deer and red deer and 0.1% for sika deer. The deer content in meat products is determined by relating the concentration obtained with the deer PCR assay to that obtained with a reference system which amplifies mammals and poultry DNA. The analysis of binary meat mixtures with pork, a meat mixture containing equal amounts of fallow deer, red deer and sika deer in pork and a model game sausage showed that the quantification approach is very accurate (systematic error generally <25%). PMID:25306377

  11. Acoustic behaviour of two large terrestrial mammals in relation to resources maintenance and mating systems: wolf(Canis lupus) and red deer (Cervus elaphus) as model species


    Passilongo, Daniela


    The high variability of vocalization is due to their function, the habitat where they evolved and the physical constraints of the emitters. The aim of this study were to analyse the acoustic behaviour of two large terrestrial mammals, wolf (Canis lupus) and red deer (Cervus elaphus), in relation to resources maintenance and mating systems. Firstly, I analysed the Italian wolf howl. I found two forms of howl; both types are uttered within the lowest frequencies of the wolf’s vocal range,...



    B. Cenci Goga; A. Vizzani; C. Monticelli; I. Nicchiarelli; P. Sechi; I. Pisano


    A case control study was performed in the Parco Nazionale dei Monti Sibillini, Italy, to find out whether roe deer (Capreolus capreolus) and red deer (Cervus elaphus) were more likely to harbour antibiotic resistant Escherichia coli in their faeces, compared to Enterococcus spp. Ten areas were selected and samples were collected during a fourmonths (May to August, 2008) sampling period. Samples of water (n=12) and feces (n=59), collected at 10 different sites, were cultured for E. coli and En...

  13. Composición y calidad de la dieta del ciervo (Cervus elaphus L. en el norte de la península ibérica

    Directory of Open Access Journals (Sweden)

    Garin, I.


    Full Text Available Plant composition and quality of the red deer (Cervus elaphus L. diet in the northern Iberian peninsula The feeding pattern of red deer varies greatly among the different European populations. The aim of our study was to elucidate the plant composition and the quality of the red deer diet in the Pyrenees (Northern Iberian peninsula. Over a one-year period, the red deer fed mainly on browse, pines being the main food. However, unlike other populations on the Iberian peninsula, consumption of herbaceous plants was higher than browse in the spring-summer period. Nevertheless, the diet of Pyrenean red deer shared some features with the Mediterranean populations such as browsing on woody legumes. Fecal nitrogen content, as an index of diet quality, showed low annual values with a marked decrease in winter. The overall feeding pattern was similar to that of other Central European populations. The large size of the surveyed population probably affected its high level of browse consumption and poor quality diet.

  14. X- and Y-chromosome specific variants of the amelogenin gene allow sex determination in sheep (Ovis aries and European red deer (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    Brenig B


    Full Text Available Abstract Background Simple and precise methods for sex determination in animals are a pre-requisite for a number of applications in animal production and forensics. However, some of the existing methods depend only on the detection of Y-chromosome specific sequences. Therefore, the abscence of a signal does not necessarily mean that the sample is of female origin, because experimental errors can also lead to negative results. Thus, the detection of Y- and X-chromosome specific sequences is advantageous. Results A novel method for sex identification in mammals (sheep, Ovis aries and European red deer, Cervus elaphus is described, using a polymerase chain reaction (PCR and sequencing of a part of the amelogenin gene. A partial sequence of the amelogenin gene of sheep and red deer was obtained, which exists on both X and Y chromosomes with a deletion region on the Y chromosome. With a specific pair of primers a DNA fragment of different length between the male and female mammal was amplified. Conclusion PCR amplification using the amelogenin gene primers is useful in sex identification of samples from sheep and red deer and can be applied to DNA analysis of micro samples with small amounts of DNA such as hair roots as well as bones or embryo biopsies.

  15. Complete mitochondrial genome sequence of a Hungarian red deer (Cervus elaphus hippelaphus) from high-throughput sequencing data and its phylogenetic position within the family Cervidae. (United States)

    Frank, Krisztián; Barta, Endre; Bana, Nóra Á; Nagy, János; Horn, Péter; Orosz, László; Stéger, Viktor


    Recently, there has been considerable interest in genetic differentiation in the Cervidae family. A common tool used to determine genetic variation in different species, breeds and populations is mitochondrial DNA analysis, which can be used to estimate phylogenetic relationships among animal taxa and for molecular phylogenetic evolution analysis. With the development of sequencing technology, more and more mitochondrial sequences have been made available in public databases, including whole mitochondrial DNA sequences. These data have been used for phylogenetic analysis of animal species, and for studies of evolutionary processes. We determined the complete mitochondrial genome of a Central European red deer, Cervus elaphus hippelaphus, from Hungary by a next generation sequencing technology. The mitochondrial genome is 16 354 bp in length and contains 13 protein-coding genes, two rRNA genes, 22 tRNA genes and a control region, all of which are arranged similar as in other vertebrates. We made phylogenetic analyses with the new sequence and 76 available mitochondrial sequences of Cervidae, using Bos taurus mitochondrial sequence as outgroup. We used 'neighbor joining' and 'maximum likelihood' methods on whole mitochondrial genome sequences; the consensus phylogenetic trees supported monophyly of the family Cervidae; it was divided into two subfamilies, Cervinae and Capreolinae, and five tribes, Cervini, Muntiacini, Alceini, Odocoileini, and Capreolini. The evolutionary structure of the family Cervidae can be reconstructed by phylogenetic analysis based on whole mitochondrial genomes; which method could be used broadly in phylogenetic evolutionary analysis of animal taxa. PMID:27165525

  16. Predisposition assessment of mountainous forests to bark peeling by red deer (Cervus elaphus L. as a strategy in preventive forest habitat management

    Directory of Open Access Journals (Sweden)

    Friedrich Reimoser


    Full Text Available This paper presents a method to assess the predisposition of mountainous forests to bark peeling by red deer (Cervus elaphus, which illustrates options in preventive forest habitat management. We developed an expert system, based on expert interviews and literature analyses. We selected the most important site- and stand-related predisposing factors for bark peeling of red deer, considering the relation of food dependent and food independent settling stimuli. Within the mechanistic expert system, knowledge on predisposing effects of certain site and stand features is represented in the form of an award-penalty point system. In the current paper, we present the predisposition assessment system for bark peeling and the verification of the system with data of the inventory of natural resources of the Limestone Alps National Park (Upper Austria. Three site-related indicators, i.e. terrain features, roughness/smoothness of relief, and local climate, and six stand-related indicator, i.e. tree age, canopy cover, proportion of conifers, cover of herb layer, method of final cutting, and harassment, were included in the system. Both the chosen indicators and the overall assessment clearly reflected the predisposition in terms of relative frequencies of peeled and unpeeled sample plots. A supplemental logistic regression run with the occurrence/absence of bark peeling as response variable and the assessed predisposition scores from the PAS as explanatory variable proved the discriminatory value of the PAS.

  17. A field survey on the status of gastrointestinal helminth parasites in hangul (Cervus elaphus hanglu) in Dachigam National Park of Kashmir. (United States)

    Lone, Bashir A; Chishti, M Z; Ahmad, Fayaz; Tak, Hidayatullah; Bandh, Suhaib A; Khan, Abida


    One year crossectional survey was carried out to determine and describe the prevalence and intensity of gastrointestinal parasite infections in hangul (Cervus elaphus hanglu) in Dachigam National Park of Kashmir through faecal examinations. Out of 153 faecal samples examined, 82 (53.59 %) were found infected with GIT helminthes. In present study seven helminth species were found, including five nematode [Haemonchus contortus (55.39 %), Trichuris ovis (39.75 %), Dictyocaulus viviparus (28.4.00 %), Oesophogostomum circumcincta (13.7 %) and Chabertia ovina (4.02 %)] one trematode [Fasciola hepatica (17.3 %)] and one cestode species [Moneizia expansa (6.05 %)]. Based on the severity of infection 81.7 % of hangul positive samples were severely infected (epg > 1,500), 8.3 % heavily infected (epg = 1,100-1,500), 3.8 % moderately infected (epg = 800-1,000) and 7.2 % mildly infected (epg = 500). Season, sex and age were the factors that influenced the epidemiological prevalence of GIT helminths in hangul in the present study. The maximum helminth infection was observed in summer season and lowest in winter (P = 0.003). Lower age groups were more infected than adult animals (P > 0.05). Prevalence was higher in males than females (P > 0.05). The present study will initially be of great significance to add to existing knowledge of the epidemiology of GIT helminth of hangul which is the pioneering study on this animal in the valley and the findings will be quite helpful to devise the appropriate control and prophylactic strategies for GIT helminthiasis of hangul in the Dachigam national park. PMID:27605778

  18. Pragmatic perspective on conservation genetics and demographic history of the last surviving population of Kashmir red deer (Cervus elaphus hanglu in India.

    Directory of Open Access Journals (Sweden)


    Full Text Available The hangul (Cervus elaphus hanglu is of great conservation concern because it represents the easternmost and only hope for an Asiatic survivor of the red deer species in the Indian subcontinent. Despite the rigorous conservation efforts of the Department of Wildlife Protection in Jammu & Kashmir, the hangul population has experienced a severe decline in numbers and range contraction in the past few decades. The hangul population once abundant in the past has largely become confined to the Dachigam landscape, with a recent population estimate of 218 individuals. We investigated the genetic variability and demographic history of the hangul population and found that it has shown a relatively low diversity estimates when compared to other red deer populations of the world. Neutrality tests, which are used to evaluate demographic effects, did not support population expansion, and the multimodal pattern of mismatch distribution indicated that the hangul population is under demographic equilibrium. Furthermore, the hangul population did not exhibit any signature of bottleneck footprints in the past, and Coalescent Bayesian Skyline plot analysis revealed that the population had not experienced any dramatic changes in the effective population size over the last several thousand years. We observed a strong evidence of sub-structuring in the population, wherein the majority of individuals were assigned to different clusters in Bayesian cluster analysis. Population viability analysis demonstrated insignificant changes in the mean population size, with a positive growth rate projected for the next hundred years. We discuss the phylogenetic status of hangul for the first time among the other red deer subspecies of the world and strongly recommend to upgrade hangul conservation status under IUCN that should be discrete from the other red deer subspecies of the world to draw more conservation attention from national and international bodies.

  19. Prevalence of Liver Fluke (Fasciola hepatica) in Wild Red Deer (Cervus elaphus): Coproantigen ELISA Is a Practicable Alternative to Faecal Egg Counting for Surveillance in Remote Populations. (United States)

    French, Andrew S; Zadoks, Ruth N; Skuce, Philip J; Mitchell, Gillian; Gordon-Gibbs, Danielle K; Craine, Alexandra; Shaw, David; Gibb, Stuart W; Taggart, Mark A


    Red deer (Cervus elaphus) are hosts of liver fluke (Fasciola hepatica); yet, prevalence is rarely quantified in wild populations. Testing fresh samples from remote regions by faecal examination (FE) can be logistically challenging; hence, we appraise frozen storage and the use of a coproantigen ELISA (cELISA) for F. hepatica surveillance. We also present cELISA surveillance data for red deer from the Highlands of Scotland. Diagnoses in faecal samples (207 frozen, 146 fresh) were compared using a cELISA and by FE. For each storage method (frozen or fresh), agreement between the two diagnostics was estimated at individual and population levels, where population prevalence was stratified into cohorts (e.g., by sampling location). To approximate sensitivity and specificity, 65 post-slaughter whole liver examinations were used as a reference. At the individual level, FE and cELISA diagnoses agreed moderately (κfrozen = 0.46; κfresh = 0.51), a likely reflection of their underlying principles. At the population level, FE and cELISA cohort prevalence correlated strongly (Pearson's R = 0.89, p advantages of cELISA over FE: i) the ability to store samples long term (frozen) without apparent loss in diagnostic power; and ii) reduced labour and the ability to process large batches. Further evaluation of cELISA sensitivity in red deer, where a range of fluke burdens can be obtained, is desirable. In the interim, the cELISA is a practicable diagnostic for F. hepatica surveillance in red deer, and its application here has revealed considerable geographic, temporal, sex and age related differences in F. hepatica prevalence in wild Scottish Highland red deer. PMID:27598003

  20. The population size, demography and the harvest strategy for the red deer (Cervus elaphus L. in the Polish eastern Carpathians

    Directory of Open Access Journals (Sweden)

    Merta, D.


    Full Text Available Using a line intercept snow track index, the population density and numbers of red deer (Cervus elaphusL. in 8 Forest Districts (Baligród, Cisna, Dukla, Lutowiska, Komacza, Stuposiany, Rymanów and Wetlina were estimated during February 2000. The total number of red deer inhabiting the study area (134.0 thousand hectares of forest was 4,081 individuals. The average population density was 30.4 red deer/1000 ha and it ranged from 10.1 animals/1000 ha in Wetlina Forest District to 39.3 individuals/1000 ha in Dukla Forest District. In September 2000, observation records of 952 red deer indicated that male/female ratio was 1:1.6, and the calf/female index was 31 calves per 100 females. Using a population dynamics model, an annual population recruitment rate was calculated. It ranged from 10.5% to 18.1% of the population size in March and it was negatively correlated with the population density of wolves. A computer simulation of various harvest strategies showed that the low percentage of old stags in the present red deer population was caused by over-harvest of 2-5-year-old stags. Therefore, it is suggested that the percentage of young males in the hunting bag should not be higher than 30% of the total harvested males.

    En février 2000 nous avons estimé la densité de population et le nombre de cerfs (Cervus elaphusL. dans 8 Districts Forestiers (Baligrod, Cisn, Dukla, Lutowiska, Komancza, Stuposiany, Rymanow et Wetlina. Pour cela un index des empreintes sur la neige interceptant une ligne a été utilisé. Le nombre total de cerfs habitant dans la zone d'étude -134.000 ha de forêt- s'élevait à 4 081 animais. La densité moyenne de la population était de 30,4 cerfs par 1000 ha, chiffre oscillant entre 10,1 animais par 1000 ha dans le District Forestier de Wetlina et 39,3 individus par 1000 ha dans le District Forestier de Dukla. En Septembre 2000, les observations enregistrées pour 952 cerfs ont montré que le

  1. Analysis of Nutritional Components and Active Components in Cervus elaphus kansuensis Meat%甘肃马鹿肉营养成分及活性物质分析

    Institute of Scientific and Technical Information of China (English)

    张爱萍; 谢宗平; 李君兰; 郭兆斌; 余群力


    以甘肃马鹿肉为实验材料,检测分析了甘肃马鹿肉的营养成分及活性物质.结果表明:甘肃马鹿水分含量为72.88g/100g,蛋白质27.49g/100g,脂肪2.13g/100g,灰分1.09g/100g;铁14.96mg/100g,锌0.84mg/100g,铜0.199mg/100g,硒1.22μg/100g,磷15.72mg/100g;总氨基酸含量为81.08g/100g,必需氨基酸占总氨基酸的38.87%;过氧化物歧化酶63.42U/mg,雌二醇157.88pg/mL,睾酮0.78ng/mL.生长激素0.76ng/mL.甘肃马鹿肉具有高蛋白、低脂肪、丰富的矿物质、氨基酸含量全面等特点,并含有一定量的活性物质,对人体有较高的营养和滋补价值,是优质的动物性食品资源.%Healthy,adult,pasture-raised Cervus elaphus kansuensis ere slaughtered and Longissimus dorsi samples were taken for the measurement of nutritional components and active components by routine methods.The results showed that the Longissimus dorsi of Cervus elaphus kansuensis contained 72.88 g of water,27.49 g of protein,2.13 g of fat,1.09 g of ash,14.96 mg of Fe,0.84 mg of Zn,0.199 mg of Cu,1.22 μg of Se,and 15.72 mg of P per 100 g.The total amino acid content was 81.08% with the essential amino acids together accounting for 38.87% of the total amino acids.Additionally,the levels of SOD,estradiol,testosterone and growth hormone were detected to be 63.42 U/mg,157.88 pg/mL,0.78 ng/mL and 0.76 ng/mL,respectively.These data demonstrate that the meat of Cervus elaphus kansuensis has good quality characteristics such as high protein,low fat,abundant minerals and a full range of amino acids in large quantities,and also contain some active substances,indicating high nutritional and nourishing value for the human body as an excellent source of animal-derived food.

  2. Induction of Sperm Acrosome Reaction wti h Calcium Ionophore A23187 in Wapiti (Cervus elaphus)%钙离子载体诱发马鹿精子顶体反应效果1)

    Institute of Scientific and Technical Information of China (English)

    李和平; 邹琦; 商兰; 刘伟石


    Wapiti (Cervus elaphus) sperm was capacitated in vitro by swimming-up and the acrosome reaction (AR) was in-duced by Calcium ionophore A23187 to choose an optimal A23187 system during AR.A23187 of 0.01-100 μmol/L can enhance the ratio of AR on the capacitated sperm and 0.1μmol/L A23187 can obtain the highest ratio of AR (74.00%± 2.62%) for 5-min treatment time.AR of capacitated sperm can, but the uncapacitated sperm cannot, be induced by A23187 in wapiti.%以马鹿( Cervus elaphus)为试验动物,采用上浮法诱导马鹿精子体外获能,以钙离子载体( A23187)诱导马鹿精子顶体反应,进而摸索钙离子载体( A23187)诱发其顶体反应的适宜体系。结果表明:0.01~100.00μmol/L的A23187可提高获能马鹿精子的顶体反应率;其中适宜的A23187浓度为0.10μmol/L,反应的时间为5 min,顶体反应率为(74.00±2.62)%。 A23187能促进获能马鹿精子的顶体反应,但不能显著(P>0.05)促进未获能马鹿精子的顶体反应。


    Directory of Open Access Journals (Sweden)

    B. Cenci Goga


    Full Text Available A case control study was performed in the Parco Nazionale dei Monti Sibillini, Italy, to find out whether roe deer (Capreolus capreolus and red deer (Cervus elaphus were more likely to harbour antibiotic resistant Escherichia coli in their faeces, compared to Enterococcus spp. Ten areas were selected and samples were collected during a fourmonths (May to August, 2008 sampling period. Samples of water (n=12 and feces (n=59, collected at 10 different sites, were cultured for E. coli and Enterococcus spp. The resulting colonies were screened for tetracycline, ampicillin and kanamycin resistance using the Lederberg Replica Plating method (breakpoint 4 μg/ml. All resistant isolates were then selected, and subjected to the CLSI antimicrobial plate susceptibility test (7. Among the water specimens contaminated by E. coli, 80% were found to be resistant to ampicillin, 80% to tetracycline and 40% to kanamycin. Among the water specimens contaminated by Enterococcus spp., 14.29% were found to be resistant to ampicillin, 14.29% to tetracycline and 71.3% to kanamycin. Among the 39 strains of E. coli isolated from red deer feces, 12 were resistant to ampicillin (30.77%, 5 to tetracycline (12,82% and 3 to kanamycin (7.69%. Among the 19 strains of Enterococcus spp. isolated from red deer feces, 0 were resistant to ampicillin (0%, 1 to tetracycline (5.26% and 19 to kanamycin (100. These are significant findings, indicating that antibiotic resistance can be found in naïve animal populations and that red deer and fallow deer could act as sentinels for antimicrobial resistance. Key words Antibiotic-resistance, red deer, fallow deer, Escherichia

  4. På vej mod en dansk krondyrforvaltning (Cervus elaphus): Hvad mangler vi at vide, og hvad mangler vi at gøre?

    DEFF Research Database (Denmark)

    Sunde, Peter; Haugaard, Lars


    bestanden og jagtudbyttet på, vil være at frede de unge hjorte mod at have fri jagt på dem, som har nået ”høstklar” alder. Ud over at sikre jægerne et bedre udbytte vil en sådan ”mindstemålsmodel” modvirke selektion for tidligere kønsmodenhed og mindre kropstørrelse for hjorte. In Denmark, red deer (Cervus....... We compared the harvest outcome and demographic composition of these theoretical models with two Danish red deer populations with contrasting land owner structure and hunting regimes (Djursland and Oksbøl). Djursland (hunting seasons 2008/9-2012/13) represents a ‘typical’ Danish landscape, comprising...... of maintaining a stable red deer population with a high proportion of mature stags. We demonstrate that the harvest pattern on Djursland (with an annual mortality of 50% of 2-7 year old stags wherefore less than 1 % of male calves survive until 8 years of age) result in far fewer mature stags in the...

  5. Ataxia enzoótica en ciervo rojo (Cervus elaphus en Argentina Enzootic ataxia in red deer (Cervus elaphus in Argentina

    Directory of Open Access Journals (Sweden)

    J P Soler


    Full Text Available Se describe un caso de ataxia enzoótica (AE en ciervos rojos en cautiverio ocurrido en Argentina. La AE es una patología de los ciervos que causa parálisis lenta y progresiva de las extremidades posteriores y ha sido asociada a la deficiencia de cobre. Su presentación suele ser a partir de los 9 meses de edad. El problema afectó a dos ciervas rojas con debilidad de los miembros posteriores. Se realizó necropsia a una hembra preñada. Se tomaron muestras de órganos en formol al 10%, de suero y sangre entera. Al feto también se le realizó necropsia y se le tomó una muestra de hígado. A partir de muestras de pasto se determinaron los niveles de Cu, Fe, Zn, Mo y SO4. En el agua se analizaron los valores de sales totales, SO4, Ca, Mg, Na y Cl. La prevalencia de esta enfermedad en el establecimiento fue del 0,14%. Los valores de Cu hepático hallados en la hembra y su feto fueron 14,6 ppm y 337 ppm MS, respectivamente. El nivel de Cu en sangre de la cierva fue de 0,5 μg/ml y el hematocrito de 46%. En mιdula espinal se encontró degeneración mielínica generalizada con pérdida de la vaina de mielina, siendo de mayor severidad en las regiones dorsales de la médula. Se observó también vacuolización de la sustancia blanca sin respuesta inflamatoria. Los niveles hepáticos de Cu en la hembra necropsiada se encontraban por debajo del valor considerado como límite, pero a pesar de esto la cupremia se hallaba dentro del rango de referencia siendo ésta una característica comúnmente observada en los casos de deficiencia de Cu. Los valores de Cu hepático fetal también estaban por debajo del rango considerado como normal. A pesar de que los parámetros medidos en pasto y agua al momento del problema estaban dentro de valores de referencia, es probable que los ciervos hayan estado expuestos previamente a bajos valores de Cu dietario durante un tiempo prolongado, lo cual pudo verse agravado por la gran demanda de Cu que ejerce el crecimiento fetal. Considerando que esta enfermedad se presenta usualmente en forma estacional, es de gran importancia realizar muestreos de sangre en la época de mayor riesgo (principios de primavera con el fin de hacer un diagnóstico temprano. De acuerdo a los datos clínicos, de laboratorio y epidemiológicos, se concluye que el diagnóstico corresponde a "ataxia enzoótica por deficiencia de Cu".Enzootic ataxia is a pathology that causes slow and progressive paralysis of the hind limbs in red deer and has been related to copper (Cu deficiency. This condition is not seen until deer are about 9 months old. The objective of this paper is to describe a clinical case of enzootic ataxia in red deer kept in captivity in Argentina. The problem started with two pregnant female deer that showed hind limb weakness. One was slaughtered for necropsy. Blood and organ samples were taken, and the latter were kept in formaldehyde at 10%. A necropsy of the foetus was also carried out and a liver sample was taken. Grass and water were analyzed. Cu, Fe, Zn, Mo and SO4 levels were measured in grass, while total salt, SO4 , Ca, Mg, Na and Cl levels were measured in water. Disease prevalence was 0.14%. Liver Cu values were 14.6 ppm and 337 ppm DM in the female and foetus respectively. Blood Cu level in the female was 0.5 μg/ml and haematocrit was 46%. In spinal cord a general medullar myelin sheath loss was found, but it was more severe in dorsal regions of the medulla. Vacuolization of white substance with no inflammatory response was also observed. Although liver Cu levels in the slaughtered female were lower than those considered as limiting, cupraemia was within the normal range. This is a commonly observed characteristic in Cu deficiency. Cu liver values in the foetus were also below the normal range. As this is a cronic disease, it is probable that the animals were exposed to a low Cu level diet for a long time. This condition could have been worsened by the high Cu demand during foetal growth in the last third of the gestation period. Since this disease is usually found in certain geographical areas and appears seasonally, it is important to take blood samples at the time of higher risk (beginning of spring in order to carry out an early diagnosis. Therefore, according to the clinical, laboratory and epidemiological data, it is concluded that the diagnosis corresponds to enzootic ataxia due to Cu deficiency.

  6. Ataxia enzoótica en ciervo rojo (Cervus elaphus) en Argentina Enzootic ataxia in red deer (Cervus elaphus) in Argentina


    J P Soler; S B Cseh


    Se describe un caso de ataxia enzoótica (AE) en ciervos rojos en cautiverio ocurrido en Argentina. La AE es una patología de los ciervos que causa parálisis lenta y progresiva de las extremidades posteriores y ha sido asociada a la deficiencia de cobre. Su presentación suele ser a partir de los 9 meses de edad. El problema afectó a dos ciervas rojas con debilidad de los miembros posteriores. Se realizó necropsia a una hembra preñada. Se tomaron muestras de órganos en formol al 10%, de suero y...

  7. Antibody Responses of Cervids (Cervus elaphus) following Experimental Mycobacterium bovis Infection and the Implications for Immunodiagnosis (United States)

    Captive and free-ranging wildlife are implicated in the maintenance and transmission of bovine tuberculosis (TB) and therefore pose a significant obstacle to eradication of the disease from domestic livestock. The current ante-mortem diagnostic method, the intradermal tuberculin skin test, has seri...

  8. Roe (Capreolus capreolus) and red (Cervus elaphus) deer foraging habits under snow conditions

    Czech Academy of Sciences Publication Activity Database

    Prokešová, Jarmila; Barančeková, Miroslava; Homolka, Miloslav

    Hamburg: DSV-Verlag, 2005 - (Pohlmeyer, K.), s. 447-449 ISBN 3-88412-431-5. [IUGB Congress /27./. Hannover (DE), 28.08.2005-03.09.2005] R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z60930519 Keywords : deer * winter diet * browsing impact Subject RIV: EG - Zoology

  9. Long-term dynamics of Coxiella burnetii in farmed red deer (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    David eGonzález-Barrio


    Full Text Available Several aspects of the dynamics of Coxiella burnetii that are relevant for the implementation of control strategies in ruminant herds with endemic Q-fever are unknown. We designed a longitudinal study to monitor the dynamics of exposure to C. burnetii in a red deer herd with endemic infection in order to allow the design of Q fever specific control approaches. Other relevant aspects of the dynamics of C. burnetii - the effect of herd immune status, age, season and early infection on exposure, the average half-life of antibodies, the presence and duration of maternal humoral immunity and the age of first exposure - were analysed. The dynamics of C. burnetii in deer herds seems to be modulated by host herd and host individual factors and by particular host life history traits. Red deer females become exposed to C. burnetii at the beginning of their second year since maternal antibodies protect them after birth and during the main pathogen shedding season - at the end of spring-early summer. Infection pressure varies between years, probably associated to herd immunity effects, determining inter-annual variation in the risk of exposure. These results suggest that any strategy applied to control C. burnetii in deer herds should be designed to induce immunity in their first year of life immediately after losing maternal antibodies. The short average life of C. burnetii antibodies suggests that any protection based upon humoral immunity would require re-vaccination every 6 months.

  10. The content of selected metals in muscles of the red deer (Cervus elaphus) from Poland. (United States)

    Skibniewski, Michał; Skibniewska, Ewa M; Kośla, Tadeusz


    The aim of this study was to evaluate the concentrations of Pb, Cu, Zn, Rb, Cs, Sr and Ba in the muscles of red deer that were hunted in two regions of Poland (south-western and north-eastern). The data obtained were evaluated with regards to benefits and potential risk to consumers' health. Samples for the investigations were collected in 2008 and 2009 from 50 female red deer, and the metal concentrations were determined by using the inductively coupled plasma-mass spectrometric (ICP-MS) method. The mean concentrations of Pb did not differ statistically between regions and were equal to that permitted for farm animals. The results of this study support the conclusion that the meat of the analysed animals does not pose a risk of lead intoxication. Statistically higher mean concentrations of Cu and Zn were found in the muscles of red deer from the south-western region (namely, 2.99 and 25.78 mg kg(-1)) than those in animals from north-eastern Poland (namely, 2.61 and 23.39 mg kg(-1) wet weight). In terms of human nutritional needs, the meat of red deer can be considered as a good source of Cu and Zn. Furthermore, Rb, Cs, Sr and Ba concentrations did not differ statistically between regions. Their mean concentrations were 4.50, 0.09, 0.16 and 0.31 mg kg(-1) wet weight, respectively. Although high Cs, Sr and Ba concentrations were found, the meat of red deer does not pose a risk for adult consumers. Only high Ba content may potentially result in negative health effects for children. PMID:25548020

  11. Seasonal and age related changes in size of reproductive structures of red deer hinds (Cervus elaphus

    Directory of Open Access Journals (Sweden)

    Rolf Langvatn


    Full Text Available Morphometric studies of uteri, ovary weights, and follicle diameters were carried out to investigate possible methodological applications. Size and anatomical appearance of the uterus varied with age and phase in the estrous cycle, both in parous and nulliparous females. The uterus thus may provide valuable information on reproductive status for known-aged animals. Weight of ovaries increased in young, but declined in old females, showing significant covariance with body weight in young and prime ages. Ovary weights increased from low levels shortly after parturition to a maximum towards the end of the gestation period. Ovaries containing a corpus luteum were heavier than those without. Compared to ovary weights, mean diameter of largest ovarian follicle varied in an opposite pattern during the yearly cycle. Maximum follicle diameter was largest in non-ovulated females. Weight of ovaries and follicle size appear to be of limited value as criteria in analysis of reproductive status and performance.

  12. Tuberculosis, genetic diversity and fitness in the red deer, Cervus elaphus. (United States)

    Queirós, João; Vicente, Joaquín; Alves, Paulo C; de la Fuente, José; Gortazar, Christian


    Understanding how genetic diversity, infections and fitness interact in wild populations is a major challenge in ecology and management. These interactions were addressed through heterozygosity-fitness correlation analyses, by assessing the genetic diversity, tuberculosis (TB) and body size in adult red deer. Heterozygosity-fitness correlation models provided a better understanding of the link between genetic diversity and TB at individual and population levels. A single local effect was found for Ceh45 locus at individual level, enhancing the importance of its close functional genes in determining TB presence. At population level, the ability of the red deer to control TB progression correlated positively with population genetic diversity, indicating that inbred populations might represent more risk of deer TB severity. Statistical models also gained insights into the dynamics of multi-host interaction in natural environments. TB prevalence in neighbouring wild boar populations was positively associated with deer TB at both individual and population levels. Additionally, TB presence correlated positively with red deer body size, for which "general and local effect" hypotheses were found. Although body size might be correlated with age, an indirect genetic effect on TB presence could be implied. This study provides new insights towards understanding host-pathogen interactions in wild populations and their relation to fitness traits. PMID:27245150

  13. Elk (Cervus elaphus) Seasonal Habitat Selection in a Heterogeneous Forest Structure


    Popp, Jesse N.; McGeachy, David N. C.; Josef Hamr


    Seasonal habitat selection by the reintroduced Burwash elk population, approximately 30 km south of Sudbury, Ontario, has been analysed in order to assist in the development of future management. Twenty-five adult females were radio-collared and tracked 1–3 times a week for 3 years. The most prominent patterns included selection of intolerant hardwood forests (trembling aspen, white birch, and balsam poplar) during all seasons, while Great Lakes-St. Lawrence pines (white and red pine dominate...

  14. Spent Mushroom Substrate Influences Elk (Cervus Elaphus Canadensis) Hematological and Serum Biochemical Parameters


    Park, Jae Hong; Kim, Sang Woo; DO, YOON JUNG; Kim, Hyun; Ko, Yeoung Gyu; Yang, Boh Suk; Shin, Daekeun; Cho, Young Moo


    The objective of this study was to evaluate the effect of spent mushroom substrate (SMS) derived from Pleurotus eryngii on the hematological and biochemical blood properties of elk. A total of 18, two and three-year-old elk were fed three different levels of SMS (0, 15 and 20%) in a corn-wheat bran diet for 80 days. The results indicated significantly high levels of blood monocytes, hemoglobin (Hb), and hematocrit (HCT) in elk fed 15% or 20% SMS (p

  15. Enterocytozoon bieneusi in sika deer (Cervus nippon) and red deer (Cervus elaphus): deer specificity and zoonotic potential of ITS genotypes. (United States)

    Zhao, Wei; Zhang, Weizhe; Wang, Rongjun; Liu, Weishi; Liu, Aiqin; Yang, Dong; Yang, Fengkun; Karim, Md Robiul; Zhang, Longxian


    As the most common cause of the human microsporidiosis, Enterocytozoon bieneusi has been found in a wide variety of animal hosts. Deers are the ruminant mammals living in a variety of biomes, and the distribution of deer species differ by geography. To understand the prevalence of natural infection of E. bieneusi in deer and to assess their epidemiological role in the transmission of microsporidiosis caused by E. bieneusi, 91 fecal specimens were collected from 86 sika deers and five red deers in the northeast of China. By PCR and sequencing of the internal transcribed spacer (ITS) region of the ribosomal RNA (rRNA) gene of E. bieneusi, an average infection rate of 31.9% (29/91) was observed in deer, with 32.6% (28/86) for sika deer, and 20% (1/5) for red deer. Six ITS genotypes were identified: one known genotype BEB6 (n = 20) and five novel genotypes HLJD-I to HLJD-IV (one each) and HLJD-V (n = 5). A phylogenetic analysis based on a neighbor-joining tree of the ITS gene sequences of E. bieneusi indicated that genotypes HLJD-II and HLJD-III fell into group 1 of zoonotic potential, while the other genotypes (BEB6, HLJD-I, HLJD-IV, HLJD-V) were clustered into so-called bovine-specific group 2. This is the first report of E. bieneusi in deer in China. The observation of genotype BEB6 in humans previously and in deer here and also the findings of the two novel genotypes (HLJD-II to HLJ-III) belonging to potential zoonotic group 1 suggested the possibility of deer in the transmission of E. bieneusi to humans. PMID:25185666

  16. Longitudinal Pathogenesis Study of Young Red Deer (Cervus elaphus after Experimental Challenge with Mycobacterium avium subsp. paratuberculosis (MAP

    Directory of Open Access Journals (Sweden)

    Colin Mackintosh


    Full Text Available Paratuberculosis progresses more quickly in young red deer than in sheep or cattle. This study describes the clinical, immunological and pathological changes over a 50-week period in fourteen 4-month-old red deer that received heavy oral challenge with Mycobacterium avium subsp. paratuberculosis (MAP. At 4 and 12 weeks post challenge they were anaesthetized and a section of jejunal lymph node was surgically removed for culture, histopathology, and genetic studies. All 14 deer became infected, none were clinically affected, and they had varying degrees of subclinical disease when killed at week 50. Week 4 biopsies showed no paratuberculosis lesions, but MAP was cultured from all animals. At weeks 12 and 50 histopathological lesions ranged from mild to severe with corresponding low-to-high antibody titres, which peaked at 12–24 weeks. IFN-γ responses peaked at 8–15 weeks and were higher in mildly affected animals than in those with severe lesions.

  17. Damage caused by red deer (Cervus elaphus & wild boar (Sus scrofa in forest hunting grounds in Serbia

    Directory of Open Access Journals (Sweden)

    Gačić Dragan P.


    Full Text Available The systematic study and assessment of the damage by big game in forest hunting grounds in Serbia was infrequent, although the damage was evident. The objective of this paper is to identify the rates and types of damage by red deer and wild boar at three localities: (1 fenced part of the hunting ground 'Crni Lug' (Srem, (2 fenced part of the hunting ground 'Podunavsko Lovište Plavna' (Southwestern Bačka, and (3 fenced rearing centre 'Lomnička Reka' (Mt. Veliki Jastrebac. The damage was not recorded on locality (1. The damage on locality (2 (new polar plantations and locality (3 (beech forests was caused by red deer. The main causes of the damage were excessive density and disturbed population structure (sex and age, nonharmonised forest and hunting management, shortage of natural food, especially of pasture areas.

  18. Steroid hormones profile during an ovarian synchronization procedure in different age categories of red deer hinds (Cervus elaphus L.

    Directory of Open Access Journals (Sweden)

    Šperanda Marcela


    Full Text Available The objective of the present study was to compare estradiol/progesterone ratios of different age categories of red deer hinds and use it as a predictor of estrus synchronization success and consequently conception rate. To accomplish this we used 38 red deer hinds to establish serum progesterone and estradiol levels in young (21 animals, mature (10 animals and old (7 animals hinds during the estrus synchronization procedure (transvaginal/cervical AI. The following estrus synchronization was used: at the start of the experiment each hind received a controlled intravaginal drug-releasing device (CIDR, Pharmacia&Upjohn, New Zealand containing 0.3 g of progesterone. The device was removed on day 11, simultaneously with an application of 250 IU of Pregnant Mare Serum Gonadotropin (PMSG, Folligon® Intervet International, Boxmeer, Holland. Transvaginal/ cervical AI (artificial insemination was performed 48 hours after CIDR withdrawal (day 13. Blood samples were obtained from the jugular vein using a Venoject® vacutainer without an anticoagulant for hormonal tests on the same experimental day (0, 11th and 13th day. A statistically (p<0.01 higher progesterone level was found in young hinds on the 11th day after controlled intravaginal drug-releasing device insertion. A significantly higher (p<0.01 estrogen level was observed in the young in regard to mature and old hinds on the expected day of estrus (13th day. Estradiol/progesterone ratios showed a statistically significant difference (p<0.01 on insemination day (13th day between old and young hinds (98.67 : 46.59 and between old and mature hinds (98.67 : 51.79. Out of a total of 38 hinds only 9 had their offspring, 6 of the young and 3 of the mature hinds.

  19. Contrary seasonal changes of rates of nutrient uptake, organ mass, and voluntary food intake in red deer (Cervus elaphus). (United States)

    Arnold, Walter; Beiglböck, Christoph; Burmester, Marion; Guschlbauer, Maria; Lengauer, Astrid; Schröder, Bernd; Wilkens, Mirja; Breves, Gerhard


    Northern ungulates acclimatize to winter conditions with restricted food supply and unfavorable weather conditions by reducing energy expenditure and voluntary food intake. We investigated in a study on red deer whether rates of peptide and glucose transport in the small intestines are also reduced during winter as part of the thrifty phenotype of winter-acclimatized animals, or whether transport rates are increased during winter in order to exploit poor forage more efficiently. Our results support the latter hypothesis. We found in a feeding experiment that total energy intake was considerably lower during winter despite ad libitum feeding. Together with reduced food intake, mass of visceral organs was significantly lower and body fat reserves were used as metabolic fuel in addition to food. However, efficacy of nutrient absorption seemed to be increased simultaneously. Extraction of crude protein from forage was higher in winter animals, at any level of crude protein intake, as indicated by the lower concentration of crude protein in feces. In line with these in vivo results, Ussing chamber experiments revealed greater electrogenic responses to both peptides and glucose in the small intestines of winter-acclimatized animals, and peptide uptake into jejunal brush-border membrane vesicles was increased. We conclude that reduced appetite of red deer during winter avoids energy expenditure for unproductive search of scarcely available food and further renders the energetically costly maintenance of a large gut and visceral organs unnecessary. Nevertheless, extraction of nutrients from forage is more efficient in the winter to attenuate an inevitably negative energy balance. PMID:26017492

  20. Effects of highways on elk (Cervus elaphus) habitat in the Western United States and proposed mitigation approaches


    Ruediger, William Bill C.; Wall, Ken; Wall, Robin


    Why Elk? Elk are an excellent species to use as a “terrestrial wildlife indicator” for highway impacts. First, they are widespread and exist in all western states as well as several midwestern and eastern states. They are prevalent on many National Forest lands, Bureau of Land Management lands, USDI Fish and Wildlife Service and National Park Service lands. Much elk habitat is on public lands in the western United States (Flathers and Hoekstra 1989, Peek undated, Thomas and Toweill 1982). Elk...

  1. Antibody Responses of Cervids (Cervus elaphus) following Experimental Mycobacterium bovis Infection and the Implications for Immunodiagnosis ▿


    Harrington, Noel P.; Surujballi, Om P.; Prescott, John F.; Duncan, J. Robert; Waters, W. Ray; Lyashchenko, Konstantin; Greenwald, Rena


    Captive and free-ranging wildlife animals are implicated in the maintenance and transmission of bovine tuberculosis and therefore pose a significant obstacle to eradication of the disease from domestic livestock. The current antemortem diagnostic method, the intradermal tuberculin skin test, is impractical for routine use with many wild animals. Antibody-based assays are particularly attractive because the animals are handled only once and immediate processing of the sample is not required. T...

  2. Introgression through rare hybridization: A genetic study of a hybrid zone between red and sika deer (genus Cervus) in Argyll, Scotland.


    Goodman, S. J.; Barton, N. H.; Swanson, G.; Abernethy, K; Pemberton, J M


    In this article we describe the structure of a hybrid zone in Argyll, Scotland, between native red deer (Cervus elaphus) and introduced Japanese sika deer (Cervus nippon), on the basis of a genetic analysis using 11 microsatellite markers and mitochondrial DNA. In contrast to the findings of a previous study of the same population, we conclude that the deer fall into two distinct genetic classes, corresponding to either a sika-like or red-like phenotype. Introgression is rare at any one locus...

  3. An Assessment of Agricultural Damage Caused by Red Deer (Cervus elaphus L.and Fallow Deer (Dama dama L. in Southwest England

    Directory of Open Access Journals (Sweden)

    Charles John Wilson


    Full Text Available The impact of deer grazing on agricultural grassland and cereal crops was assessed at two locations with medium to high deer densities in the Exmoor area of southwest England. Red deer impact on early spring grazing was measured at one site by comparing samples of herbage cut from inside and outside deer-proof exclosure cages, just prior to turn out of livestock, on 1 March 1989. Fallow deer impact on first-cut silage grass production was similarly measured using exclosure cages at a second site by cutting samples on 31 May 1990 and on 6 June 1995. In addition, impact of fallow deer on cereal crops was assessed at this site by measuring sample grain yields from areas of the crop used or unused by deer in 1995 (winter wheat, 1996 (winter barley and 1997 (winter wheat. Significant dry matter yield losses were recorded for red deer impact on spring grazing in 1989 (14.5% and for fallow deer impact on first-cut silage (15.9% in 1995 but not in 1990. In 1995 a small but significant yield loss (7.1% was recorded for winter wheat at the fallow deer site but no loss in cereal yield was recorded in 1996 or 1997. These assessments, carried out in response to complaints about deer damage, suggest that the impacts of deer in this area, where they occur at relatively high density, are only moderate. This highlights the need for careful assessment of cost-benefits when considering deer management strategies to reduce perceived agricultural damage.

  4. Application of a hybrid model to reduce bias and improve precision in population estimates for elk (Cervus elaphus) inhabiting a cold desert ecosystem


    Kathryn A. Schoenecker; Bruce C. Lubow


    Accurately estimating the size of wildlife populations is critical to wildlife management and conservation of species. Raw counts or “minimum counts” are still used as a basis for wildlife management decisions. Uncorrected raw counts are not only negatively biased due to failure to account for undetected animals, but also provide no estimate of precision on which to judge the utility of counts. We applied a hybrid population estimation technique that combined sightability modeling, radio coll...

  5. Application of a hybrid model to reduce bias and improve precision in population estimates for elk (Cervus elaphus inhabiting a cold desert ecosystem

    Directory of Open Access Journals (Sweden)

    Kathryn A. Schoenecker


    Full Text Available Accurately estimating the size of wildlife populations is critical to wildlife management and conservation of species. Raw counts or “minimum counts” are still used as a basis for wildlife management decisions. Uncorrected raw counts are not only negatively biased due to failure to account for undetected animals, but also provide no estimate of precision on which to judge the utility of counts. We applied a hybrid population estimation technique that combined sightability modeling, radio collar-based mark-resight, and simultaneous double count (double-observer modeling to estimate the population size of elk in a high elevation desert ecosystem. Combining several models maximizes the strengths of each individual model while minimizing their singular weaknesses. We collected data with aerial helicopter surveys of the elk population in the San Luis Valley and adjacent mountains in Colorado State, USA in 2005 and 2007. We present estimates from 7 alternative analyses: 3 based on different methods for obtaining a raw count and 4 based on different statistical models to correct for sighting probability bias. The most reliable of these approaches is a hybrid double-observer sightability model (model MH, which uses detection patterns of 2 independent observers in a helicopter plus telemetry-based detections of radio collared elk groups. Data were fit to customized mark-resight models with individual sighting covariates. Error estimates were obtained by a bootstrapping procedure. The hybrid method was an improvement over commonly used alternatives, with improved precision compared to sightability modeling and reduced bias compared to double-observer modeling. The resulting population estimate corrected for multiple sources of undercount bias that, if left uncorrected, would have underestimated the true population size by as much as 22.9%. Our comparison of these alternative methods demonstrates how various components of our method contribute to improving the final estimate and demonstrates why each is necessary.

  6. Antemortem detection of PrP-CWD in preclinical, ranch-raised Rocky Mountain elk (Cervus elaphus nelsoni) by biopsy of the rectal mucosa (United States)

    Chronic wasting disease is a transmissible spongiform encephalopathy or TSE of deer and elk in North America. All diseases in this family are characterized by long preclinical incubation periods following by a relatively short clinical course. The abnormal isoform of the normal cellular prion prot...

  7. Structural changes in fluorosed dental enamel of red deer (Cervus elaphus L.) from a region with severe environmental pollution by fluorides

    International Nuclear Information System (INIS)

    A macroscopic, microradiographic and scanning electron microscope study was performed on the structure of fluorosed dental enamel in red deer from a fluoride polluted region (North Bohemia, Czech Republic). As was revealed by analysis of mandibular bone fluoride content, the rate of skeletal fluoride accumulation in the fluorotic deer was about 6 times that in controls taken from a region not exposed to excessive fluoride deposition. In all fluorosed mandibles, the 1st molar was consistently less fluorotic than the other permanent teeth. This was related to the fact that crown formation in the M1 takes place prenatally and during the lactation period. Fluorosed teeth exhibited opaque and posteruptively stained enamel, reduction or loss of enamel ridges, moderately to grossly increased wear and, in more severe cases, also enamel surface lesions of partly posteruptive, partly developmental origin. Microradiographically, fluorosed enamel was characterised by subsurface hypomineralisation, interpreted as a result of fluoride interference with the process of enamel maturation. In addition, an accentuation of the incremental pattern due to the occurrence of alternating bands with highly varying mineral content was observed in severely fluorosed teeth, denoting fluoride disturbance during the secretory stage of amelogenesis. A corresponding enhancement of the incremental pattern was also seen in the dentine. The enamel along the more pronounced hypoplasias consisted of stacked, thin layers of crystals arranged in parallel, indicating that the ameloblasts in these locations had lost the distal (prism-forming) portions of their Tomes processes. The findings of the present study indicate that red deer are highly sensitive bioindicators of environmental pollution by fluorides

  8. A Non-Destructive Method for Distinguishing Reindeer Antler (Rangifer tarandus) from Red Deer Antler (Cervus elaphus) Using X-Ray Micro-Tomography Coupled with SVM Classifiers (United States)

    Lefebvre, Alexandre; Rochefort, Gael Y.; Santos, Frédéric; Le Denmat, Dominique; Salmon, Benjamin; Pétillon, Jean-Marc


    Over the last decade, biomedical 3D-imaging tools have gained widespread use in the analysis of prehistoric bone artefacts. While initial attempts to characterise the major categories used in osseous industry (i.e. bone, antler, and dentine/ivory) have been successful, the taxonomic determination of prehistoric artefacts remains to be investigated. The distinction between reindeer and red deer antler can be challenging, particularly in cases of anthropic and/or taphonomic modifications. In addition to the range of destructive physicochemical identification methods available (mass spectrometry, isotopic ratio, and DNA analysis), X-ray micro-tomography (micro-CT) provides convincing non-destructive 3D images and analyses. This paper presents the experimental protocol (sample scans, image processing, and statistical analysis) we have developed in order to identify modern and archaeological antler collections (from Isturitz, France). This original method is based on bone microstructure analysis combined with advanced statistical support vector machine (SVM) classifiers. A combination of six microarchitecture biomarkers (bone volume fraction, trabecular number, trabecular separation, trabecular thickness, trabecular bone pattern factor, and structure model index) were screened using micro-CT in order to characterise internal alveolar structure. Overall, reindeer alveoli presented a tighter mesh than red deer alveoli, and statistical analysis allowed us to distinguish archaeological antler by species with an accuracy of 96%, regardless of anatomical location on the antler. In conclusion, micro-CT combined with SVM classifiers proves to be a promising additional non-destructive method for antler identification, suitable for archaeological artefacts whose degree of human modification and cultural heritage or scientific value has previously made it impossible (tools, ornaments, etc.). PMID:26901355

  9. Uzgoj običnoga jelena (Cervus elaphus L.) u kontroliranim uvjetima u ograđenom prostoru Šeprešhat


    Grubešić, Marijan; Urošević, Branko; Mihaljević, Zlatan; Tomljanović, Kristijan


    Ograđeni prostor Šeprešhat namijenjen je intenzivnomu uzgoju običnoga jelena u kontroliranim uvjetima. Svrha je takva uzgoja proizvodnja visokovrijednoga baranjskoga jelena s mogućnošću distribucije kvalitetnoga rasplodnoga materijala u druga lovišta Republike Hrvatske. Uzgoj je jelena započeo još 2002. godine s prvim hvatanjima i ispuštanjima teladi u ograđeni prostor. Ograđeni prostor Šeprešhat u međuvremenu se postupno širio te od početnih 53 ha danas ima 380 ha. Prostor je razdijeljen na ...

  10. The Influence of Snow Cover Changes on Red Deer (Cervus elaphus L. Migrations in the Western Part of Gorski Kotar Region in Croatia

    Directory of Open Access Journals (Sweden)

    Josip Malnar


    Full Text Available Background and Purpose: Animal migrations are a direct result of reproduction, behaviour characteristics, predators, population density, disturbance, loss of habitat, climatic, vegetational and nutritional factors. The availability and accessibility of natural food in winter months is dependent on snow cover. The main objective of this study was to determine the migrational activities of red deer and to examine the dependency between migrations and climatic factors. Materials and Methods: The study was carried out in the northwest Dinarid mountains, i.e. in the western part of Gorski Kotar region, which represents a large integral forest complex, distinctive due to its significant vertical drops, diverse relief characteristics and habitat conditions. Data on red deer migrations was collected over a 12 year period from hunting records, gamekeeper logs and records from game counting and monitoring. Results and Conclusions: The results of the macroclimatic analysis show a statistically significant difference (p<0.05 between the monitored weather stations in the study area. The Klana site stood out as the most appropriate red deer winter habitat, based on climatic conditions. Climatic conditions play a key role in seasonal red deer migrations or non-migrations. The Crni Lug site was assessed to be the least favourable due to macroclimatic conditions (snow depth.

  11. Environ: E00332 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00332 Cervus male sex organ Crude drug Cervus elaphus [TAX:9860], Cervus nippon [T...AX:9863] Cervidae Cervus male sex organ Crude drugs [BR:br08305] Animals Mammals E00332 Cervus male sex organ ...

  12. Validación y uso de Espectrocopía de Infrarrojo Cercano (NIRS) para el estudio de alimentación de ciervo (Cervus elaphus hispanicus) y gamo (Dama dama) en ecosistemas mediterráneos


    Tellado-Ruiz, María-Sierra


    [ES]En este estudio desarrollamos y validamos un método de Espectroscopía de Reflectancia en la región del infrarrojo cercano (NIRS) para determinar, de forma indirecta a partir de heces, la calidad de la dieta de dos especies de cérvidos en ambiente mediterráneo. Se estudió el contenido de fibra ácido detergente (ADF) y fibra neutro detergente (NDF), el contenido de lignina, el índice de carbono/nitrógeno (C:N), la digestibilidad enzimática (EDOM) y de la pared celular (CWD), la cantidad de ...

  13. Modelli di valutazione ambientale per i Bovidi (Capra ibex, Rupicapra rupicapra e i Cervidi (Capreolus capreolus, Cervus elaphus nel Parco Nazionale del Gran Paradiso

    Directory of Open Access Journals (Sweden)

    C. Oppio


    Full Text Available La conservazione delle popolazioni di stambecco ha grande rilevanza a livello italiano ed europeo, a causa della distribuzione concentrata in poche aree, mentre le consistenti popolazioni di camoscio hanno importanza economica e gestionale. L?espansione dell?areale di distribuzione dei cervidi in territorio alpino, è un fenomeno ormai consolidato e legato all?abbandono dei territori collinari e montani ma anche alle reintroduzioni e alle azioni di tutela nei confronti delle specie. I modelli d?idoneità ambientale rappresentano un efficace strumento per il confronto a livello qualitativo (numero di specie e quantitativo (abbondanza delle popolazioni tra l?attuale popolamento faunistico dei territori alpini e la loro situazione potenziale. Il Parco Nazionale del Gran Paradiso si estende per oltre 700 km² sul territorio di Piemonte e di Valle d?Aosta; gli affioramenti rocciosi ne occupano il 37.0%, la vegetazione rada il 20.1% e le praterie sommitali e le brughiere il 17.3%. L?analisi ambientale del Parco è stata effettuata mediante Arcview 3.2 per Windows misurando il valore di 20 variabili ambientali (Corine Land Cover III Liv., 27 fisiche (DTM e 17 di complessità paesaggistica in 2925 Unità Campione di 0,5 km di lato. Per la formulazione dei modelli relativi alla distribuzione (presenza/assenza dello stambecco sono stati utilizzati i dati dei censimenti (1999 effettuati nel Parco; per il camoscio ed il capriolo sono stati utilizzati i dati rilevati nelle province di Vercelli e Biella (1997 e in quella di Verbania (1999, mentre per il cervo sono stati utilizzati quelli relativi alla sola provincia di Verbania (1999. I modelli sono stati formulati mediante Analisi di Funzione Discriminante (Magnusson, 1983; Massolo & Meriggi, 1995 e Analisi di Regressione Logistica (Norusis, 1994. Per lo stambecco i dati sono stati suddivisi in due sets, di cui uno utilizzato per la formulazione del modello e l?altro per la sua validazione. Mediante un test del chi-quadrato sono state confrontate le percentuali di casi classificati nei due sets. Per le altre specie i modelli formulati sono stati applicati al territorio del parco e la validità dei modelli è stata valutata dalla percentuale di casi originali riclassificati correttamente. Per i bovidi il modello a maggior capacità predittiva è stato quello discriminante (classificazioni corrette: 73.0% per stambecco e 82.8% per camoscio. La non significatività del test Χ² (P=0.470 indica che non esistono differenze significative tra la distribuzione reale dello stambecco e quella ottenuta dal modello. L'81.1% del territorio del Parco è idoneo al camoscio alpino e l'area vocata include il 93.6% del territorio realmente occupato dalla specie. Per il capriolo il modello logistico è stato quello a maggior capacità predittiva (88.1% dei casi originali classificati correttamente, individuando il 50.7% del territorio realmente occupato dalla specie. Anche per il cervo quello logistico è preferibile per la maggiore percentuale di casi totali classificati correttamente (AFD: 74.9%; ARL: 76.0%.

  14. Podiel drevín v potrave jeleňa lesného (Cervus elaphus) a srnca hôrneho (Capreolus capreolus) v lužnom lese

    Czech Academy of Sciences Publication Activity Database

    Prokešová, Jarmila; Barančeková, Miroslava

    Zvolen: Technická univerzita, 2003, s. 161-166. [Nové trendy v ochrane lesa. Zvolen (SK), 23.01.2003-24.01.2003] R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : deer * floodplain forest * food Subject RIV: EH - Ecology, Behaviour

  15. Selezione invernale dell'habitat e densità del cervo (Cervus elaphus e del capriolo (Capreolus capreolus nel Parco Nazionale d'Abruzzo

    Directory of Open Access Journals (Sweden)

    R. Latini


    Full Text Available Nel Parco Nazionale d'Abruzzo è stata studiata la selezione dell'habitat invernale di cervo e capriolo da aprile a maggio del 2000 e del 2002, in un'area caratterizzata da boschi di faggio, rimboschimenti a pino nero e pascoli. È stata utilizzata la tecnica del pellet group count, su transetti lineari larghi 2 metri, individuati ogni 100 m di quota, lungo le isoipse da 1350 a 1950 m s.l.m. Sono stati percorsi 61 km ed è stata campionata un'area di 12 ha. Per ogni gruppo di escrementi (1583 per il cervo e 946 per il capriolo sono state rilevate l'altitudine, la pendenza, l'esposizione e il tipo di vegetazione. È stato assunto che tutti gli habitat fossero ugualmente disponibili ed accessibili e che le disponibilita fossero conosciute (Alldredge et al., 1998. I dati raccolti sono stati elaborati applicando il test del Χ², la statistica di Bonferroni (Neu et al., 1974 e l'indice Jacobs (Jacobs, 1974. Il cervo ha selezionato aree comprese tra 1300 e 1500 m s.l.m. (p<0.01, un range altimetrico più ristretto rispetto al capriolo che seleziona anche le quote piu elevate, comprese cioè tra 1300 e 1700 m s.l.m. (p<0.01. Entrambi i cervidi selezionano le zone più scoscese (21°-60° (p<0.01: Il cervo seleziona le classi d'esposizione comprese tra sud-est ed ovest (p<0.01, mentre il capriolo i versanti sud-ovest e ovest (p<0.01. Entrambe le specie preferiscono ambienti di transizione ed evitano le zone di bosco maturo ed i pascoli d'alta quota (p<0.01. Utilizzando il tasso di defecazione è stata calcolata la densità delle due specie (Mayle, 1999 che è risultata di 2.7 cervi/100 ha e 1.0 caprioli/100 ha. Le due specie selezionano le stesse risorse, suggerendo, così come riscontrato da altri autori (Welch, 1989, una convergenza per quanto riguarda l'uso invernale dell'habitat. La scelta d'aree poste a quote medio-basse, di zone scoscese e di versanti meridionali potrebbe essere legata alla minore altezza e persistenza del manto nevoso (Mysterud et al., 1997. La scelta di aree ecotonali e zone di bosco con soprassuolo forestale articolato potrebbe essere messo in relazione sia al più elevato valore trofico di questi habitat, sia alla maggiore disponibilità di siti di riparo. I risultati trovano riscontro in uno studio analogo condotto nel Parco Naturale Adamello-Brenta (Pedrotti & Mustoni, 1994 e rappresentano il primo contributo alla conoscenza di queste due popolazioni all'interno del Parco a 30 anni dalla loro reintroduzione.

  16. 马鹿生长激素(GH)基因生物信息学预测及分析%Bioinformatics Prediction and Analysis on GH Gene of Cervus elaphus

    Institute of Scientific and Technical Information of China (English)

    宋兴超; 杨福合; 刘汇涛; 徐超; 魏海军; 邢秀梅


    In order to study the structure and function of GH gene of wapiti, coding sequences(CDS) of GH gene in wapiti, sika deer, chevrotain, cattle, goat, sheep, pig, human, chimpanzee, Norway rat, house mouse, arctic fox, dog, chicken and zebrafish were downloaded from GenBank as experimental ma- terials. Bioinformaties analysis was made on basic information and encoding protein structure, physic- chemical property, signal peptide, transmembrane structure, generic phosphorylation sites, secondary structure and subcellular localization were predicted by means of biologic software and online tools. In ad- dition, the similarity of GH gene CDS sequence and amino acid between those of wapiti and other 14 species were also analyzed. Phylogentic tree of the homologous gene based on the amino acid of GH gene was constructed. The results showed that the length of wapiti GH gene was 2 100 bp, which included 5 exons, 4 introns, partial 5'UTR and 3'UTR, and it contained an open reading frame of 654 bp, which encoded 217 amino acids. The estimated molecular weight of GH protein was 24.588 4 ku, with a iso- electric point of 7.62 and 31.04 in stability index, belonging to the stable alkalinous protein with hy- drophobicity. The GH protein had two obvious strong transmembrane region, eight phosphorylation sites. The secondary structure of GH protein was mainly α-helix and irregular curly. The extracellular protein contained one signal peptide was probably being secreting type. The similarity comparison and phyloge- netic tree indicated that the evolution distance of wapiti GH gene was the most homogeneous to sika deer, chevrotain, cattle, goat and sheep. The research provided detailed bioinformatics information for further study on GH gene of wapiti.%为研究马鹿生长激素(GH)基因的结构和功能,从GenBank中下载马鹿、梅花鹿、鼷鹿、牛、山羊、绵羊、猪、人、黑猩猩、挪威大鼠、小家鼠、北极狐、狗、鸡和斑马鱼的GH基因完整编码区(CDS)及氨基酸序列,利用DNAStar 7.0、BioEdit 7.0生物软件与相关在线工具对马鹿GH基因核苷酸序列的基本信息及其编码蛋白的理化特性和结构特征进行了生物信息学预测及分析,对马鹿与其他14个物种GH基因的CDS序列及其编码氨基酸序列进行相似性分析,并基于氨基酸序列构建了15个物种的系统进化树。结果表明:马鹿GH基因DNA序列长度为2 100 bp,包括完整的5个外显子和4个内含子,部分5′UTR和3′UTR,CDS全长654 bp,编码217个氨基酸;其编码的蛋白是一种分子质量为24.588 4 ku,等电点为7.62的疏水性稳定碱性蛋白;存在2个强跨膜区、8个广泛磷酸化位点,二级结构元件以α-螺旋和无规则卷曲为主;该蛋白位于细胞外,含有1个信号肽,属一种分泌型蛋白;马鹿与梅花鹿、牛、绵羊、山羊和鼷鹿等动物的GH基因氨基酸序列相似性较高,亲缘关系最近。该研究结果可为马鹿GH基因的进一步分析提供详细的生物学基础信息。

  17. Složení potravy jelena lesního (Cervus elaphus) a srnce lesního (Capreolus capreolus) v NP a CHKO Šumava a Bavorský les

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Krojerová-Prokešová, Jarmila; Šustr, P.; Heurich, M.

    Brno: Ústav biologie obratlovců AV ČR, 2009 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 27-28 ISBN 978-80-87189-03-0. [Zoologické dny. 12.02.2009-13.02.2009, Brno] Institutional research pla n: CEZ:AV0Z60930519 Keywords : analyses * deer browse * faeces Subject RIV: GK - Forestry

  18. Welfare pro velké cervidy - zohlednění potřeb jelenovitých (Cervidae) a možnosti jejich naplnění v expozicích zoo Brno


    Přichystalová, Michala


    Many species of deer family (Cervidae) are common among the inmates zoos and similar livestock farms. Center of radiation biungulates deer family was Asia, deer now inhabit all continents except Antarctica. The zoo in Brno kepts following species: Siberian deer (Cervus elaphus sibiricus) inhabit the forested areas of Southeast Asia. In the older literature is cited as subspecies of deer (Cervus elaphus), modern science provides evidence of a greater relationship with wapiti (Cervus canadensis...

  19. Migrations and management of the Jackson elk herd (United States)

    US Fish and Wildlife Service, Department of the Interior — From April 1978 to April 1982, 85 adult (~2. 7 years-old) elk (Cervus elaphus nelsoni) were captured and radio-collared on the National Elk Refuge in northwestern...

  20. Genetic variability of sika and red deer populations in the Czech Republic based on mitochondrial DNA

    Czech Academy of Sciences Publication Activity Database

    Prokešová, Jarmila; Vallo, Peter; Barančeková, Miroslava; Koubek, Petr

    Primiero : Parco Naturale Paneveggio, 2007. s. 98. [International conference on genus Cervus 2007 /1./. 14.09.2007-17.09.2007, Primiero] R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon * Cervus elaphus * control region * cytochrome b gene * genetic variability Subject RIV: EB - Genetics ; Molecular Biology

  1. Guía para la determinación de la edad del ciervo ibérico (Cervus elaphus hispanicus) a través de su dentición: revisión metodológica y técnicas de elección


    Azorit Casas, Concepción E.


    La determinación de la edad de los ciervos cazados es fundamental e imprescindible para valorar tanto la calidad individual como la calidad de la población en su conjunto y pone en perspectiva cuestiones sobre gestión y manejo. La determinación de la edad es la mejor fuente de información para evaluar los resultados de la gestión desarrollada, monitorizar el cumplimiento de los objetivos marcados a medio y largo plazo, y valorar las consecuencias de prácticas de manejo anteriores. También con...

  2. Habitat acoustics of Rocky Mountain elk in Colorado and European Red deer in Denmark

    DEFF Research Database (Denmark)

    Riede, Tobias; Jensen, Kenneth Kragh; Larsen, Ole Næsbye;

      Male vocal displays are rarely so dramatically different in closely related subspecies as in Cervus elaphus. Many studies investigated the evolution of the European Red deer low pitched roaring sounds, but little is known about why the Rocky Mountain elk evolved high pitched bugles. We investig......  Male vocal displays are rarely so dramatically different in closely related subspecies as in Cervus elaphus. Many studies investigated the evolution of the European Red deer low pitched roaring sounds, but little is known about why the Rocky Mountain elk evolved high pitched bugles. We...

  3. Brucellosis in the United States: Role and Significance of Wildlife Reservoirs (United States)

    Regulatory programs for brucellosis in domestic livestock have been active in the United States for almost 80 years. Wildlife reservoirs of brucellosis include bison (Bison bison) and elk (Cervus elaphus nelsonii) for B. abortus whereas B. suis is the predominant species infecting feral swine. The...

  4. Eurasian lynx hunting red deer: is there an influence of a winter enclosure system?

    Czech Academy of Sciences Publication Activity Database

    Belotti, E.; Kreisinger, Jakub; Romportl, D.; Heurich, M.; Bufka, L.


    Roč. 60, č. 3 (2014), s. 441-457. ISSN 1612-4642 Institutional support: RVO:68081766 Keywords : Cervus elaphus * Habitat heterogeneity * Lynx lynx * Predation probability * Prey density * Supplementary feeding Subject RIV: EG - Zoology Impact factor: 1.634, year: 2014

  5. Native red deer and introduced chamois: foraging habits and competition in a subalpine meadow-spruce forest area

    Czech Academy of Sciences Publication Activity Database

    Homolka, Miloslav; Heroldová, Marta


    Roč. 50, č. 2 (2001), s. 89-98. ISSN 0139-7893 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6093917 Keywords : Cervus elaphus * Rupicapra rupicapra * foraging strategy Subject RIV: EG - Zoology Impact factor: 0.287, year: 2001

  6. Solar Radiation Determines Site Occupancy of Coexisting Tropical and Temperate Deer Species Introduced to New Zealand Forests


    Robert B Allen; Forsyth, David M.; Allen, Roy K. J.; Affeld, Kathrin; MacKenzie, Darryl I.


    Assemblages of introduced taxa provide an opportunity to understand how abiotic and biotic factors shape habitat use by coexisting species. We tested hypotheses about habitat selection by two deer species recently introduced to New Zealand’s temperate rainforests. We hypothesised that, due to different thermoregulatory abilities, rusa deer (Cervus timorensis; a tropical species) would prefer warmer locations in winter than red deer (Cervus elaphus scoticus; a temperate species). Since adult m...

  7. Is there any evidence of their crossbreeding in captive and/or in free-living populations?

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Voloshina, I. V.; Kawata, Y.; Oshida, T.; Igota, H.; Lamka, J.; Koubek, Petr

    Huilo Huilo: Fundacion Huilo Huilo, 2010 - (Werner-Flueck, J.; Charrier, A.). s. 38-39 [International Deer Biology Congress /7./. 02.08.2010-07.08.2010, Huilo Huilo] R&D Projects: GA ČR GA524/09/1569 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon * Cervus elaphus * hybridization * microsatellite loci * conservation Subject RIV: EG - Zoology

  8. Reproductive biotechnologies: a new approach for Cervids conservation


    Uccheddu, Stefania


    Reproductive biotechnologies have great potential as a tool for the conservation of endangered mammal species. We tried to apply some assisted reproductive techniques (ART) in the sardinian regional context, widely considered for its peculiar biodiversity. Our research had been driven in particular at cervids, Fallow deer (Dama dama, Linneus 1758) and Sardinian red deer (Cervus elaphus corsicanus, Exrleben 1777). This subspecies is strictly protected and is included as a Near Threatened on th...

  9. Cost–Benefit Analyses of Mitigation Measures Aimed at Reducing Collisions with Large Ungulates in the United States and Canada: a Decision Support Tool


    Robert J. Ament; Anthony P. Clevenger; John W. Duffield; Huijser, Marcel P.; Pat T. McGowen


    Wildlife–vehicle collisions, especially with deer (Odocoileus spp.), elk (Cervus elaphus), and moose (Alces alces) are numerous and have shown an increasing trend over the last several decades in the United States and Canada. We calculated the costs associated with the average deer–, elk–, and moose–vehicle collision, including vehicle repair costs, human injuries and fatalities, towing, accident attendance and investigation, monetary value to hunters of the animal kil...

  10. Trophic facilitation by introduced top predators: grey wolf subsidies to scavengers in Yellowstone National Park


    Wilmers, C C; Crabtree, R L; Smith, D. W.; Murphy, K M; Getz, Wayne M.


    1. The reintroduction of grey wolves Canis lupus (L.) to Yellowstone National Park provides a natural experiment in which to study the effects of a keystone predator on ecosystem function. 2. Grey wolves often provision scavengers with carrion by partially consuming their prey. 3. In order to examine how grey wolf foraging behaviour influences the availability of carrion to scavengers, we observed consumption of 57 wolf-killed elk Cervus elaphus (L.) and determined the percentage of edible bi...

  11. Association analysis of PRNP gene region with chronic wasting disease in Rocky Mountain elk


    Spraker Terry R; White Stephen N; Reynolds James O; O'Rourke Katherine I


    Abstract Background Chronic wasting disease (CWD) is a transmissible spongiform encephalopathy (TSE) of cervids including white-tailed (Odocoileus virginianus) and mule deer (Odocoileus hemionus), Rocky Mountain elk (Cervus elaphus nelsoni), and moose (Alces alces). A leucine variant at position 132 (132L) in prion protein of Rocky Mountain elk confers a long incubation time with CWD, but not complete resistance. However, variants in regulatory regions outside the open reading frame of PRNP h...

  12. Babesia spp. in European wild ruminant species: parasite diversity and risk factors for infection.


    Michel, Adam O; Mathis, Alexander; Ryser-Degiorgis, Marie-Pierre


    Babesia are tick-borne parasites that are increasingly considered as a threat to animal and public health. We aimed to assess the role of European free-ranging wild ruminants as maintenance mammalian hosts for Babesia species and to determine risk factors for infection. EDTA blood was collected from 222 roe deer (Capreolus c. capreolus), 231 red deer (Cervus e. elaphus), 267 Alpine chamois (Rupicapra r. rupicapra) and 264 Alpine ibex (Capra i. ibex) from all over Switzerland and analysed by P...

  13. Babesia spp. in European wild ruminant species: parasite diversity and risk factors for infection


    Michel, Adam O; Mathis, Alexander; Ryser-Degiorgis, Marie-Pierre


    Babesia are tick-borne parasites that are increasingly considered as a threat to animal and public health. We aimed to assess the role of European free-ranging wild ruminants as maintenance mammalian hosts for Babesia species and to determine risk factors for infection. EDTA blood was collected from 222 roe deer (Capreolus c. capreolus), 231 red deer (Cervus e. elaphus), 267 Alpine chamois (Rupicapra r. rupicapra) and 264 Alpine ibex (Capra i. ibex) from all over Switzerland and analysed by P...

  14. Immune Responses of Elk to Initial and Booster Vaccinations with Brucella abortus Strain RB51 or 19


    S. C. Olsen; Fach, S. J.; Palmer, M. V.; Sacco, R. E.; Stoffregen, W. C.; Waters, W.R.


    Previous studies have suggested that currently available brucellosis vaccines induce poor or no protection in elk (Cervus elaphus nelsoni). In this study, we characterized the immunologic responses of elk after initial or booster vaccination with Brucella abortus strains RB51 (SRB51) and 19 (S19). Elk were vaccinated with saline or 1010 CFU of SRB51 or S19 (n = seven animals/treatment) and booster vaccinated with a similar dosage of the autologous vaccine at 65 weeks. Compared to nonvaccinate...

  15. Fire behaviour and impact on heather moorland


    Davies, Gwilym Matthew


    For roughly the past 200 years land-managers have used the practice of “muirburning” to manipulate the structure of heather (Calluna vulgaris) to create a patchwork of habitat structures able to provide forage and nesting sites for red grouse (Lagopus lagopus scoticus) as well as grazing for sheep (Ovis aries) and red deer (Cervus elaphus). This thesis investigates both the behaviour and impact of management fires in recognition of the need to develop multi-aim land management practices ...

  16. Characteristics of PCR-SSCP and RAPD-HPCE methods for identifying authentication of Penis et testis cervi in Traditional Chinese Medicine based on cytochrome b gene. (United States)

    Li, Mingcheng; Gao, Lijun; Qu, Li; Sun, Jingyu; Yuan, Guangxin; Xia, Wei; Niu, Jiamu; Fu, Guilian; Zhang, Lihua


    The use of Penis et testis cervi, as a kind of precious Traditional Chinese Medicine (TCM), which is derived from dry deer's testis and penis, has been recorded for many years in China. There are abundant species of deer in China, the Penis et testis from species of Cervus Nippon and Cervus elaphusL were authentic, others species were defined as adulterant (different subspecies of deer) or counterfeits (different species). Identification of their origins or authenticity becomes a key in controlling the herbal products. A modified column chromatography was used to extract mitochondrial DNA of dried deer's testis and penis from sika deer (C. Nippon) and red deer (C. elaphusL) in addition to adulterants and counterfeits. Column chromatography requires for a short time to extract mitochondrial DNA of high purity with little damage of DNA molecules, which provides the primary structure of guarantee for the specific PCR; PCR-SSCP method showed a clear intra-specific difference among patterns of single-chain fragments, and completely differentiate Penis et testis origins from C. Nippon and C. elaphusL. RAPD-HPCE was based on the standard electropherograms to compute a control spectrum curve as similarity reference (R) among different samples. The similarity analysis indicated that there were significant inter-species differences among Penis et testis' adulterant or counterfeits. Both techniques provide a fast, simple, and accurate way to directly identify among inter-species or intra-species of Penis et testis. PMID:26309015

  17. Risk assessment of Sika deer Cervus nippon in the Netherlands


    Lammertsma, D.R.; Groot Bruinderink, G.W.T.A.; Griffioen, A.J.


    Sika Deer (Cervus nippon) is considered an invasive alien species in Europe. They were introduced in the 19th and 20th century in Europe and have established self-sustaining populations in various countries. Main concerns for Sika, without preventive measures taken and without population control, are about damage to forestry (silviculture, timber production), agriculture, Natura 2000 areas, competition with native ungulates and hybridization and introgression with native Red Deer. Risk assess...

  18. Reprodukce siky (Cervus nippon) na Plzeňsku


    Husinec, Václav


    This thesis examines the impact of the age of female sika deer on the weight of embryos of sika deer Cervus nippon nippon in the North Pilsen Region. From 2011 to the start of 2013 hunted down female sika deer were examined to establish the presence of embryos. Embryos were subsequently taken out of the hunted deer and analysed. The location of Košetice was selected to collate the data necessary. The location and the method of collation of data has been described in one of the chapters of thi...

  19. Descriptive epidemiology of captive cervid herds in Michigan, USA. (United States)

    Bruning-Fann, C S; Shank, K L; Kaneene, J B


    A study was designed to determine the species composition, disease period prevalence, and utilization of preventive practices in captive cervid herds in Michigan. This is the first description of cervid farming in the United States. Data for the 12 months preceding the study were collected by means of a mail questionnaire conducted from March 3 through June 28, 1993. Completed questionnaires were returned by 228 of 362 (63%) farms. Study respondents reported ownership of a total of 4972 (80.9%) white-tailed deer (Odocoileus virginianus), 766 (12.5%) elk (Cervus elaphus canadensis), 284 (4.6%) fallow deer (Dama dama), 114 (1.9%) sika deer (Cervus nippon), 6 (0.1%) red deer (Cervus elaphus), 4 (treatment of injuries (27.7% [44/159]), anthelmintic administration (25.2% [40/159]), issuance of health certificates (19.5% [31/159]), diagnosis and treatment of illnesses (17.6% [28/159]), vaccination (13.8% [22/159]), disease diagnosis (treatment provided by farmer) (8.8% [14/159]), foot care (3.8% [6/159]), and other purposes (ie, necropsy, dystocia, antler removal) (11.3% [18/159]). PMID:9208449

  20. Late Pleistocene/Early Holocene Migratory Behavior of Ungulates Using Isotopic Analysis of Tooth Enamel and Its Effects on Forager Mobility. (United States)

    Pilaar Birch, Suzanne E; Miracle, Preston T; Stevens, Rhiannon E; O'Connell, Tamsin C


    Zooarchaeological and paleoecological investigations have traditionally been unable to reconstruct the ethology of herd animals, which likely had a significant influence on the mobility and subsistence strategies of prehistoric humans. In this paper, we reconstruct the migratory behavior of red deer (Cervus elaphus) and caprids at the Pleistocene-Holocene transition in the northeastern Adriatic region using stable oxygen isotope analysis of tooth enamel. The data show a significant change in δ18O values from the Pleistocene into the Holocene, as well as isotopic variation between taxa, the case study sites, and through time. We then discuss the implications of seasonal faunal availability as determining factors in human mobility patterns. PMID:27275784

  1. Niche relationships within a guild of ungulate species in Yellowstone National Park, Wyoming, following release from artificial controls (United States)

    Singer, Francis J.; Norland, Jack E.


    Niche relationships and diet overlaps were compared among elk (Cervus elaphus), bison (Bison bison), bighorn sheep (Ovis canadensis), mule deer (Odocoileus hemionus), and pronghorn antelope (Antilocapra americana) between 1967–1970 and 1986–1988, a period when total ungulate numbers nearly tripled on Yellowstone's northern range. Ungulate species ratios on Yellowstone's northern winter range during the latter period were 100 elk : 10 mule deer : 3 bison : 2 pronghorns : 1 bighorns. Elk numbers were positively correlated to bison, mule deer, and pronghorn numbers (r2 = 0.76, 0.97, and 0.48, respectively, P niche relationships during a period of near tripling in density of the ungulate guild.

  2. Stime di consistenza del cervo sardo nell'oasi di Monte Arcosu mediante la tecnica del pellets-group count


    Murgia, Andrea; Cocco, Francesca; Murgia, Carlo; Deiana, Anna Maria


    This paper presents the results obtained during a research carried out from 2002 to 2003 in the Monte Arcosu Natural Park. The aim of this work has been to estimate the density values and the amount of population of Sardinian deer (Cervus elaphus corsicanus). Pellets-group count was the method used. Data obtained show the average density values in the study area (29.9 SE = 5.8 deer/Km2). A higher value has been obtained in the inner part of the Park. Data show that population is constant duri...

  3. Late Pleistocene/Early Holocene Migratory Behavior of Ungulates Using Isotopic Analysis of Tooth Enamel and Its Effects on Forager Mobility (United States)

    Pilaar Birch, Suzanne E.; Miracle, Preston T.; Stevens, Rhiannon E.; O’Connell, Tamsin C.


    Zooarchaeological and paleoecological investigations have traditionally been unable to reconstruct the ethology of herd animals, which likely had a significant influence on the mobility and subsistence strategies of prehistoric humans. In this paper, we reconstruct the migratory behavior of red deer (Cervus elaphus) and caprids at the Pleistocene-Holocene transition in the northeastern Adriatic region using stable oxygen isotope analysis of tooth enamel. The data show a significant change in δ18O values from the Pleistocene into the Holocene, as well as isotopic variation between taxa, the case study sites, and through time. We then discuss the implications of seasonal faunal availability as determining factors in human mobility patterns. PMID:27275784

  4. Etologie jelení zvěře v přezimovacích obůrkách


    Kocán, Jaroslav


    Abstrakt The main part of the Bachelor degree thesis “The ethology of red deer in the winter enclosures”, is an effort to compare the differences between the behavior of deer in the winter enclosure with the ecological demands and the way of life in the wild. The work is mainly focused on Red deer (Cervus elaphus) ethology. The focus is primarily on deer´s ethology during the winter season, for which there is a period of emergency. Game changes their food habits and home area claims during...

  5. Field evaluation of the efficacy of fenbendazole in captive wild ruminants. (United States)

    Goossens, E; Dorny, P; Vercammen, F; Vercruysse, J


    The efficacy of in-feed fenbendazole at a dose rate of 7.5 mg/kg bodyweight for three consecutive days was assessed in five Arabian oryx (Oryx leucoryx), six scimitar-horned oryx (Oryx dammah), 14 slender-horned gazelles (Gazella leptoceros), eight Soay sheep (Ovis aries aries soay), 13 alpine ibex (Capra ibex ibex), six red deer (Cervus elaphus hippelaphus) and 11 Nelson's elk (Cervus elaphus nelsoni) kept in five herds in a zoo. The efficacy was assessed by means of repeated faecal egg count reduction (fecr) tests and in vitro egg hatch assays. Fenbendazole was highly effective against nematodes in five of the seven species, consistently reducing egg shedding by more than 90 per cent. In the egg hatch assays of the five herds, 50 per cent inhibition of hatching (ld50) was observed at a concentration of thiabendazole below 0.1 microg/ml. In the Arabian oryx and alpine ibex the efficacy of fenbendazole was less than 90 per cent, and the ld50 in the egg hatch assays was between 0.1 and 0.2 microg/ml thiabendazole. PMID:16272545

  6. La espátula de Boppard (Boppard, Renania-Palatinado, Alemania y sus paralelos en Europa a finales del Paleolítico superior y en el Mesolítico

    Directory of Open Access Journals (Sweden)

    Stefan WENZEL


    Full Text Available RESUMEN: En el Paleolítico superior final del yacimiento de Boppard se ha documentado una espátula realizada a partir de la cara posterior de un metatarso de Cervus elaphus. La pieza posee decoración en ambos bordes que consiste en incisiones paralelas horizontales orientadas en el sentido longitudinal del hueso. Estas incisiones están dispuestas en grupos, separadas por zonas del hueso sin decoración. Se estudian piezas de similares características procedentes principalmente de la región cantábrica, pero también de Francia, de Italia, de Alemania, de la República Checa y de Suecia. En lo referente a su posición cronológica los mejores paralelos de la espátula de Boppard proceden de finales del Paleolítico superior.ABSTRACT: A spatula recovered from the Late Palaeolithic site of Boppard is manufactured on a fragment of the plantar face of a metatarsal bone of red deer (Cervus elaphus. Along its narrow side, the tool exhibits numerous parallel notches at right angles to the longitudinal axis of the bone. These are arranged in groups separated by notch-free areas of bone. Comparable bone tools are described, mainly from Cantabrian Spain, but also from France, Italy, Germany, the Czech Republik and Sweden. The best paralells for the Boppard specimen are, insofar as they are dated, known from the Later Upper Palaeolithic.

  7. Faunal migration in late-glacial central Italy: implications for human resource exploitation. (United States)

    Pellegrini, Maura; Donahue, Randolph E; Chenery, Carolyn; Evans, Jane; Lee-Thorp, Julia; Montgomery, Janet; Mussi, Margherita


    The hunter-gatherer transhumance model presents foragers as specialised hunters of migratory ungulates, which moved seasonally between coastal lowlands and interior uplands. We studied six animal teeth of horse (Equus hydruntinus) and red deer (Cervus elaphus) from four different archaeological sites: the Grotta di Vado all'Arancio, Grotta di Settecannelle, Grotta Polesini and Grotta di Pozzo, in central Italy to test whether the migratory patterns and seasonal variations recorded in their teeth were consistent with expectations of the transhumance model for this region during the late Upper Palaeolithic. Sequential sub-samples of enamel were analysed from each tooth for oxygen, carbon and strontium isotope ratios to reconstruct mobility and yearly seasonal variations. The results show little evidence that these animals were moving over different geological terrains throughout the year, although small variations in Sr isotope ratios and concentrations were detected that corresponded to probable seasonal variations as shown by variability in oxygen isotope sequences. The results do, however, demonstrate that Cervus elaphus and Equus hydruntinus had different ranging behaviours, with the former moving over wider areas than the latter. This methodology produces results appropriate to assess animal migratory behaviour and, in turn, to test the consistency of proposed models of hunter-gatherer subsistence and mobility strategies. PMID:18537188

  8. Genetic analysis of evolutionary relationships among deer (subfamily Cervinae). (United States)

    Emerson, B C; Tate, M L


    The evolutionary relationships among 10 taxa of deer from the four genera of the subfamily Cervinae (Cervus, Elaphurus, Axis, and Dama) were examined by a comparison of their electrophoretic types for 22 proteins. We analyzed the data using both phenetic and cladistic methods and found that the genera of the Cervinae were not monophyletic. The genus Cervus was split into two distinct groups with red deer, wapiti (C. elaphus ssp.), and sika (C. nippon) in one clade and sambar (C. unicolor) and rusa (C. timorensis) in another. There was a close genetic relationship between the genus Elaphurus and the red deer, wapiti, sika group, whereas sambar and rusa were more similar to members of the genera Dama and Axis than to the other members of their own genus. These findings contrast with the taxonomy of the species that is based largely on studies of comparative morphology. Our samples (n = 5) showed fixed allelic differences between wapiti and red, wapiti and sika, and red and sika samples at 3, 6, and 7 loci, respectively. Analysis of these protein loci in a wider range of C. elaphus and C. nippon subspecies could resolve debate over the evolutionary relationships of these taxa. PMID:8340615

  9. Fauna de mamiferos del pleistoceno superior del yacimiento de las Majolicas (Granada

    Directory of Open Access Journals (Sweden)

    Alberdi, Mª T.


    Full Text Available In this paper we describe the fossils of macromarnmals provided by Las Majolicas site (Granada, Spain. This site was excavated in the 50's by E. Aguirre. The high frecuency of cervids with 469 fossils identified out of 558 is remarkable. We have compared Cervus elaphus from Las Majolicas with others that belong to the Cantabrian Range and we can conclude that they have smaller sizes, a fact which can be related to the more meridional situation of the site. According to the fauna that appears in Las Majolicas this site might be located in the Upper Pleistocene.En este trabajo se describen los fósiles de macromamíferos del yacimiento de Las Majolicas (Granada, España, excavado en la década de los cincuenta por E. Aguirre. En él predominan los cérvidos, con 469 restos identificados de un total de 558. Los restos de Cervus elaphus al compararlos con otros ejemplares del Pleistoceno superior de la Cordillera Cantábrica presentan un menor tamaño, lo cual podría indicar una reducción de la talla en relación al nivel más meridional de esta localidad. La fauna presente en Las Majolicas indica su posible asignación al Pleistoceno Superior

  10. Sequence Length Polymorphisms within Cervid AmelogeninX and AmelogeninY Genes: Use in Sex Determination

    Directory of Open Access Journals (Sweden)

    Benson H. Morrill


    Full Text Available Sequence length polymorphisms between the amelogeninX and amelogeninY genes have been utilized for the design of rapid PCR sex determination assays for various mammalian species, including four cervid species (Capreolus capreolus, Cervus elaphus, Cervus nippon, and Dama dama. Several of these assays have been shown to be able to determine sex from non-invasively collected samples such as hair roots, feces, or skeletal remains. Such assays can be helpful for both zoo and wildlife biologists for sex determination, and could possibly be further developed to aid in species identification and SNP analyses if sequence information is also available. In order to further study the amelogeninX and amelogeninY gene polymorphisms that exist within cervids, partial sequences from these genes were generated and analyzed in multiple amelogeninX and amelogeninY samples of mule deer (Odocoileus hemionus and Rocky Mountain elk (Cervus elaphus nelsoni; and single amelogeninX and amelogeninY samples of sika deer (Cervus nippon, fallow deer (Dama dama and axis deer (Axis axis. Within these five species, three sequence length polymorphism regions (two or more nucleotides inserted or deleted between samples were found. The lengths of these polymorphisms were 45, 9, and 9 nucleotides. In addition, a SNP was found in the amelogeninY sequences of the mule deer samples that were analyzed. Lastly, the primers used to amplify the regions of the amelogeninX and amelogeninY sequences were able to determine sex in all five species that were studied.

  11. Kajian kualitas daging rusa sambar (cervus unicolor) buru dan dipeliharaan secara intensif


    Sihombing, Juli Mutiara


    JULI MUTIARA SIHOMBING: The Meat Quality Sambar Deer (Cervus unicolor) Hunting and Intensive maintained deer, guided by RISTIKA HANDARINI and HERLA RUSMARILIN. Information about sambar meat quality is still lacking, especially the comparison between Sambar deer hunting and intensively maintained. The purpose of this study to examine differences in the quality of game and deer venison reared intensively given feed with crude protein 16%. The research was conducted in deer captivity at Univ...

  12. Detection of Rickettsia helvetica DNA from peripheral blood of Sika deer (Cervus nippon yesoensis) in Japan. (United States)

    Inokuma, Hisashi; Seino, Nobutaka; Suzuki, Masatsugu; Kaji, Koichi; Takahashi, Hiroshi; Igota, Hiromasa; Inoue, Satoshi


    Partial nucleotide sequences of the citrate synthase and 17-kDa genes of Rickettsia helvetica were detected from peripheral blood samples of Sika deer (Cervus nippon yesoensis) in Hokkaido, Japan. Results suggest the presence of a rickettsiemia associated with R. helvetica. This is the first evidence of R. helvetica infection in Sika deer and indicates that this species may represent a potential reservoir host of R. helvetica in Japan. PMID:18263833

  13. Určování domovského okrsku siky (Cervus nippon)


    Janda, Jakub


    This Bachelor thesis deals with available methods of research leads to monitoring of sika deer (Cervus nippon nippon) home range, with preference for telelmetric research. The knowledges that are key for better understanding and approach to the sika deer behavior and life strategy – species that population is rising to the essential quantity. Quantity that is vital not only for management of this species but also for his influence to the forestry – harms on forest vegetation. In this th...

  14. Telemetrické sledování siky (Cervus nippon)


    Dvořák, Stanislav


    In my thesis, I focused on the research of the spatial orientation of sika deer (Cervus nippon nippon) in Hradiste hunting using GPS devices. Research has been and still is carried on the forest Lomnica forest area. The first part is devoted to the description, morphology, biology, habitat and expansion of the sika deer, describe a device that is used to monitor and narcotization. The second part focuses on the experience I gained and assessed by telemetric monitoring and observation of this ...

  15. Haematological values of rusa deer (Cervus timorensis russa) in New Caledonia. (United States)

    Audigé, L


    Blood samples were collected from 91 rusa deer (Cervus timorensis russa), immediately after being shot, to define their mean haematological values (red cell count, white cell count, differential leucocyte count, packed cell volume, haemoglobin concentration, mean cell volume, mean cell haemoglobin, and mean cell haemoglobin concentration). Male deer had a significantly higher red cell count and haemoglobin concentration, and a lower mean cell volume and mean cell haemoglobin content, than did female deer. PMID:1288471



    Bambang Tjahyono Hariadi; Thimotius Sraun


    The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi) at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  17. Parelaphostrongylus tenuis-associated meningoencephalitis in a sika deer (Cervus nippon). (United States)

    Gerhold, Richard W; Keel, M Kevin; Arnold, Kim; Hotton, Doug; Beckstead, Robert B


    An adult, female, free-ranging, sika deer (Cervus nippon yakushimae) from Wicomico County, Maryland, USA, was found circling and having no fear of humans. The animal was euthanized and submitted for a postmortem exam. There were no gross lesions and the deer was negative for rabies. Microscopic examination revealed lymphoplasmacytic, neutrophilic, and eosinophilic meningoencephalitis with intralesional adult nematodes, larvae, and eggs consistent with nematodes in the family Protostrongylidae. Parelaphostrongylus tenuis was identified by polymerase chain reaction and DNA sequencing. To our knowledge, this is the first report of P. tenuis-associated encephalitis in a sika deer. PMID:20090046

  18. Surveillance of chronic wasting disease in sika deer, Cervus nippon, from Tokachi district in Hokkaido. (United States)

    Kataoka, Natsumi; Nishimura, Masakazu; Horiuchi, Motohiro; Ishiguro, Naotaka


    Surveillance of chronic wasting disease (CWD) was conducted by performing Western blot analysis of tissue samples from 136 sika deer (Cervus nippon) killed by hunters in the Tokachi district of Hokkaido Island. No prion protein (PrPSc) associated with CWD was detected in any of the samples. To assess amino acid polymorphisms of the sika deer PrP gene, nucleotide sequencing of the PrP gene was performed. The only amino acid polymorphisms detected were 3 silent mutations at nucleotide positions 63, 225 and 408. These results suggest that sika deer in the Tokachi district are genetically homogeneous, and are not infected with CWD. PMID:15805745

  19. Complete mitochondrial genome sequence of northeastern sika deer (Cervus nippon hortulorum). (United States)

    Shao, Yuanchen; Zha, Daiming; Xing, Xiumei; Su, Weilin; Liu, Huamiao; Zhang, Ranran


    The complete mitochondrial genome of the northeastern sika deer, Cervus nippon hortulorum, was determined by accurate polymerase chain reaction. The entire genome is 16,434 bp in length and contains 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and 1 control region, all of which are arranged in a typical vertebrate manner. The overall base composition of the northeastern sika deer's mitochondrial genome is 33.3% of A, 24.5% of C, 28.7% of T and 13.5% of G. A termination associated sequence and several conserved central sequence block domains were discovered within the control region. PMID:24660928


    Directory of Open Access Journals (Sweden)

    Bambang Tjahyono Hariadi


    Full Text Available The objective of this experiment was to know carrying capacity of rusa deer (Cervus timorensisi at Mar, Wasur National Park Merauke district. The data collected were spesies of grasses, production each species and carrying capacity. The results showed species of grasses were Cynadon dactylon, Imperata cylindrica and Phragmites karka. Mar was dominated by Cynadon dactylon. The production of Cynodon dactylon was 2.183 kg/ha. The carryng capacity of rusa deer was 0.5 ha/head/year.

  1. Adrenal response to ACTH stimulation in Rusa deer (Cervus rusa timorensis). (United States)

    van Mourik, S; Stelmasiak, T


    Resting cortisol values in immobilized mature Rusa stags (Cervus rusa timorensis) and the response to synthetic ACTH were investigated. The mean level of cortisol in mature Rusa stags was found to be 3.80 ng/ml (SD = 0.87, N = 18). Over the range 0.37-6.0 i.u. the adrenal response to ACTH challenge was linearly related to the log dose ACTH administered (r = 0.998). More than 6 i.u. of ACTH caused maximal stimulation of the adrenal gland. Rusa deer appear to be much more sensitive to ACTH administration than other species. PMID:6150796

  2. Case 3018. Cervus gouazoubira Fischer, 1814 (currently Mazama gouazoubira; Mammalia, Artiodactyla): proposed conservation as the correct original spelling (United States)

    Gardner, A.L.


    The purpose of this application is to conserve the spelling of the specific name of Cervus gouazoubira Fischer, 1814 for the brown brocket deer of South America (family Cervidae). This spelling, rather than the original gouazoubira, has been in virtually universal usage for almost 50 years.

  3. Prevalence and genetic diversity of Bartonella species in sika deer (Cervus nippon) in Japan. (United States)

    Sato, Shingo; Kabeya, Hidenori; Yamazaki, Mari; Takeno, Shinako; Suzuki, Kazuo; Kobayashi, Shinichi; Souma, Kousaku; Masuko, Takayoshi; Chomel, Bruno B; Maruyama, Soichi


    We report the first description of Bartonella prevalence and genetic diversity in 64 Honshu sika deer (Cervus nippon centralis) and 18 Yezo sika deer (Cervus nippon yesoensis) in Japan. Overall, Bartonella bacteremia prevalence was 41.5% (34/82). The prevalence in wild deer parasitized with ticks and deer keds was 61.8% (34/55), whereas no isolates were detected in captive deer (0/27) free of ectoparasites. The isolates belonged to 11 genogroups based on a combination of the gltA and rpoB gene sequences. Phylogenetic analysis of concatenated sequences of the ftsZ, gltA, ribC, and rpoB genes of 11 representative isolates showed that Japanese sika deer harbor three Bartonella species, including B. capreoli and two novel Bartonella species. All Yezo deer's isolates were identical to B. capreoli B28980 strain isolated from an elk in the USA, based on the sequences of the ftsZ, gltA, and rpoB genes. In contrast, the isolates from Honshu deer showed a higher genetic diversity. PMID:22832020

  4. Molecular diversity of rumen bacterial communities from tannin-rich and fiber-rich forage fed domestic Sika deer (Cervus nippon) in China


    Li, Zhi Peng; Liu, Han Lu; Li, Guang Yu; Bao, Kun; Wang, Kai Ying; Xu, Chao; Yang, Yi Feng; Yang, Fu He; Wright, André-Denis G.


    Background Sika deer (Cervus nippon) have different dietary preferences to other ruminants and are tolerant to tannin-rich plants. Because the rumen bacteria in domestic Sika deer have not been comprehensively studied, it is important to investigate its rumen bacterial population in order to understand its gut health and to improve the productivity of domestic Sika deer. Results The rumen bacterial diversity in domestic Sika deer (Cervus nippon) fed oak leaves- (OL group) and corn stalks-base...

  5. An ecological perspective on the changing face of Brucella abortus in the western United States (United States)

    Cross, Paul C.; Maichak, Eric J.; Brennan, Angela; Scurlock, Brandon M.; Henningsen, John C.; Luikart, Gordon


    After a hiatus during the 1990s, outbreaks of Brucella abortus in cattle are occurring more frequently in some of the western states of the United States, namely, Montana, Wyoming and Idaho. This increase is coincident with increasing brucellosis seroprevalence in elk (Cervus elaphus), which is correlated with elk density. Vaccines are a seductive solution, but their use in wildlife systems remains limited by logistical, financial, and scientific constraints. Cattle vaccination is ongoing in the region. Livestock regulations, however, tend to be based on serological tests that test for previous exposure and available vaccines do not protect against seroconversion. The authors review recent ecological studies of brucellosis, with particular emphasis on the Greater Yellowstone Area, and highlight the management options and implications of this work, including the potential utility of habitat modifications and targeted hunts, as well as scavengers and predators. Finally, the authors discuss future research directions that will help us to understand and manage brucellosis in wildlife.

  6. Climatic and density influences on recruitment in an irruptive population of Roosevelt elk (United States)

    Starns, Heath D.; Ricca, Mark A.; Duarte, Adam; Weckerly, Floyd W.


    Current paradigms of ungulate population ecology recognize that density-dependent and independent mechanisms are not always mutually exclusive. Long-term data sets are necessary to assess the relative strength of each mechanism, especially when populations display irruptive dynamics. Using an 18-year time series of population abundances of Roosevelt elk (Cervus elaphus roosevelti) inhabiting Redwood National Park in northwestern California we assessed the influence of population size and climatic variation on elk recruitment and whether irruptive dynamics occurred. An information-theoretic model selection analysis indicated that abundance lagged 2 years and neither climatic factors nor a mix of abundance and climatic factors influenced elk recruitment. However, density-dependent recruitment differed between when the population was declining and when the population increased and then stabilized at an abundance lower than at the start of the decline. The population displayed irruptive dynamics.

  7. Impact of harmful agents on forest growths - bark beetles; Impact of abiotic factors on forest growths; Impact of harmful agents on forest growths - leaf-eating insect; Impact of harmful agents on forest growths - game; Impact of harmful agents on forest growths - fungal diseases; 1 : 2 000 000

    International Nuclear Information System (INIS)

    On these maps the impact of different biotic and abiotic factors on forest growth on the territory of the Slovak Republic are shown. The data on damage to forest growth in the years 1996 - 1999 are based on source material of 'Lesnicka ochranarska sluzba' and the reports on occurrence of the bark beetles from the entities managing the forests. The most important species of bark beetles are: Ips typographus, Pityogenes chalcographus, and Xyloterus lineatus for spruce trees; Tomicus minor, Tomicus piniperda, and Ips acuminatus for pine trees; Scolytus intricatus for beech trees. The most important abiotic damage-causing factors are wind, snow, and rime. The most important leafeating species are: Lymantria dispar, Dreyfusia nordmannianae, Tortricidae, and Geometridae. Red deer Cervus elaphus L. causes the most important damage to forest growths. The most important species of fungal pathogens are tracheomycosis, cankers, bark necrosis and wood destroying fungi such as Armillaria mellea, Hypoxylon deustum and the like. (authors)

  8. Red deer synchronise their activity with close neighbours

    Directory of Open Access Journals (Sweden)

    Sean A. Rands


    Full Text Available Models of collective animal behaviour frequently make assumptions about the effects of neighbours on the behaviour of focal individuals, but these assumptions are rarely tested. One such set of assumptions is that the switch between active and inactive behaviour seen in herding animals is influenced by the activity of close neighbours, where neighbouring animals show a higher degree of behavioural synchrony than would be expected by chance. We tested this assumption by observing the simultaneous behaviour of paired individuals within a herd of red deer Cervus elaphus. Focal individuals were more synchronised with their two closest neighbours than with the third closest or randomly selected individuals from the herd. Our results suggest that the behaviour of individual deer is influenced by immediate neighbours. Even if we assume that there are no social relationships between individuals, this suggests that the assumptions made in models about the influence of neighbours may be appropriate.

  9. Elemental composition of game meat from Austria. (United States)

    Ertl, Kathrin; Kitzer, Roland; Goessler, Walter


    Concentrations of 26 elements (B, Na, Mg, P, S, K, Ca, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, As, Se, Rb, Sr, Mo, Cd, Sb, Ba, Hg, Pb, U) in wild game meat from Austria were analysed using an inductively coupled plasma mass spectrometer. All investigated animals were culled during the hunting season 2012/2013, including 10 chamois (Rupicapra rupicapra), 9 hare (Lepus europaeus), 10 pheasant (Phasianus colchicus), 10 red deer (Cervus elaphus), 12 roe deer (Capreolus capreolus) and 10 wild boar (Sus scrofa). In 19 out of 61 meat samples lead concentrations were higher than 0.1 mg/kg, the maximum limit in meat as set by the European Commission (Regulation EC No 1881/2006), which is most likely caused by ammunition residues. Especially, pellet shot animals and chamois show a high risk for lead contamination. Despite ammunition residues all investigated muscle samples show no further health risk with respect to metal contamination. PMID:26886253

  10. Zygomycetes from herbivore dung in the ecological reserve of Dois Irmãos, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    André Luiz Cabral Monteiro de Azevedo Santiago


    Full Text Available Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris, camel (Camelus bactrianus, horse (Equus caballus, deer (Cervus elaphus, agouti (Dasyprocta aguti, donkey (Equus asinus, llama (Llama glama and waterbuck (Kobus ellipsiprymnus dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant.

  11. Rusa alfredi papillomavirus 1 - a novel deltapapillomavirus inducing endemic papillomatosis in the endangered Visayan spotted deer. (United States)

    Fux, Robert; Langenmayer, Martin C; Jörgens, Dirk; Schubert, Christina; Heckel, Jens-Ove; Sutter, Gerd


    We describe a novel papillomavirus - Rusa alfredi papillomavirus 1 (RalPV1) - which causes endemic fibropapillomatosis in the European conservation breeding population of the highly endangered Visayan spotted deer (Rusa alfredi). Degenerated papillomavirus-specific primers were used to amplify and sequence parts of the viral DNA. Subsequently, the complete genomic DNA was cloned and the sequence was determined. The RalPV1 genome has a length of 8029 bp, encodes the early proteins E6, E7, E1, E2 and E5, the two late proteins L1 and L2 and contains an upstream regulatory region. Highest sequence identities were observed with two deltapapillomaviruses, the Capreolus capreolus PV1 and Cervus elaphus PV1. Pairwise comparisons and phylogenetic analysis based on the ORF L1 suggested that RalPV1 is a putative new type of the papillomavirus species Deltapapillomavirus 5. PMID:26555294

  12. Effects of bull elk demographics on age categories of harem bulls (United States)

    Bender, L.C.


    Many management strategies for elk (Cervus elaphus) emphasize increasing numbers of mature bulls in the population. These strategies are usually assumed to enhance productivity via increased breeding by mature bulls. I compared age classes of harem bulls during the peak of the rut under 4 bull harvest strategies that resulted in different bull:cow ratios, mature bull:cow ratios, bull mortality rates, and proportions of mature bulls in the autumn (pre-hunting season) population. Proportions of harems held by differing age classes of bulls [mature (P84% of harems only in populations where mature bull:cow ratios exceeded 21:100 in the autumn population. Interaction of mature bull ratios in the autumn population, harem size, and bull selectivity in the harvest strategy must be considered if increased breeding by mature harem bulls is a management goal.

  13. Elk Distributions Relative to Spring Normalized Difference Vegetation Index Values

    International Nuclear Information System (INIS)

    Rocky Mountain elk (Cervus elaphus) that winter near San Antonio Mountain in northern New Mexico provide important recreational and economic benefits while creating management challenges related to temporospatial variation in their spring movements. Our objective was to examine spring distributions of elk in relation to vegetative emergence as it progresses across the landscape as measured by remote sensing. Spring distributions of elk were closely associated with greater photosynthetic activity of spring vegetation in 2 of 3 years as determined using NDVI values derived from AVHRR datasets. Observed elk locations were up to 271% greater than expected in the category representing the most photosynthetic activity. This association was not observed when analyses at a finer geographic scale were conducted. Managers facing challenges involving human-wildlife interactions and land-use issues should consider environmental conditions that may influence variation in elk association with greener portions of the landscape.

  14. Dicty_cDB: Contig-U04539-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.006 ( P27476 ) RecName: Full=Nuclear localization sequence-binding pro... 33 0.007 ( O35698 ) RecName: Full=RNA-binding moti...e Score E Sequences producing significant alignments: (bits) Value (Q54WM4) RecName: Full=Eukaryotic translation... factor ... 68 3e-18 AF291712_1( AF291712 |pid:none) Arabidopsis thaliana initiation f...e) Arabidopsis thaliana eukaryotic tr... 65 4e-15 (A5DNX9) RecName: Full=Eukaryotic translation initiation...1 EF619483_1( EF619483 |pid:none) Cervus elaphus eukaryotic translat... 71 4e-11 (A8WLV5) RecName: Full=Probable eukaryotic translati

  15. 贺兰山野生有蹄类动物的经济价值及种群动态变化%Value and Population Dynamics of Wild Ungulates in Helan Mountains

    Institute of Scientific and Technical Information of China (English)

    梁军; 胡天华


    记述了贺兰山的4种野生有蹄类动物——马麝、马鹿、岩羊、鹅喉羚的经济价值及目前的种群动态变化,对贺兰山野生有蹄类动物的种群致危原因进行了分析,并据此提出了相应的保护管理建议。%The economic value and present population dynamics of four wild ungulates like Moschus chrysogaster, Cervus elaphus, Pseudois nayaur and Gazella subgutturosa in Helan Mountains were recorded. Endangered reasons of the wild ungulates were analyzed, meanwhile the management suggestions were put forward.

  16. Predatory senescence in ageing wolves (United States)

    MacNulty, D.R.; Smith, D.W.; Vucetich, J.A.; Mech, L.D.; Stahler, D.R.; Packer, C.


    It is well established that ageing handicaps the ability of prey to escape predators, yet surprisingly little is known about how ageing affects the ability of predators to catch prey. Research into long-lived predators has assumed that adults have uniform impacts on prey regardless of age. Here we use longitudinal data from repeated observations of individually-known wolves (Canis lupus) hunting elk (Cervus elaphus) in Yellowstone National Park to demonstrate that adult predatory performance declines with age and that an increasing ratio of senescent individuals in the wolf population depresses the rate of prey offtake. Because this ratio fluctuates independently of population size, predatory senescence may cause wolf populations of equal size but different age structure to have different impacts on prey populations. These findings suggest that predatory senescence is an important, though overlooked, factor affecting predator-prey dynamics. ?? 2009 Blackwell Publishing Ltd/CNRS.

  17. The complete mitochondrial genome of sika deer Cervus nippon (Cetartiodactyla: Cervinae) South Anhui population. (United States)

    Pan, Hong-Chun; Fang, Hong-Yan; Jin, Can; Liu, Lei


    The complete mitochondrial genome of sika deer (Cervus nippon) South Anhui population is a circular molecule of 16,429 bp in length, containing 13 protein-coding genes, 2 ribosomal RNAs, 22 transfer RNAs and a control region. The A + T content of the overall base composition of H-strand is 62% (T: 28.7%; C: 24.6%; A: 33.3%; G: 13.4%). ND2, ND3 and ND5 genes begin with ATA as start codon, ND4L gene begins with GTG as start codon, while other nine protein-coding genes start with a typical ATG initiation codon. ND1, COI, COII, ATP8, ATP6, ND4L, ND5 and ND6 genes are terminated with TAA as stop codon, ND2 ends with TAG, COIII, ND3 and ND4 ends with T, Cyt b ends with AGA. PMID:23570529

  18. Two potentially zoonotic parasites infecting Philippine brown deer (Cervus mariannus desmarest, 1822 in Leyte Island

    Directory of Open Access Journals (Sweden)

    Harvie Potot Portugaliza


    Full Text Available This case report describes the necropsy findings of two potentially zoonotic parasites infecting the Philippine brown deer (Cervus mariannus in Leyte Island, Philippines. A female deer aging approximately 5-year was presented for necropsy to the Diagnostic Laboratory at the College of Veterinary Medicine, Visayas State University. Gross pathology was recorded and the selected organs having lesion were collected for histopathological studies. Results showed severe necrotizing lesions in the nasal and palatal areas, infestation of calliphorid maggots, hepatic fibrosis, cholangitis, cholecystitis, lung atelectasis and duodenitis. Heavy ruminal fluke infection was also observed. Two potentially zoonotic parasites namely Fasciola gigantica and Sarcocystis spp. were identified. The Philippine brown deer appears to have a role in transmission and amplification of zoonotic parasites, and can also be threatened by diseases caused by the parasites.

  19. Malignant catarrhal fever in farmed Rusa deer (Cervus timorensis). 2. Animal transmission and virological studies. (United States)

    Westbury, H A; Denholm, L J


    A disease with clinical signs and histological lesions similar to malignant catarrhal fever in cattle was transmitted from Rusa deer (Cervus timorensis) to rabbits. This was accomplished on 3 separate occasions, and the disease was serially passaged in rabbits up to 11 times. The clinical signs in affected rabbits were pyrexia, depression, anorexia, mucopurulent conjunctivitis, nasal discharge and diarrhoea. These signs were seen in 27 of 38 inoculated rabbits with the mean incubation period being 12 days (range 8 to 20 days). Histologically, affected rabbits exhibited mononuclear perivascular cuffing and vasculitis in the brain, heart, liver and kidney. Lymph nodes and spleen showed destruction and loss of mature lymphocytes and lymphoid follicles and an increased number of large lymphoblastoid cells. These clinical signs and lesions were not detected in control rabbits. The disease was not transmitted to cattle, sheep, guinea pigs or mice, nor was an agent isolated in cattle, deer or rabbit tissue cultures, or in chicken embryos. PMID:7115234

  20. Serum biochemical values of rusa deer (Cervus timorensis russa) in New Caledonia. (United States)

    Audigé, L


    Blood samples were collected from 91 rusa deer (Cervus timorensis russa), immediately after being shot. Serum mean biochemical values from shot deer are presented for blood urea nitrogen, creatinine, creatine kinase, alanine aminotransferase, aspartate aminotransferase, alkaline phosphatase, total bilirubin, total protein, albumin, calcium, and phosphorus. Mean total protein and albumin increased with age. There was an age-associated increase of gamma globulins. Mean creatine kinase activity and creatinine, albumin and phosphorus concentrations were higher in stags than in hinds. Pregnant hinds had lower mean creatine kinase activity and phosphorus and higher mean alanine aminotransferase and total protein than non-pregnant hinds. Mean calcium concentration increased when deer were agitated before bleeding. PMID:1288472

  1. An outbreak of malignant catarrhal fever in young rusa deer (Cervus timorensis). (United States)

    Tomkins, N W; Jonsson, N N; Young, M P; Gordon, A N; McColl, K A


    On the basis of clinical signs and histological findings eight 9-month-old male rusa deer (Cervus timorensis) were diagnosed with sheep associated-malignant catarrhal fever. Following a variable course involving rectal temperatures around 40.5 degrees C, depression, inappetence, diarrhoea, corneal opacity and hypopyon all animals died or were euthanased over a 5-week period. Severe multifocal vasculitis, mainly periglomerular and in the arcuate vessels were consistent histological findings which in the past have been adequate to confirm clinical diagnosis of sheep associated-malignant catarrhal fever. A nested polymerase chain reaction test has been used to detect a sheep associated-malignant catarrhal fever PRC product, 238 base-pairs in size, in DNA extracted from lymphocyte preparations. The result supported the diagnosis of sheep associated-malignant catarrhal fever in these deer. PMID:9406629

  2. Evaluation of three strategic parasite control programs in captive wild ruminants. (United States)

    Goossens, Els; Vercruysse, Jozef; Vercammen, Francis; Dorny, Pierre


    Parasite control in wild ruminants is based mainly on anthelmintics. The objective of the present study was to evaluate three parasite control programs in seven herds of captive wild ruminants in 3 consecutive years. In the first year, a biannual spring-summer treatment regime with fenbendazole at 7.5 mg/kg body weight p.o. for 3 days was applied. The next year, an early-season treatment program with three administrations of fenbendazole at the same dosage at 3-wk intervals was used. In the third year, an early-season treatment program with ivermectin (0.2 mg/kg p.o. for 3 days), applied three times at 5-wk intervals, was evaluated. Effectiveness of these control programs was assessed by fecal egg counts and by scores of body condition and fecal consistency at weekly intervals. Involved animal species were Arabian oryx (Oryx leucoryx), scimitar-horned oryx (Oryx dammah), slender-horned gazelle (Gazella leptoceros), Soay sheep (Ovis aries soay), ibex (Capra ibex), red deer (Cervus elaphus hippelaphus), and Nelson's elk (Cervus elaphus nelsoni). With the spring-summer regime, fecal egg counts remained low during the first 5 mo, but from September onward, they slowly increased to significant levels in all seven herds. The early-season program with fenbendazole resulted in fecal egg counts near zero during the entire year in four herds but a significant egg shedding from August onward was noted in Arabian oryx, scimitar-horned oryx, and Soay sheep. The early-season program with ivermectin resulted in very low to zero egg shedding in gazelle, adult Soay sheep, ibex, red deer, and Nelson's elk during the entire grazing season, but failed to prevent high shedding in October in Arabian oryx and scimitar-horned oryx. High contamination of grassy pastures with infective larvae/eggs in the previous year or before the first treatment may explain failure of the treatment regimes in some herds. PMID:17312807

  3. Elaphostrongylus spp. from Scandinavian cervidae - a scanning electron microscope study (SEM

    Directory of Open Access Journals (Sweden)

    Margareta Stéen


    Full Text Available Nematodes of the genus Elaphostrongylus collected from moose (Alces alces L., reindeer (Rangifer tarandus tarandus L., and red deer (Cervus elaphus L., respectively, were studied by means of scanning electron microscopy. Morphological differences in the ribs of the genital bursa were demonstrated. The Elaphostrongylus species from reindeer and red deer differed from each other in four ribs of the genital bursa. These results agree with the morphological characters of E. cervi and E. rangiferi described by Cameron (1931 and Mitskevitch (1960. The genital bursa of Elaphostrongylus sp. from moose, in accordance with the description of E. alces by Steen et al. (1989 showed characteristics differing from those found in Elaphostrongylus spp. from reindeer and red deer respectively. These results support the hypothesis that there are three separate species of Elaphostrongylus present in Scandinavian Cervidae. Svep-elektroniska studier på Elaphostrongylus spp. hos skandinaviska hjortdjur.Abstract in Swedish / Sammandrag: Rundmaskar inom slaktet Elaphostrongylus funna hos alg (Alces alces L., ren (Rangifer tarandus tarandus L. och kronhjort(Cervus elaphus L. studerades med hjalp av svepelelektronmikroskop. De hanliga bursorna med sin a stodjeribbor uppvisade variationer i utseende, langd och placering mellan dessa rundmaskar. De arter av Elaphostrongylus funna hos ren och kronhjort skilde sig åt avseende fyra stodjeribbor på de hanliga bursorna. Dessa resultat stammer val overens med de karaktarer som tidigare ar beskrivna av Cameron(1931 och av Mitskevich (1960. Den hanliga bursan hos arten Elaphostrongylus funnen hos alg, vilken tidigare ar beskriven av Steen et al. (1989, visade upp ett utseende som skilde sig från bursorna hos de Elaphostrongylus-arter funna hos ren och kronhjort. Dessa resultat stoder hypotesen om tre skilda arter av Elaphostrongylus hos skandinaviska hjortdjur.

  4. Mesola red deer: physical characteristics, population dynamics and conservation perspectives

    Directory of Open Access Journals (Sweden)

    Stefano Mattioli


    Full Text Available Abstract The biometry, demography and genetics of red deer Cervus elaphus of Mesola Wood (NE Italy, are presented and discussed in relation to the conservation of this population. Modest body size, low stature, oversimplified antlers and a low reproductive performance characterise red deer from Mesola Wood. The mitochondrial genome showed a private haplotype, different from other red deer in Italy and central Europe. The uniqueness of this nucleus and its biogeographic importance make a long-term conservation plan particularly urgent. Management measures such as fallow deer reduction, winter feeding and pasture mowing were tested, giving promising results. The physical condition of the animals improved, calf and adult mortality declined, and a few cases of antlers with bez tine or crown were reported in this study after four decades. Riassunto Il Cervo della Mesola: caratteristiche fisiche, dinamica di popolazione e prospettive di conservazione La biometria, la demografia e la genetica del cervo Cervus elaphus del Gran Bosco della Mesola (Italia nord-orientale, vengono presentate e discusse in relazione alla salvaguardia di questa popolazione. Il cervo della Mesola risulta caratterizzato dalle modeste dimensioni corporee, dalla struttura semplificata dei palchi e da un basso rendimento riproduttivo. L'analisi del genoma mitocondriale ha evidenziato un aplotipo privato, diverso da quello degli altri cervi italiani e centroeuropei. L'unicità di questo nucleo e la sua importanza biogeografica rendono particolarmente urgente un piano di conservazione a lungo termine. Sono stati verificati interventi gestionali quali la riduzione numerica dei daini, il foraggiamento invernale e lo sfalcio delle superfici a pascolo, con risultati promettenti. Le condizioni fisiche degli animali sono migliorate, la mortalità tra i piccoli e gli adulti è diminuita, e sono stati registrati alcuni

  5. Serosurvey for antibodies to malignant catarrhal fever-associated viruses in free-living and captive cervids in Germany. (United States)

    Frölich, K; Li, H; Müller-Doblies, U


    A total of 486 serum samples collected from several species of both free-living and captive cervids in Germany was examined for antibodies against malignant catarrhal fever (MCF)-associated viruses (MCFV) by a competitive-inhibition enzyme-linked immunosorbent assay (CI-ELISA). Eleven (2%) of these samples were positive for antibodies against MCFV. Among 157 serum samples collected from 16 different species of captive deer including four (7%) of 54 fallow deer and one (7%) of 14 sika deer (Cervus nippon) were seropositive. Among 329 samples from three species of free-ranging deer, including 253 roe deer (Capreolus capreolus), 22 red deer (Cervus elaphus) and 54 fallow deer (Cervus dama), only fallow deer were antibody-positive. Of the 25 fallow deer samples collected between 1990 and 1993, four (16%) were seropositive. Among 29 free-ranging fallow deer samples collected in the hunting period 1996-1997, antibodies to MCFV were detected in two (7%) of these sera. All of these fallow deer samples were collected from a circumscribed area in northern Germany. In the same area a high seroprevalence (72%) to MCFV was observed in domestic sheep (n = 50). Among 20 sheep samples (buffy coat) and 15 fallow deer samples (spleen or lymph nodes) examined for ovine herpesvirus 2 (OvHV-2) by PCR, all 20 sheep samples examined were OvHV-2 positive, but all of the 15 fallow deer samples, including seven seropositive deer, were OvHV-2 negative. PMID:9813848

  6. Observations on the eruption of the permanent incisor teeth of farmed Javan rusa deer (Cervus timorensis russa) in New Caledonia. (United States)

    Bianchi, M; Hurlin, J C; Lebel, S; Chardonnet, P


    The eruption of the permanent incisor teeth of 14 farmed Javan rusa deer (Cervus timorensis russa) of known birth date and their live weights were observed about every 2 weeks from 12 to 30 months of age. The permanent incisor pattern was 11, 14-17 months; 12, 18-23 months; 13, 20-26 months; and 14, 22-27 months. There was no significant relationship between body weight and timing of permanent incisor eruption. PMID:16031978

  7. Detachment of hard ticks (Acari: Ixodidae) from hunted sika deer (Cervus nippon). (United States)

    Tsunoda, Takashi


    Ixodid ticks were collected from 13 sika deer, Cervus n.nippon, shot in the Boso Peninsula in central Japan from late February to early March 1999. Haemaphysalis megaspinosa was the most abundant species of the adults collected, although Haemaphysalis longicornis, H. flava, H. kitaokai, H. cornigera, Ixodes ovatus, and Amblyomma testudinarium were also collected. Males were more abundant than females for H. longicornis, H. megaspinosa, H. flava, and H. kitaokai. Ticks that had inserted their hypostome into its host skin (designated attached) were distinguished from those that were detached and on the host's surface. A greater fraction of males than females of all four species were detached. Females were classified in three feeding stages (engorged, partially engorged, and unfed). More H. longicornis and H. megaspinosa unfed female ticks than engorged and partially-engorged female ticks were collected detached. Our results indicated that H. megaspinosa, H. longicornis, H. flava, and H. kitaokai male ticks detached sooner than female ticks after their host died. PMID:24659518

  8. Sperm membrane proteome in wild Japanese macaque (Macaca fuscata) and Sika deer (Cervus nippon). (United States)

    Kawase, Osamu; Cao, Shinuo; Xuan, Xuenan


    Whereas recent advances in proteome-related techniques have accumulated a lot of information about sperm proteins in model animals, the information in non-model wildlife species is absolutely deficient, although this knowledge would be valuable to regulate wildlife overabundance. To characterize the repertoires of sperm membrane proteins in Japanese overpopulated wildlife, our study focuses on the following two species: Macaca fuscata and Cervus nippon. We enriched sperm membrane proteins by the phase partitioning with Triton X-114, and then separated them by two-dimensional electrophoresis, and, finally, they were comprehensively identified by peptide mass fingerprinting. Sperm membrane proteins were successfully enriched. They included some proteins with unknown function and fertility-related proteins that work in sperm development, motility, capacitation, transport, protection, acrosome reaction, and fertilization. Additionally, beta-defensin 126 and epithelial chloride channel were strongly detected in M. fuscata but not in C. nippon, whereas lactadherin and NADH-cytochrome b5 reductase 1 were strongly detected in C. nippon alone. This study is an initiative case showing that the sperm of wildlife conserve major fertility-related proteins, but express some proteins in a species-specific manner. In the development of a practical method for fertility control, this aspect may be taken into consideration. PMID:25277530

  9. The complete mitochondrial genome of Sika deer Cervus nippon hortulorum (Artiodactyla: Cervidae) and phylogenetic studies. (United States)

    Liu, Yan-Hua; Liu, Xin-Xin; Zhang, Ming-Hai


    Sika deer (Cervus nippon Temminck 1836) are classified in the order Artiodactyla, family Cervidae, subfamily Cervinae. At present, the phylogenetic studies of C. nippon are problematic. In this study, we first determined and described the complete mitochondrial sequence of the wild C. nippon hortulorum. The complete mitogenome sequence is 16 566 bp in length, including 13 protein-coding genes, two rRNA genes, 22 tRNA genes, a putative control region (CR) and a light-strand replication origin (OL). The overall base composition was 33.4% A, 28.6% T, 24.5% C, 13.5% G, with a 62.0% AT bias. The 13 protein-coding genes encode 3782 amino acids in total. To further validate the new determined sequences and phylogeny of Sika deer, phylogenetic trees involving 15 most closely related species available in GenBank database were constructed. These results are expected to provide useful molecular data for deer species identification and further phylogenetic studies of Artiodactyla. PMID:26258510

  10. Isolation and characterization of peptidoglycan recognition protein 1 from antler base of sika deer (Cervus nippon). (United States)

    Jiang, Wei; Yin, Yongguang; Zhou, Yajun; He, Guidan; Qi, Yue


    Peptidoglycan recognition proteins (PGRPs) are secreted innate immunity pattern recognition molecules. In this study, a new peptidoglycan recognition protein 1 named cnPGRP1 was isolated from an antler base of sika deer Cervus nippon. The antler base antimicrobial proteins (AAP) were subjected to consecutive chromatographic methods connected to Sephadex G-25 gel filtration column (CM) anion-exchange column, and RP-HPLC. The molecular weight of cnPGRP1 was 17.2 kDa under SDS-PAGE, and peptide mass fingerprint analysis by MALDI-TOF-MS as peptidoglycan recognition protein 1 matched to Dasypus novemcinctus. The matched amino acids sequences were RLYEIIQKWPHYRA. Both Gram-positive and Gram-negative bacteria can be killed by cnPGRP1 in the 50-250 μg/mL range through in vitro. Furthermore, cnPGRP1 has been found to bind Gram-positive bacteria, Gram-negative bacteria, and even fungus. PMID:24360898

  11. Malignant catarrhal fever in farmed Rusa deer (Cervus timorensis). 1. Clinico-pathological observations. (United States)

    Denholm, L J; Westbury, H A


    A sporadic fatal disease is described in 7 Rusa deer (Cervus timorensis) from 5 deer farms in Victoria. Bilateral ophthalmia and wasting were the most significant signs in a clinical course varying from 4 to 34 days. Bilateral hypopyon, peripheral corneal opacities and interstitial mononuclear cell infiltration of the renal cortex with pronounced mural thickening and dilatation of vessels at the cortico-medullary junction were the only consistent lesions. Haemorrhagic ileitis, colitis and typhlitis were the major lesions in two deer that died 4 and 6 days after onset of clinical disease. Ecchymotic haemorrhages and sub-serosal haematomas on the intestines and mesentery were the main finding in cases with a longer clinical course. Other gross lesions varied between cases. The most significant histological lesion was fibrinoid necrotising vasculitis with adventitial lymphoid cell infiltration characteristic of bovine malignant catarrhal fever. Mucosal erosions seen in protracted cases of this disease were associated with lymphoid cell infiltration into foci of degenerating epithelial cells. In many lymph nodes there was severe follicular necroses. In chronic cases extensive proliferation of lymphoblastoid cells was seen in the parafollicular cortex and medullary sinuses of nodes which also showed discrete follicular necrosis. PMID:6981408

  12. Identification of single-nucleotide polymorphisms of the prion protein gene in sika deer (Cervus nippon laiouanus)


    Jeong, Hyun-Jeong; Lee, Joong-Bok; Park, Seung-Yong; Song, Chang-Seon; Kim, Bo-Sook; Rho, Jung-Rae; Yoo, Mi-Hyun; Jeong, Byung-Hoon; Kim, Yong-Sun; Choi, In-Soo


    Polymorphisms of the prion protein gene (PRNP) have been detected in several cervid species. In order to confirm the genetic variations, this study examined the DNA sequences of the PRNP obtained from 33 captive sika deer (Cervus nippon laiouanus) in Korea. A total of three single-nucleotide polymorphisms (SNPs) at codons 100, 136 and 226 in the PRNP of the sika deer were identified. The polymorphic site located at codon 100 has not been reported. The SNPs detected at codons 100 and 226 induc...

  13. Effects of ovarian storage condition on in vitro maturation of Hokkaido sika deer (Cervus nippon yesoensis) oocytes. (United States)

    Tulake, Kuerban; Yanagawa, Yojiro; Takahashi, Yoshiyuki; Katagiri, Seiji; Higaki, Shogo; Koyama, Keisuke; Wang, Xuguang; Li, Heping


    The effects of different preservation conditions (temperature 20-25 or 10-15 degrees C; duration 12 or 24 h) for ovaries of Cervus nippon yesoensis on in vitro maturation of oocytes were examined. When ovaries were kept for 12 h at 20-25 degrees C, maturation rate of oocytes was highest (71%); however, it declined when the preservation time was extended to 24 h (31%). When the preservation temperature decreased to 10-15 degrees C, the maturation rate after 12 h preservation decreased (51%) but it remained in same level even though preservation time is prolonged to 24 h (55%). PMID:25597189

  14. Artificial insemination, hybridization and pregnancy detection in sika deer (Cervus nippon ). (United States)

    Willard, S T; Hughes, D M; Bringans, M; Sasser, R G; White, D R; Jaques, J T; Godfrey, R W; Welsh, T H; Randel, R D


    Artificial insemination (AI) was performed on sika hinds (Cervus nippon ) receiving various dosages of pregnant mare serum gonadotropin (PMSG; Year 1: 0, 50 and 100 IU; Year 2: 100 and 150 IU) and using semen collected from elk and 1 2 elk x 1 2 sika stags. The time from synchronization device removal (CIDR vs norgestomet) to estrus was determined through observations of mounting activity. Methods for pregnancy detection, serum progesterone (P4), estrone sulfate (E1S), pregnancy-specific protein B (PSPB) and ultrasonography, following AI (Year 1: AI, Days 28 and 48 after AI; Year 2: AI, Days 42, 53 and 100 after AI) and a 90-d natural breeding season were investigated. From available production data, body weights were compared among sika and 1 4 elk x 3 4 sika hybrids relative to age. Pregnancy rates tended (P treatment and sire; administration of 0 IU PMSG resulted in fewer hinds becoming pregnant to AI than 50 or 100 IU of PMSG. Hinds receiving 100 IU of PMSG had higher (P 0.10) between the CIDR and norgestomet groups. Pregnancy rates 50 d after a 90-d breeding season were similar (P > 0.10) between ultrasound (70.9%) and PSPB (61.6%). Serum P4 after 90 d in breeding groups and 50 d after stag removal were higher (P 0.10) between ultrasound (49.0%) and PSPB (37.3%). Serum P4 28 and 48 d after AI were higher (P 0.10) between ultrasound and PSPB (66.7%). Serum P4 was higher (P sika males tended (P sika males, while 1 4 elk x 3 4 sika females were heavier (P sika females at all ages. In summary, this study documents the use of AI and methods for pregnancy detection in sika hinds as well as preliminary information regarding the production of elk-x-sika hybrids. PMID:16727942

  15. An assessment of zoonotic and production limiting pathogens in rusa deer (Cervus timorensis rusa) from Mauritius. (United States)

    Jori, F; Godfroid, J; Michel, A L; Potts, A D; Jaumally, M R; Sauzier, J; Roger, M


    A population of approximately 70,000 rusa deer (Cervus timorensis russa) represents the most important mammal species reared for food on the island of Mauritius, being the main source of red meat for the local population. However, very limited information is available on the circulation of pathogens affecting the productivity and health of this species. To produce baseline data on the circulation of infectious pathogens in rusa deer under production, a serological survey and/or direct pathogen detection for six selected infectious diseases was undertaken in 2007 in a sample of 53% of the herds reared in semi-free-ranging conditions in hunting estates. Seropositive results were recorded for Johne's disease with an indirect ELISA test (1.7%, n = 351), heartwater with an immunofluorescence antibody test (IFAT) (95.5%, n = 178) and leptospirosis with a Microscopic Agglutination Test (MAT) (25.9%, n = 363). Significant associations were found between seroprevalence to some of the leptospiral serogroups detected (Tarassovi, Pomona, Sejroe and Mini) and age of the animals, animal density or location of the estates (being more prevalent in hotter and more humid areas). In addition, Mycobacterium bovis and M. avium subspecies paratuberculosis were confirmed in two deer carcasses by culture and PCR, respectively. No antibodies against Brucella spp. nor Rift Valley Fever virus were detected with the use of respective indirect ELISA's. The results obtained suggest that the population of rusa deer from Mauritius is exposed to a wide range of pathogens which may affect their productivity. In addition, the results highlight the potential public health risks incurred by deer industry workers and consumers. This survey fills an important gap in knowledge regarding the health of tropical deer meat in Mauritius and justifies the need to implement more regular surveys of selected pathogens in the deer population. PMID:24382104

  16. Vaccination of elk (Cervus canadensis) with Brucella abortus strain RB51 overexpressing superoxide dismutase and glycosyltransferase genes does not induce adequate protection against experimental brucella abortus challenge (United States)

    In recent years, elk (Cervus canadensis) have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area (GYA). In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the d...

  17. Affinities between Cutifilaria (Nematoda: Filarioidea, parasites of deer, and Mansonella as seen in a new onchocercid, M. (C. perforata n. sp., from Japan

    Directory of Open Access Journals (Sweden)

    Uni S.


    Full Text Available A new dermal filarioid nematode, collected from Cervus nippon nippon (sika deer on Kyushu Island, Japan, showed close affinities between the genera Cutifilaria and Mansonello (Onchocercidae : Onchocercinae : no buccal capsule, esophagus reduced to a thin fibrous tube, and female tail with four lappets. We propose Cutifilaria as a subgenus of Mansonella. Cutifilaria was distinguished from the five other subgenera, Mansonella, Tetrapetalonema, Esslingeria, Sandnema, and Tupainema, in having an area rugosa composed of transverse bands with tiny points, 14-16 papillae around the cloacal aperture, two prominent rhomboidal subterminal papillae, and a thick right spicule with spoon-shaped distal extremity. The host range of Mansonella was extended to ungulates by the addition of Cutifilaria, which appears to be derived from Tupainema, parasitic in Tupaioidea (insectivores, because of the similarity in their right spicules ; Cutifilaria seems to have an Asiatic origin. M. (C. perforata n. sp. was distinct from the sole other related species, M. (C. wenki, a parasite of Cervus elaphus (red deer in Europe, having a more complex right spicule with a sturdy terminal point and microfilariae with a bifid posterior end. In addition, almost all females had cuticular pores near the vulva, on the ventral line. The prevalence of microfilariae and adults of M. (C. perforata in the skin of sika deer was 38 % and 21 %, respectively.

  18. Hepatitis E virus antibody prevalence in wildlife in Poland. (United States)

    Larska, M; Krzysiak, M K; Jabłoński, A; Kęsik, J; Bednarski, M; Rola, J


    Hepatitis E is an important public health problem mostly in developing but occasionally also in industrialized countries. Domestic and wildlife animals are considered reservoirs of the hepatitis E virus (HEV). Since no information on the prevalence of autochthonous HEV infections in human and animal in Poland is available, the aim of the study was to investigate the HEV seroprevalence of different wildlife species as potential virus reservoirs in the country. No HEV antibodies were found in any of the sera collected from the red deer (Cervus elaphus), European bison (Bison bonasus), roe deer (Capreolus capreolus), elk (Alces alces), fallow deer (Dama dama), sika deer (Cervus nippon), Tatra chamois (Rupicapra rupicapra tatrica) or brown bear (Ursus arctos). HEV-specific antibodies were detected in 44.4% (95% CI 38.3-50.7) serum samples originated only from wild boars. The percentage of seropositive wild boars differed significantly between the provinces and was positively correlated with the wild boar density and rurality of the area. This study showed that HEV circulates among wild boar population in Poland, and this species should be considered as an important reservoir of the virus. PMID:24655475

  19. Bovine virus diarrhea virus in free-living deer from Denmark. (United States)

    Nielsen, S S; Roensholt, L; Bitsch, V


    Free-living deer are suggested as a possible source of infection of cattle with bovine virus diarrhea (BVD) virus. To examine this hypothesis blood samples from 476 free-living deer were collected during two different periods and tested for BVD virus and antibody in Denmark. In 1995-96, 207 animals were tested. These included 149 roe deer (Capreolus capreolus), 29 fallow deer (Dama dama), 20 red deer (Cervus elaphus) and one sika deer (Cervus sika). For the remaining eight animals no species information was available. In 1998-99, 269 animals were tested including 212 roe deer and 57 red deer. The animals were selected from areas with a relatively high prevalence of cattle herds with a BVD persistent infection status in 1997 and 1998. All 207 samples from 1995-96 were found antibody-negative except two samples from red deer. Only 158 of the 207 samples were tested for virus and were all found negative. Of the 269 samples from 1998-99 all but one were antibody negative. The positive sample was from a red deer. All samples were virus-negative. It appears that BVD infection does not occur in roe deer in Denmark. The presence of antibody in a few red deer from various districts in Jutland probably results from cattle to deer transmission, rather than spread among deer. Hence, the possibility of free-living deer as a source of infection for cattle in Denmark seems to be remote. PMID:10941751

  20. [Molecular identification of hairy antler by analysis of high resolution melting]. (United States)

    Chen, Kang; Jiang, Chao; Yuan, Yuan; Huang, Lu-qi; Jin, Yan


    High resolution melting (HRM) , an important technology for genotyping and mutation scanning, has broad prospects in the authenticity of traditional Chinese medicine. This paper selected universal CO I primers and used HRM to establish a new method for authenticity of Hairy Antler. PCR was conducted at the annealing temperature of 60 °C and 45 cycles. The range of the DNA template concentration, the primer concentration and the Mg2+ ion concentration were further optimized. The results showed that the Tm values of Cervus nippon were (81.96 ± 0.07), (84.51 ± 0.03) °C and Cervus elaphus was(82.58 ± 0.13), (85.95 ± 0.05) °C with 10-100 mg · L(-1) DNA template, 0.2 µLmol · L(-1) primer, 2.0 mmol · L(-1) Mg2+. This method can authenticate of hairy antler and is simple, fast, high-throughput, visualization. PMID:26137679

  1. Middle Pleistocene climate and habitat change at Zhoukoudian, China, from the carbon and oxygen isotopic record from herbivore tooth enamel (United States)

    Gaboardi, Mabry; Deng, Tao; Wang, Yang


    The Pleistocene deposits at Zhoukoudian, often referred to as the "Peking Man" site, contain dental remains from a diverse group of herbivores, including Equus sanmeniensis, Cervus elaphus, Cervus nippon, Megaloceros pachyosteus, Sus lydekkeri, and Dicerorhinus choukoutienensis. The carbon and oxygen isotopic compositions of structural carbonate within the enamel of these teeth are used to reconstruct the paleodiet and paleoenvironment of the mammals. The δ13C values of enamel from Zhoukoudian range from -2.3‰ to -13.0‰, indicating that these mammals consumed between ˜25% and 100% C 3 plants. The presence of significant amounts of C 4 plants in the diets of some herbivore species indicates that at the onset of the Middle Pleistocene local habitats included mixed C 3/C 4 vegetation. By approximately 470,000 yr ago, C 3 plants dominated the diets of herbivores studied, suggesting that the abundance of C 4 flora had decreased in the area. For all deer analyzed in this study, the values of δ13C and δ18O decrease substantially from about 720,000 to 470,000 yr ago. This trend may be due to a strengthening of the winter monsoon during the Middle Pleistocene.

  2. Serological survey for Lyme disease in sika deer (Cervus nippon yesoensis) by enzyme-linked immunosorbent assay (ELISA). (United States)

    Isogai, E; Isogai, H; Masuzawa, T; Yanagihara, Y; Sato, N; Hayashi, S; Maki, T; Mori, M


    Seventy-six wild sika deer (Cervus nippon yesoensis) from areas endemic for Borrelia burgdorferi during 1988 to 1989 had the IgG antibody to the bacteria in enzyme-linked immunosorbent assay. The percentage of seropositive deer was 25.0% to strain HO14 and 22.4% to strain HP3, respectively. Specific IgG antibody titers were high in summer but low in winter. In summer, seropositive deer were 75.0%. Similar results were obtained in serum specimens obtained monthly from 4 farmed deer. It was suggested that the sika deer could be one of the wild reservoirs for B. burgdorferi in Hokkaido, Japan. The transmission risk of B. burgdorferi is considered to be greatest during late spring to early summer. PMID:1808467

  3. Changes in plasma levels of cortisol and corticosterone after acute ACTH stimulation in rusa deer (Cervus rusa timorensis). (United States)

    van Mourik, S; Stelmasiak, T; Outch, K H


    Resting cortisol and corticosterone levels in immobilized mature rusa stags (Cervus rusa timorensis) and the influence of synthetic ACTH on the cortisol/corticosterone ratio (F/B ratio) were investigated. The basal concentration of cortisol was found to be 14.07 nmol/l (SD = 9.3, N = 15) and corticosterone was 3.79 nmol/l (SD = 2.3, N = 15). The cortisol/corticosterone ratio for the basal level was 5.31 (SD = 3.9, N = 15). After ACTH administration the cortisol/corticosterone ratio increased to 11.41 (SD = 5.4, N = 147) regardless of doses of ACTH administered to individual stags. The adrenal response to ACTH administration has a potential application for selection of deer most suitable for deer farming. PMID:2863041

  4. Rusa deer (Cervus timorensis) as a host for the cattle tick (Boophilus microplus) in Papua New Guinea. (United States)

    Owen, I L


    The rusa deer (Cervus timorensis) is more resistant to the cattle tick (Boophlilus microplus) than are Britsh breed cattle in Papua New Guinea. The average yield of replete female ticks from deer was 1.6% (0.3-3.2%) as compared to 11.2% (3.4-23.1%) from calves. Ticks from deer were more slender, lighter in weight and produced fewer eggs (mean 1,800) than did ticks from calves (mean 2,200) but the deer was shown to be an effective host. A cervid population can maintain a tick population in the absence of bovine hosts thus presenting an important factor in eradication programs. Nutritional stress appears to result in a higher seasonal prevalence of infestation amongst males and non-pregnant females. PMID:864854

  5. Vaccination of Elk (Cervus canadensis) with Brucella abortus Strain RB51 Overexpressing Superoxide Dismutase and Glycosyltransferase Genes Does Not Induce Adequate Protection against Experimental Brucella abortus Challenge


    Nol, Pauline; Olsen, Steven C.; Rhyan, Jack C.; Sriranganathan, Nammalwar; McCollum, Matthew P.; Hennager, Steven G.; Pavuk, Alana A.; Sprino, Phillip J.; Boyle, Stephen M.; Berrier, Randall J.; Salman, Mo D.


    In recent years, elk (Cervus canadensis) have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area. In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the development of effective disease management strategies for wild elk herds is of utmost importance, not only for the prevention of reintroduction of brucellosis to cattle, but also for the overall health o...

  6. Vegetation Recovery in Response to the Exclusion of Grazing by Sika Deer (Cervus nippon) in Seminatural Grassland on Mt. Kushigata, Japan


    Nagaike, Takuo; Ohkubo, Eiji; Hirose, Kazuhiro


    We examined the recovery of vegetation in seminatural grassland in central Japan after eliminating grazing by sika deer (Cervus nippon) by fencing. By 2012, after 5 years of fencing for exclusion of sika deer, the species composition of quadrats within the enclosure reverted to the original species composition in 1981, not browsed by sika deer. Conversely, outside the fence was different from the baseline quadrats in 1981. Iris sanguinea, a prominent flower in the area, recovered within the e...

  7. The Association of BDNF Gene Variants with Behaviour Traits in Sika Deer (Cervus nippon)


    Wei Wan-Hong; Guo Jun; Yang Yan; Lv Shen-Jin


    It is widely accepted that Brain Derived Neurotrophic Factor (BDNF) is involved in modulating behaviour performance induced by environmental conditions. The aim of this study was to study polymorphisms of the BDNF gene and their relationship with animal behaviour in sika deer (Cervus nippon). About 48 sika deer reared under Ping-Shan-Tang Farm (25 deers) and Zhu-Yu-Wan Park (23 deers), Yangzhou City, Jiangsu province, China were observed and blood samples taken to identify BDNF genotypes. Dat...

  8. Seed contents of sika deer (Cervus nippon) dung and the fate of seeds in a temperate short grassland in an urban park in Japan


    Haruna Ishikawa


    Many studies have suggested the positive effects of grazing by large herbivorous mammals on seed dispersal, but little isknown about how herbivores could affect the fate of ingested seeds. This study examined the effects of seed ingestion bysika deer (Cervus nippon) on seed fate in a temperate grassland established in an urban park long resided by high densitiesof sika deer. I compared species composition and seasonal traits of seed abundance and maturity in the grasslandcommunity with those ...


    Raines, Janis A; Storms, Timothy


    A captive Indochinese sika deer (Cervus nippon pseudaxis) was castrated at the age of 5 yr. The resultant abnormal antler growth over the next few years became difficult to manage from both the veterinary and husbandry standpoints. Using a commercially available trenbolone acetate and estradiol implant marketed for domestic cattle heifers, normal mineralization of the abnormal antlers was achieved along with the expected normal casting. The deer was then maintained for 6 yr using an annual implant regimen. PMID:26667563


    Institute of Scientific and Technical Information of China (English)

    雷蕾; 张再蓉; 王成东; 余星明; 赵波


    Four sika deers (Cervus nippon) (3 males, and 1 female) with depression, loss of appetite, high body temperature and hematochezia were dead in June, 1999 and Yersinia was cultured from their pathological materials. In addition, the susceptibility of Yersinia to antibiotics and the toxicity to mice were detected. All the other sika deers contacted with the died animals were treated with amikacin sulfate and protected from the disease.

  11. Population genetic structure of wild and farmed rusa deer (Cervus timorensis russa) in New-Caledonia inferred from polymorphic microsatellite loci


    Garine-Wichatitsky de, M.; De Meeûs, Thierry; Chevillon, Christine; BERTHIER, D.; Barre, N.; Thevenon, S.; Maillard, J.C.


    Historical records indicate that 12 rusa deer (Cervus timorensis russa) were introduced in New-Caledonia during the 1870s. We used eight polymorphic microsatellite DNA loci to assess the genetic differentiation and diversity of farmed and wild deer populations. Past genetic bottlenecks were detected in both sub-populations, although higher genetic diversity was maintained in farmed populations, probably due to the regular introduction of reproducers from wild populations and from other farms....

  12. A Possible Role for Rusa Deer (Cervus timorensis russa) and Wild Pigs in Spread of Trypanosoma evansi from Indonesia to Papua New Guinea



    Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa) and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were m...

  13. Genetic diversity and population structure of a Sichuan sika deer (Cervus sichuanicus) population in Tiebu Nature Reserve based on microsatellite variation. (United States)

    He, Ya; Wang, Zheng-Huan; Wang, Xiao-Ming


    Cervus sichuanicus is a species of sika deer (Cervus nippon Group). To date, research has mainly focused on quantity surveying and behavior studies, with genetic information on this species currently deficient. To provide scientific evidence to assist in the protection of this species, we collected Sichuan sika deer fecal samples from the Sichuan Tiebu Nature Reserve (TNR) and extracted DNA from those samples. Microsatellite loci of bovine were used for PCR amplification. After GeneScan, the genotype data were used to analyze the genetic diversity and population structure of the Sichuan sika deer in TNR. Results showed that the average expected heterozygosity of the Sichuan sika deer population in TNR was 0.562, equivalent to the average expected heterozygosity of endangered animals, such as Procapra przewalskii. Furthermore, 8 of 9 microsatellite loci significantly deviated from the Hardy-Weinberg equilibrium and two groups existed within the Sichuan sika deer TNR population. This genetic structure may be caused by a group of Manchurian sika deer (Cervus hortulorum) released in TNR. PMID:25465089

  14. Yersiniosis in farmed deer. (United States)

    Jerrett, I V; Slee, K J; Robertson, B I


    Samples from 77 chital (Axis axis), 42 fallow (Dama dama), 26 red (Cervus elaphus), 7 rusa (Cervus timorensis) and 1 sambar deer (Cervus unicolor) were examined. Yersinia pseudotuberculosis infection was diagnosed as the cause of death in 6 (23%) of the red and 23 (30%) of the chital deer. Yersiniosis was the most common infectious cause of death diagnosed. Affected deer were usually found moribund or dead, often with faecal staining of the perineum. Gross pathology in chital included a fibrinous enterocolitis, enlarged congested mesenteric lymph nodes and multiple pale foci through the liver. Gross changes in red deer were limited to intense congestion of the intestinal mucosa and enlargement and congestion of mesenteric lymph nodes. Microscopic intestinal changes in both species consisted of microabscessation or diffuse suppurative inflammation of the intestinal mucosa with numerous bacterial colonies in the lamina propria. Multifocal suppurative mesenteric lymphadenitis was a common finding. Multifocal suppurative or non-suppurative hepatitis was frequently present in the liver of chital but was uncommon in the red deer. Yersiniosis occurred during the cooler months from June to November, with younger age classes most commonly affected. Y. pseudotuberculosis serotypes I, II and III were isolated in the ratio 17:3:0 in the chital deer and 1:1:2 in red deer. The clinical, epidemiological and bacteriological features are similar to those documented previously by New Zealand workers. The increased susceptibility to disease of red deer and chital compared to fallow deer and perhaps other species has not previously been documented. PMID:2222364

  15. Genetic diversity among Chinese sika deer (Cervus nippon) populations and relationships between Chinese and Japanese sika deer

    Institute of Scientific and Technical Information of China (English)


    Sika deer (Cervus nippon) is a cervid endemic to mainland and insular Asia and endangered. We analyzed variation in the mitochondrial DNA (mtDNA) control region for four subspecies to understand the genetic diversity, population structure and evolutionary history in China. 335 bp were sequenced and eight haplotypes were identified based on 25 variable sites among the populations. Sika deer in China showed lower genetic diversity, suggesting a small effective population size due to habitat fragmentation, a low number of founder individuals, or the narrow breeding program. AMOVA analysis indicated that there was significant genetic subdivision among the four populations, but no correlation between the genetic and geographic distance. Phylogenetic analyses also revealed that Chinese sika deer may be divided into three genetic clades, but the genetic structure among Chinese populations was inconsistent with subspecies designations and present geographic distribution. Including the sequence data of Japanese sika deer, the results indicated that Chinese populations were more closely related to Southern Japanese populations than to the Northern Japanese one, and the Taiwan population was closer to populations of Northeastern China and Sichuan than to those of Southern China.

  16. Molecular identification of the Cryptosporidium deer genotype in the Hokkaido sika deer (Cervus nippon yesoensis) in Hokkaido, Japan. (United States)

    Kato, Satomi; Yanagawa, Yojiro; Matsuyama, Ryota; Suzuki, Masatsugu; Sugimoto, Chihiro


    The protozoan Cryptosporidium occurs in a wide range of animal species including many Cervidae species. Fecal samples collected from the Hokkaido sika deer (Cervus nippon yesoensis), a native deer of Hokkaido, in the central, western, and eastern areas of Hokkaido were examined by polymerase chain reaction (PCR) to detect infections with Cryptosporidium and for sequence analyses to reveal the molecular characteristics of the amplified DNA. DNA was extracted from 319 fecal samples and examined with PCR using primers for small-subunit ribosomal RNA (SSU-rRNA), actin, and 70-kDa heat shock protein (HSP70) gene loci. PCR-amplified fragments were sequenced and phylogenetic trees were created. In 319 fecal samples, 25 samples (7.8 %) were positive with SSU-rRNA PCR that were identified as the Cryptosporidium deer genotype. Among Cryptosporidium-positive samples, fawns showed higher prevalence (16.1 %) than yearlings (6.4 %) and adults (4.7 %). The result of Fisher's exact test showed a statistical significance in the prevalence of the Cryptosporidium deer genotype between fawn and other age groups. Sequence analyses with actin and HSP70 gene fragments confirmed the SSU-rRNA result, and there were no sequence diversities observed. The Cryptosporidium deer genotype appears to be the prevalent Cryptosporidium species in the wild sika deer in Hokkaido, Japan. PMID:26687968

  17. Bacterial community composition and fermentation patterns in the rumen of sika deer (Cervus nippon) fed three different diets. (United States)

    Li, Zhipeng; Wright, André-Denis G; Liu, Hanlu; Bao, Kun; Zhang, Tietao; Wang, Kaiying; Cui, Xuezhe; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu


    Sika deer (Cervus nippon) rely on microorganisms living in the rumen to convert plant materials into chemical compounds, such as volatile fatty acids (VFAs), but how the rumen bacterial community is affected by different forages and adapt to altered diets remains poorly understood. The present study used 454-pyrosequencing of bacterial 16S ribosomal RNA (rRNA) genes to examine the relationship between rumen bacterial diversity and metabolic phenotypes using three sika deer in a 3 × 3 latin square design. Three sika deer were fed oak leaves (OL), corn stover (CS), or corn silage (CI), respectively. After a 7-day feeding period, when compared to the CS and CI groups, the OL group had a lower proportion of Prevotella spp. and a higher proportion of unclassified bacteria belonging to the families Succinivibrionaceae and Paraprevotellaceae (Psika deer. However, the differences in interplay patterns between rumen bacterial community composition and metabolic phenotypes were altered in the native and domesticated diets indicating the changed fermentation patterns in the rumen of sika deer. PMID:25252928

  18. 半圈养条件下白唇鹿行为时间分配及活动规律的研究%Time Budget and Behaviour Pattern of Cervus Albirostris in Captivity

    Institute of Scientific and Technical Information of China (English)

    何利军; 丁由中; 王小明; 夏述忠


    From March to April,1998,the authors studied the time budget andbehaviour patterns of Cervus albirostris in Shanghai Wild Animal Park.We analyzed the results from 23 days′observation for different sex and weather were analyzed.Cervus albirostris spent about 50% daytime in resting,and 40% daytime in feeding.Resting behaviour was presented from 8∶00 to 17∶00.The female spent more resting time than the male(p<0.05)in fine days.The female spent less standing time than the male in rainy days(p<0.01).Cervus albirostris spent more standing time in fine days than in rainy days(p<0.05 for the male,p<0.01 for the female).

  19. Seasonal variation in plasma testosterone, luteinizing hormone concentrations and LH-RH responsiveness in mature, male rusa deer (Cervus rusa timorensis). (United States)

    van Mourik, S; Stelmasiak, T; Outch, K H


    Plasma testosterone and luteinizing hormone (LH) concentrations in immobilized or yarded rusa stags (Cervus rusa timorensis) were investigated over a two-year period. Testosterone concentrations showed a minor elevation in autumn (May) and reached maximal levels in late winter-early spring (August) coinciding with the rut. Luteinizing hormone in plasma was only detectable from January to May. Maximal responsiveness of the pituitary-gonadal axis to LH-RH stimulation was recorded in August. The combination of Fentaz (fentanylcitrate and azaperone) and Rompun (xylazine hydrochloride) for immobilizing deer influences hypothalamic function. PMID:2869876

  20. Effect of the association of cattle and rusa deer (Cervus timorensis russa) on populations of cattle ticks (Boophilus microplus). (United States)

    Barre, N; Bianchi, M; De Garine-Wichatitsky, M


    The wild population of rusa deer (Cervus timorensis russa) in New Caledonia (South Pacific) is nearly as large as the cattle population. The cattle tick is widespread and occurs all year round. Opinions are divided on the role of deer in the biological cycle of the tick: i) Do they maintain a sustainable tick population that is secondarily available for cattle? ii) Do they decrease the infestation of the environment by collecting larvae on the pasture, but preventing their development to the engorged female stage? or iii) Do they contribute to both situations? An experiment was conducted in three groups of pastures, each seeded with 450 000 larvae/ha and allowed to be grazed only by cattle, only by deer, and by a mixed herd of deer and cattle (deer representing 30% of the biomass), at approximately the same stocking rate (470-510 kg/ha). After 15 months of exposure, the tick burden per weight unit of host was 42 ticks/kg for the steers-only herd and 0.01/kg for the deer-only herd. The steers in the "mixed group" harbored 7 times fewer ticks (6.2/kg) than the cattle-only group, and the deer in the "mixed group," 130 times more (1.3/kg) than the deer-only group. Five emergency acaricide treatments had to be applied in the cattle-only group, but none in the other groups. The long-term sustainability of a viable tick population on deer as well as the potential benefit resulting from the association of deer and susceptible cattle in the tick control of cattle are highlighted. PMID:12381606

  1. 梅花鹿 LHβ基因的克隆及序列分析%The Cloning and Sequence Analysis of Cervus nippon LHβ Gene

    Institute of Scientific and Technical Information of China (English)

    竭航; 陈彬龙; 吴楠; 李地艳; 雷美艳; 张承露; 曾德军


    【目的】克隆梅花鹿 LHβ基因 CDS 区并进行序列分析。【方法】采用 PCR 克隆测序的方法获得梅花鹿 LHβ基因 CDS 区全序列,采用 ProtParam tool 等分子生物学工具对梅花鹿 LHβ蛋白的分子量、等电点、二级结构、蛋白功能等进行预测,并采用 MEGA 6.0软件构建进化树以确定其系统发育地位。【结果】梅花鹿 LHβ基因 CDS 区全长462 bp (GenBank 序列号为 KT199365),包含了 ATG 起始密码子和 TAA 终止密码子,共编码141个氨基酸,蛋白质分子量为15.17 kDa,等电点为8.00。梅花鹿 LHβ蛋白均位于膜外,无跨膜结构,平均疏水性(GRAVY)为0.391,蛋白功能预测显示,该蛋白最有可能为激素,这与本研究的目的基因相符。进化树分析结果表明,梅花鹿LHβ基因与山羊、绵羊和牛等反刍动物较近,其中与绵羊最近。【结论】梅花鹿 LHβ基因 CDS 区序列与绵羊 LHβ基因最近。%Objective]The aim of this study is to clone the LHβ gene CDS of Cervus nippon and analyze the structure and features of LHβprotein.[Method]The LHβ gene CDS of Cervus nip-pon was obtained by PCR,cloning and sequencing.Then,the structure and features of LHβpro-tein,including molecular weight,isoelectric point,secondary structure,function were predicted by online molecular biological tool,such as ProtParam tool.Meanwhile,we constructed a phylo-genetic tree by MEGA 6.0 software to further explain the genetic basis for this gene.[Results]The full CDS sequence of Cervus nippon LHβ gene was 462 bp (GenBank Accession No. KT199365),encoding 141 amino acids,which contained ATG start codon,and TGA stop codon, with a calculated molecular weight of 15.17 kDa and an isoelectric point of 8.00.No conserved transmembrane region was detected and all of the amino acids were located outside the membrane. The average of hydrophobicity (GRAVY)was 0.391.Function predicted results showed that the function of

  2. Game species: extinction hidden by census numbers

    Directory of Open Access Journals (Sweden)

    Carranza, J.


    Full Text Available Management of game species may involve a risk of alteration of their genetic properties. Local adaptations may be disrupted if artificially selected individuals from farms or those belonging to distant geographical areas are introduced to increase population density or trophy ‘quality’. In Spain, red deer (Cervus elaphus from different European subspecies have been introduced to increase the size of trophies (antlers of local populations. Legislation against these introductions is not effective for various reasons, and once the individuals are in the Iberian peninsula it is virtually impossible to prevent their spreading throughout the whole territory without a genetic tool to distinguish between autochthonous and foreign specimens. We have developed such a genetic test and propose a strategy to dissuade land-owners from importing foreign deer. Since deer are bred mainly for their antlers, our strategy is based on an agreement with the National Trophy Body in Spain which rejects trophies from foreign populations. Rejection decreases the value of the trophy so that it becomes more profitable to produce autochthonous deer. Using such a strategy at some critical step in the production or commercialisation process may be a good model to apply in protecting genetic properties of exploited species.

  3. Decreasing prevalence of brucellosis in red deer through efforts to control disease in livestock (United States)

    Serrano, E.; Cross, P.C.; Beneria, M.; Ficapal, A.; Curia, J.; Marco, X.; Lavin, S.; Marco, I.


    When a pathogen infects a number of different hosts, the process of determining the relative importance of each host species to the persistence of the pathogen is often complex. Removal of a host species is a potential but rarely possible way of discovering the importance of that species to the dynamics of the disease. This study presents the results of a 12-year programme aimed at controlling brucellosis in cattle, sheep and goats and the cascading impacts on brucellosis in a sympatric population of red deer (Cervus elaphus) in the Boumort National Game Reserve (BNGR; NE Spain). From February 1998 to December 2009, local veterinary agencies tested over 36 180 individual blood samples from cattle, 296 482 from sheep and goats and 1047 from red deer in the study area. All seropositive livestock were removed annually. From 2006 to 2009 brucellosis was not detected in cattle and in 2009 only one of 97 red deer tested was found to be positive. The surveillance and removal of positive domestic animals coincided with a significant decrease in the prevalence of brucellosis in red deer. Our results suggest that red deer may not be able to maintain brucellosis in this region independently of cattle, sheep or goats, and that continued efforts to control disease in livestock may lead to the eventual eradication of brucellosis in red deer in the area.

  4. Mapping brucellosis increases relative to elk density using hierarchical Bayesian models (United States)

    Cross, Paul C.; Heisey, Dennis M.; Scurlock, Brandon M.; Edwards, William H.; Brennan, Angela; Ebinger, Michael R.


    The relationship between host density and parasite transmission is central to the effectiveness of many disease management strategies. Few studies, however, have empirically estimated this relationship particularly in large mammals. We applied hierarchical Bayesian methods to a 19-year dataset of over 6400 brucellosis tests of adult female elk (Cervus elaphus) in northwestern Wyoming. Management captures that occurred from January to March were over two times more likely to be seropositive than hunted elk that were killed in September to December, while accounting for site and year effects. Areas with supplemental feeding grounds for elk had higher seroprevalence in 1991 than other regions, but by 2009 many areas distant from the feeding grounds were of comparable seroprevalence. The increases in brucellosis seroprevalence were correlated with elk densities at the elk management unit, or hunt area, scale (mean 2070 km2; range = [95–10237]). The data, however, could not differentiate among linear and non-linear effects of host density. Therefore, control efforts that focus on reducing elk densities at a broad spatial scale were only weakly supported. Additional research on how a few, large groups within a region may be driving disease dynamics is needed for more targeted and effective management interventions. Brucellosis appears to be expanding its range into new regions and elk populations, which is likely to further complicate the United States brucellosis eradication program. This study is an example of how the dynamics of host populations can affect their ability to serve as disease reservoirs.

  5. Ungulate herbivory on alpine willow in the Sangre de Cristo Mountains of Colorado (United States)

    Zeigenfuss, L.C.; Schoenecker, K.A.; Amburg, L.K.V.


    In many areas of the Rocky Mountains, elk (Cervus elaphus) migrate from low-elevation mountain valleys during spring to high-elevation subalpine and alpine areas for the summer. Research has focused on the impacts of elk herbivory on winter-range plant communities, particularly on woody species such as willow and aspen; however, little information is available on the effects of elk herbivory on alpine willows. In the Sangre de Cristo Mountains of south central Colorado, select alpine areas appear to receive high levels of summer elk herbivory, while other areas are nearly unbrowsed. In 2005 and 2008, we measured willow height, cover, and utilization on sites that appeared to be used heavily by elk, as well as on sites that appeared to be used lightly, to determine differences between these communities over time. We found less willow cover and shorter willows at sites that received higher levels of browsing compared to those that had lower levels of browsing. Human recreational use was greater at lightly browsed sites than at highly browsed sites. From 2005 to 2008, willow utilization declined, and willow cover and height increased at sites with heavy browsing, likely owing to ownership change of adjacent valley land which led to (1) removal of grazing competition from, cattle at valley locations and (2) increased human use in alpine areas, which displaced elk. We discuss the implications of increased human use and climate change on elk use of these alpine habitats. ?? 2011.

  6. Comparison of Mexican wolf and coyote diets in Arizona and New Mexico (United States)

    Carrera, R.; Ballard, W.; Gipson, P.; Kelly, B.T.; Krausman, P.R.; Wallace, M.C.; Villalobos, C.; Wester, D.B.


    Interactions between wolves (Canis lupus) and coyotes (C. latrans) can have significant impacts on their distribution and abundance. We compared diets of recently translocated Mexican wolves (C. l. baileyi) with diets of resident coyotes in Arizona and New Mexico, USA. We systematically collected scats during 2000 and 2001. Coyote diet was composed mostly of mammalian species, followed by vegetation and insects. Elk (Cervus elaphus) was the most common item in coyote scats. Mexican wolf diet had a higher proportion of large mammals and fewer small mammals than coyote diet; however, elk was also the most common food item in Mexican wolf scats. Our results suggest that Mexican wolf diet was more similar to coyote diet than previously reported, but coyotes had more seasonal variation. Considering results in other areas, we expect that Mexican wolves will have a negative impact on coyotes through direct mortality and possibly competition. Reintroduction of Mexican wolves may have great impacts on communities by changing relationships among other predators and their prey.

  7. Changes in interacting species with disturbance (United States)

    Cole, Glen F.


    Human-influenced changes in the diversity and abundance of native wildlife in a southern boreal forest area, which became a national park in 1975, are used to develop working hypotheses for predicting and subsequently measuring the effects of disturbance or restoration programs on groups of interacting species. Changes from presettlement conditions began with early 1900 hunting, which eliminated woodland caribou ( Rangifer tarandus) and elk ( Cervus elaphus), and reduced moose ( Alces alces) to the low numbers which still persist. Increases in white-tailed deer ( Odocoileus virginianus), as these other cervid species became less abundant or absent, provided enough alternative food to sustain the system's carnivores until plant succession on previously burned or logged areas also caused deer to decline. With increased competition for reduced food, carnivore species also became less abundant or absent and overexploited some prey populations. The abilities of interacting species to maintain dynamically stable populations or persist varied with their different capacities to compensate for increased exploitation or competition. These relationships suggested a possible solution to the problem of predicting the stability of populations in disturbed systems. For the 1976 1985 period, a hypothesis that the increased protection of wildlife from exploitation in a national park would restore a more diverse, abundant, and productive fauna had to be rejected.

  8. Parasitofauna in the gastrointestinal tract of the Cervids (Cervidae in northern Poland

    Directory of Open Access Journals (Sweden)

    Burlinski P.


    Full Text Available The aim of this study was to determine parasite species and their prevalence in the gastrointestinal tract of the roe deer (Capreolus capreolus L., red deer (Cervus elaphus and fallow deer (Dama dama from selected areas of northern Poland. A total of 1668 fecal samples, obtained from animals living in three various regions, were analyzed. The samples were examined by coproscopic techniques, including flotation (according to Fülleborn, decantation (according to Zarnowski and Josztowa and flotation in the McMaster chamber. The experimental materials were collected from January 2008 to January 2009, in the hunting districts belonging to two hunting associations, "Bór" in Wipsowo and "Gwardia Slupsk" in Lupawa. In order to compare the health status of cervids kept under farm-like conditions, fecal samples were also collected in the paddocks of the Municipal Zoological Garden "Wybrzeza" in Gdansk. Parasites (eggs and oocysts were found in 42.09% of the analyzed samples. The most frequently observed roundworm was Chabertia sp. (13.79% in roe deer, 12.07% in red deer, 11.36% in fallow deer. High counts of Ostertagia sp. eggs (11.55% in roe deer, 6.03% in red deer, 13.18% in fallow deer and Trichostrongylus sp. eggs (10.69% in roe deer, 2.93% in red deer, 10.68% in fallow deer were also noted. The highest infestation rates (51.17% were determined in the studied areas of the Zoological Garden in Gdansk.

  9. Monitoring fish, wildlife, radionuclides and chemicals at Hanford, Washington

    International Nuclear Information System (INIS)

    Concern about the effects of potential releases from nuclear and non-nuclear activities on the US Department of Energy's Hanford Site in southeastern Washington has evolved over four decades into a comprehensive environmental monitoring and surveillance program. The program includes field sampling, and chemical and physical analyses of air, surface and ground water, fish, wildlife, soil, foodstuffs, and natural vegetation. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined, usually during the breeding season. Data from monitoring efforts are used to assess the environmental impacts of Hanford operations and calculate the overall radiological dose to humans onsite, at the Site perimeter, or residing in nearby communities. Chinook salmon (Oncorhynchus tshawytscha) spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter nesting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis) and great blue heron (Ardea herodias), and various other animals, e.g., mule deer (Odocoileus hemionus) and coyotes (Canis latrans) are common. Measured exposure to penetrating radiation and calculated radiation doses to the public are well below applicable regulatory limits. 35 refs., 4 figs

  10. Overview of a comprehensive environmental monitoring and surveillance program: The role of fish and wildlife

    International Nuclear Information System (INIS)

    Concern about the effects of potential releases from nuclear and non-nuclear activities on the US Department of Energy's Hanford Site in southeastern Washington has evolved over four decades into a comprehensive environmental monitoring and surveillance program. The program includes field sampling, and chemical and physical analyses of air, surface and ground water, fish and wildlife, soil, foodstuffs, and natural vegetation. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined, usually during the breeding season. Data from monitoring efforts are used to assess the environmental impacts of Hanford operations and calculate the overall radiological dose to humans onsite, at the Site perimeter, or residing in nearby communities. Chinook salmon spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter nesting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis) and great blue heron (Ardea herodias), and various other animals, e.g., mule deer (Odocoileus hemionus) and coyotes (Canis latrans) are common. Measured exposure to penetrating radiation and calculated radiation doses to the public are well below applicable regulatory limits

  11. Hanford, Washington: Monitoring to assess the state of the environment

    International Nuclear Information System (INIS)

    Environmental monitoring has been ongoing at the US Department of Energy's Hanford Site for almost 5 years. Concentrations of airborne radionuclides at the Site perimeter, and concentrations of radionuclides and nonradiological water quality in the Columbia River are in compliance with applicable standards. Radionuclide levels in food stuffs irrigated with river water taken downstream of the Site, most onsite wildlife samples, and soils and vegetation from both on- and off-site locations are typical of those attributable to worldwide fallout. The calculated dose potentially received by a maximally exposed individual, using worst-case assumptions for all routes of exposure, was 0.05 mrem/yr in 1989. The average per capita whole-body effective dose to people, based on a population of 340,000 living within 80 km (50 mi) of the Site, was <0.01 to 0.03 mrem annually from 1985 through 1989. Chinook salmon (Oncorhynchus tshawytscha) spawning in Hanford Reach of the Columbia River has increased in recent years with a con-comitant increase in winter roosting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is also increasing. Nesting Canada goose (Branta canadensis), great blue heron (Ardea herodias), various plants and other animals, e.g., mule deer (Odocoileus hemionus), and coyotes (Canis latrans) are common

  12. Long-term environmental monitoring at Hanford, Washington

    International Nuclear Information System (INIS)

    Environmental monitoring has been an ongoing activity on the US Department of Energy's Hanford Site in southeastern Washington for over 45 years. Objectives are to detect and assess potential impacts of Site operations (nuclear and nonnuclear) on air, surface and ground water, foodstuffs, fish, wildlife, soils and vegetation. Data from monitoring efforts are used to calculate the overall radiological dose to humans working onsite or residing in nearby communities. In 1988, measured Hanford Site perimeter concentrations of airborne radionuclides were below applicable guidelines. In addition to monitoring radioactivity in fish and wildlife, population numbers of key species are determined. Chinook salmon (Oncorhynchus tshawytscha) spawning in the Columbia River at Hanford has increased in recent years with a concomitant increase in winter roosting activity of bald eagles (Haliaeetus leucocephalus). An elk (Cervus elaphus) herd, established by immigration in 1972, is increasing. The Hanford Site also serves as a refuge for Canada good (Branta canadensis) and great blue heron (Ardea herodias), and various plants and other animals, e.g., (Odocoileus hemionus) and coyote (Canis latrans). 32 refs., 4 figs

  13. Evaluation of Serodiagnostic Assays for Mycobacterium bovis Infection in Elk, White-Tailed Deer, and Reindeer in the United States

    Directory of Open Access Journals (Sweden)

    Jeffrey T. Nelson


    Full Text Available In 2011, the United States Department of Agriculture conducted a project in which elk (Cervus elaphus spp., white-tailed deer (WTD (Odocoileus virginianus, and reindeer (Rangifer tarandus were evaluated by the single cervical tuberculin test (SCT, comparative cervical tuberculin test (CCT, and serologic tests. The rapid antibody detection tests evaluated were the CervidTB Stat-Pak (Stat-Pak, and the Dual Path Platform VetTB (DPP. Blood was collected from presumably uninfected animals prior to tuberculin injection for the SCT. A total of 1,783 animals were enrolled in the project. Of these, 1,752 (98.3% were classified as presumably uninfected, based on originating from a captive cervid herd with no history of exposure to TB. Stat-Pak specificity estimates were 92.4% in reindeer, 96.7% in WTD, and 98.3% in elk and were not significantly different from SCT specificity estimates. Using the DPP in series on Stat-Pak antibody-positive samples improved specificity in the three species. Thirty one animals were classified as confirmed infected, based on necropsy and laboratory results, and 27/31 were antibody positive on Stat-Pak for an estimated sensitivity of 87.1%. The study findings indicate that rapid serologic tests used in series are comparable to the SCT and CCT and may have a greater ability to detect TB-infected cervids.

  14. Temporal stability in the genetic structure of Sarcoptes scabiei under the host-taxon law: empirical evidences from wildlife-derived Sarcoptes mite in Asturias, Spain

    Directory of Open Access Journals (Sweden)

    Rossi Luca


    Full Text Available Abstract Background Implicitly, parasite molecular studies assume temporal genetic stability. In this study we tested, for the first time to our knowledge, the extent of changes in genetic diversity and structure of Sarcoptes mite populations from Pyrenean chamois (Rupicapra pyrenaica in Asturias (Spain, using one multiplex of 9 microsatellite markers and Sarcoptes samples from sympatric Pyrenean chamois, red deer (Cervus elaphus, roe deer (Capreolus capreolus and red fox (Vulpes vulpes. Results The analysis of an 11-years interval period found little change in the genetic diversity (allelic diversity, and observed and expected heterozygosity. The temporal stability in the genetic diversity was confirmed by population structure analysis, which was not significantly variable over time. Population structure analysis revealed temporal stability in the genetic diversity of Sarcoptes mite under the host-taxon law (herbivore derived- and carnivore derived-Sarcoptes mite among the sympatric wild animals from Asturias. Conclusions The confirmation of parasite temporal genetic stability is of vital interest to allow generalizations to be made, which have further implications regarding the genetic structure, epidemiology and monitoring protocols of the ubiquitous Sarcoptes mite. This could eventually be applied to other parasite species.

  15. Influence of group size on the success of wolves hunting bison.

    Directory of Open Access Journals (Sweden)

    Daniel R MacNulty

    Full Text Available An intriguing aspect of social foraging behaviour is that large groups are often no better at capturing prey than are small groups, a pattern that has been attributed to diminished cooperation (i.e., free riding in large groups. Although this suggests the formation of large groups is unrelated to prey capture, little is known about cooperation in large groups that hunt hard-to-catch prey. Here, we used direct observations of Yellowstone wolves (Canis lupus hunting their most formidable prey, bison (Bison bison, to test the hypothesis that large groups are more cooperative when hunting difficult prey. We quantified the relationship between capture success and wolf group size, and compared it to previously reported results for Yellowstone wolves hunting elk (Cervus elaphus, a prey that was, on average, 3 times easier to capture than bison. Whereas improvement in elk capture success levelled off at 2-6 wolves, bison capture success levelled off at 9-13 wolves with evidence that it continued to increase beyond 13 wolves. These results are consistent with the hypothesis that hunters in large groups are more cooperative when hunting more formidable prey. Improved ability to capture formidable prey could therefore promote the formation and maintenance of large predator groups, particularly among predators that specialize on such prey.

  16. Welfare issues of modern deer farming

    Directory of Open Access Journals (Sweden)

    Silvana Mattiello


    Full Text Available This paper will start with briefly outlining the recent domestication history of red deer (Cervus elaphus and fallow deer (Dama dama, followed by a description of the present status of modern deer farming. It will then review the main welfare issues of deer farming. The following aspects will be considered: accommodation and housing, management and handling, nutrition (feed and water provision, transport and slaughter, plus a short mention of velvet harvest. As a summary, the following practices can be recommended to ensure animal welfare in modern deer farming: the adoption of suitable housing systems and of adequate management techniques (e.g. specific handling pens and drop-floor cradles or crushes and the respect of specific needs (e.g. provision of protection and shelter from predators as well as from climatic extremes, such as cold winds or direct solar radiation. Handling and yarding operations will be easier when they occur in dim light. Special attention must be paid to the manipulation of the newborns. At the slaughterhouse, facilities must be designed specifically for deer. The presence of well trained stockpersons, with a sound knowledge of deer physiology and behaviour, is also a key-factor for improving welfare levels in deer farms. To achieve these aims, training of the managers and stockpersons and the adoption of specific codes of conducts are highly recommendable.

  17. Aboriginal overkill in the intermountain west of North America : Zooarchaeological tests and implications. (United States)

    Lyman, R Lee


    Zooarchaeological evidence has often been called on to help researchers determine prehistoric relative abundances of elk (Cervus elaphus) in the Greater Yellowstone ecosystem. Some interpret that evidence as indicating elk were abundant; others interpret it as indicating elk were rare. Wildlife biologist Charles Kay argues that prehistoric faunal remains recovered from archaeological sites support his contention that aboriginal hunters depleted elk populations throughout the Intermountain West, including the Yellowstone area. To support his contention Kay cites differences between modern and prehistoric relative abundances of artiodactyls, age and sex demographics of ungulates in the prehistoric record indicating selective predation of prime-age females, and a high degree of fragmentation of artiodactyl bones indicating humans were under nutritional stress. Kay's data on taxonomic abundances are time and space averaged and thus mask much variation in elk abundances. When these data are not lumped they suggest that elk were at some times, in some places, as abundant as they are today. Data on the age-sex demography of artiodactyl prey are ambiguous or contradict Kay's predictions. Bone fragmentation data are variously nonexistent or ambiguous. The zooarchaeological implications of Kay's aboriginal overkill hypothesis have not yet undergone rigorous testing. PMID:26190412

  18. Accumulation of polonium 210Po, uranium (234U and 238U and plutonium (238Pu and 239+240Pu in tissues and organs of deer Carvidae from northern Poland

    Directory of Open Access Journals (Sweden)

    Strumińska-Parulska D. I.


    Full Text Available Livers, kidneys and muscles of large herbivorous animals: roe deer (Capreolus capreolus, red deer (Cervus elaphus and fallow deer (Dama dama, collected in northern Poland, were the subject of the investigation. Polonium, uranium and plutonium activities were measured using alpha spectrometry along with relevant radiochemical procedures. The average concentrations of 210Po ranged between 0.02±0.01 Bq kg−1 ww in muscles and 7.15±0.12 Bq kg−1 ww in kidneys. The concentration of 238U ranged widely between 2.49±0.18 and 69.37±5.45 mBq kg−1 ww. The average concentrations of 239+240Pu ranged between 0.18±0.04 mBq kg−1 ww in muscle and 2.77±0.60 mBq kg−1 ww in kidneys. Statistical analysis showed that the sampling location, sex, age and species did not influence on the radioisotope activities in the analyzed samples.

  19. Landowner and permit-holder perceptions of wildlife damage around the Idaho National Engineering and Environmental Laboratory. A survey of INEEL neighbors about elk, mule deer, pronghorn antelope, and depredation

    Energy Technology Data Exchange (ETDEWEB)

    Roush, D.E. Jr. [Environmental Science and Research Foundation, Inc., Idaho Falls, ID (United States); Beaver, D.E. [Univ. of Idaho, Moscow, ID (United States). Coll. of Forestry, Wildlife, and Range Sciences


    Property-owners (N = 220) around the Idaho National Engineering and Environmental Laboratory (INEEL) in southeastern Idaho were surveyed about depredation, control methods and economic issues related to use of the area by elk (Cervus elaphus), mule deer (Odocoileus hemionus), and pronghorn antelope (Antilocapra americana). Depredation was defined as damage to privately-owned crops, forage, and fences and irrigation equipment by these animals. The focus on the three ungulate species was prompted by concerns that elk, which had recolonized the INEEL since 1984, were responsible for an inordinate amount of unprecedented damage to agricultural operations. As the INEEL is a US Department of Energy (DOE) reserve with little public hunting access, there have been calls for removal of elk from this land. This study`s objective was to quantify the wildlife damage occurring on agricultural operations adjacent to the INEEL and to characterize the damage attributed to each big game species. Responses from 70.2% of the target population indicate an evenness of opinion, by which the authors mean that various opinions were represented equitably, toward these animals and wildlife damage Total estimated wildlife damage in 1996 was between $140,000 and $180,000 It was attributed foremost to elk, although pronghorn antelope were viewed nearly as damaging. Respondents placed high values in big game animals and wished to see them continue to inhabit these lands. For managing depredation, adjusting hunting seasons was preferred.

  20. Concentration of 137Cs and 40K in meat of omnivore and herbivore game species in mountain forest ecosystems of Gorski Kotar, Croatia

    International Nuclear Information System (INIS)

    The aim of this study was to investigate 137Cs and 40K load in large mammal game species in the mountain forest region of Gorski Kotar in Croatia approximately a quarter of century after the Chernobyl accident. 137Cs and 40K activity were determined by the gamma-spectrometric method in 49 meat samples of five large game species: brown bear (Ursus arctos), wild boar (Sus scrofa), roe deer (Capreolus capreolus), red deer (Cervus elaphus), and chamois (Rupicapra rupicapra). The results indicated that herbivore game species (roe deer, red deer and chamois) show significantly lower 137Cs concentrations than omnivore species (brown bear, wild boar), thereby confirming the hypothesis that different dietary strategy impact caesium concentrations in meat. The measured caesium load in brown bear meat was in the range of two orders of magnitude, while caesium load in wild boar meat was found in the range of one order of magnitude. The estimated effective equivalent dose showed that uptake of the highest caesium doses would be from consumption of omnivore species meat, while much lower doses could be taken in with the consumption of meat from herbivore species. (author)

  1. Lesion Distribution and Epidemiology of Mycobacterium bovis in Elk and White-Tailed Deer in South-Western Manitoba, Canada

    Directory of Open Access Journals (Sweden)

    Todd K. Shury


    Full Text Available Surveillance for Mycobacterium bovis in free-ranging elk (Cervus elaphus and white-tailed deer (Odocoileus virginianus from south-western Manitoba was carried out from 1997 to 2010 to describe the lesions, epidemiology, and geographic distribution of disease. Tissues were cultured from animals killed by hunters, culled for management, blood-tested, or found opportunistically. Period prevalence in elk was approximately six times higher than deer, suggesting a significant reservoir role for elk, but that infected deer may also be involved. Prevalence was consistently higher in elk compared to deer in a small core area and prevalence declines since 2003 are likely due to a combination of management factors instituted during that time. Older age classes and animals sampled from the core area were at significantly higher risk of being culture positive. Positive elk and deer were more likely to be found through blood testing, opportunistic surveillance, and culling compared to hunting. No non-lesioned, culture-positive elk were detected in this study compared to previous studies in red deer.

  2. Stable isotope ratio analysis to differentiate temporal diets of a free-ranging herbivore. (United States)

    Walter, W D; Leslie, D M


    Stable isotope ratio analysis (SIRA) of carbon (delta13C) and nitrogen (delta15N) in tissue samples of herbivores can identify photosynthetic pathways (C3 vs. C4) of plants consumed. We present results from free-ranging Rocky Mountain elk (Cervus elaphus) that highlight the ability to differentiate diets using tissue delta13C and delta15N. The signatures of delta13C and delta15N differed in tissues of varying metabolic activity: muscle, a short-term dietary indicator (i.e., 1-2 months) and hoof, a long-term dietary indicator (i.e., 3-12 months). We also documented that delta13C and delta15N values along elk hooves (proximal, middle, distal sections) elucidated temporal shifts in dietary selection. The carbon isotopes of the composite hoof were similar to those of the middle section, but the composite hoof differed in delta(13)C from the distal and proximal sections. The delta13C and delta15N signatures also differed among elk populations, indicating temporal dietary shifts of individuals occupying disparate native range and human-derived agricultural landscapes. Analyses of stable isotopes in various tissues highlighted carbon and nitrogen assimilation through time and differences in the foraging ecology of a rangeland herbivore. PMID:19530151

  3. Application of commercial enzyme linked immunosorbent assays (ELISA for the detection of antibodies for foot-and-mouth disease virus in wild boar and red deer

    Directory of Open Access Journals (Sweden)

    Terzić Svjetlana


    Full Text Available For detecting antibodies towards foot and mouth (FMD virus in sera collected from red deer hinds (Cervus elaphus and wild boars (Sus scrofa, three commercially available enzyme-linked immunosorbent assays (ELISA were used. Two ELISA kits (PrioCHECK FMDV NS and CHEKIT FMD-3ABC were used for the detection of antibodies towards non-structural proteins of FMD virus and one assay was based on the detection of antibodies for serotype O (PrioCHECK FMDV type O. All of the sera tested in our study were negative for antibodies against FMD virus. The aim of this study was to investigate the usefulness of commercially available ELISA kits given for marketing authorization in Croatia in testing the prevalence of FMD antibodies in wild boar and red deer populations. Since the producers of ELISA kits used in our study did not declare wild animals as a target species, we hypothesised that the same kits could be used for serological diagnosis of FMD in red deer and wild boars. Our study confirmed that the kits used are acceptable for detecting antibodies in both species tested, however, the investigation highlighted the problem of validating the kits due to the absence of available positive sera originating from red deer, as well as other susceptible species, especially artiodactyls.

  4. The expanding universe of prion diseases.

    Directory of Open Access Journals (Sweden)

    Joel C Watts


    Full Text Available Prions cause fatal and transmissible neurodegenerative disease. These etiological infectious agents are formed in greater part from a misfolded cell-surface protein called PrP(C. Several mammalian species are affected by the diseases, and in the case of "mad cow disease" (BSE the agent has a tropism for humans, with negative consequences for agribusiness and public health. Unfortunately, the known universe of prion diseases is expanding. At least four novel prion diseases--including human diseases variant Creutzfeldt-Jakob disease (vCJD and sporadic fatal insomnia (sFI, bovine amyloidotic spongiform encephalopathy (BASE, and Nor98 of sheep--have been identified in the last ten years, and chronic wasting disease (CWD of North American deer (Odocoileus Specis and Rocky Mountain elk (Cervus elaphus nelsoni is undergoing a dramatic spread across North America. While amplification (BSE and dissemination (CWD, commercial sourcing of cervids from the wild and movement of farmed elk can be attributed to human activity, the origins of emergent prion diseases cannot always be laid at the door of humankind. Instead, the continued appearance of new outbreaks in the form of "sporadic" disease may be an inevitable outcome in a situation where the replicating pathogen is host-encoded.

  5. The expanding universe of prion diseases.

    Directory of Open Access Journals (Sweden)


    Full Text Available Prions cause fatal and transmissible neurodegenerative disease. These etiological infectious agents are formed in greater part from a misfolded cell-surface protein called PrP(C. Several mammalian species are affected by the diseases, and in the case of "mad cow disease" (BSE the agent has a tropism for humans, with negative consequences for agribusiness and public health. Unfortunately, the known universe of prion diseases is expanding. At least four novel prion diseases-including human diseases variant Creutzfeldt-Jakob disease (vCJD and sporadic fatal insomnia (sFI, bovine amyloidotic spongiform encephalopathy (BASE, and Nor98 of sheep-have been identified in the last ten years, and chronic wasting disease (CWD of North American deer (Odocoileus Specis and Rocky Mountain elk (Cervus elaphus nelsoni is undergoing a dramatic spread across North America. While amplification (BSE and dissemination (CWD, commercial sourcing of cervids from the wild and movement of farmed elk can be attributed to human activity, the origins of emergent prion diseases cannot always be laid at the door of humankind. Instead, the continued appearance of new outbreaks in the form of "sporadic" disease may be an inevitable outcome in a situation where the replicating pathogen is host-encoded.

  6. Les indicateurs de la pression du cerf élaphe sur la végétation du sous-bois en forêt feuillue tempérée (synthèse bibliographique

    Directory of Open Access Journals (Sweden)

    Lehaire, F.


    Full Text Available Indicators of red deer pressure on understory vegetation in temperate deciduous forest. A review. During recent decades, populations of large herbivores have increased. Consequently, their pressure on forest vegetation has been exacerbated and, in some forests, has reached levels that have reduced the diversity of forest ecosystem services. Assessing the balance between timber production and hunting remains a crucial question for forest users (foresters, hunters and requires reliable tools such as ecological indicators. This paper reviews the ecological indicators that characterize the pressure of red deer (Cervus elaphus L. on understory vegetation in temperate deciduous forest. Such indicators monitor the cover, height, stem density, biomass and species diversity of different indicator plant groups. These plant groups embrace species belonging to the herbaceous stratum, forest regeneration or particular species such as bilberry (Vaccinium myrtillus L. and bramble (Rubus fruticosus L.. As the choice of indicator plants affects considerably the performance of the ecological indicator of deer pressure on understory vegetation, such decisions must be carried out with caution, taking into account plant abundance and palatability. The reviewed indicators help us to understand the relationship between biodiversity, carrying capacity and deer populations. They are intended for use by forest managers who would like to monitor red deer pressure in relation to forest management goals and forest sustainability.

  7. Native prey distribution and migration mediates wolf (Canis lupus) predation on domestic livestock in the Greater Yellowstone Ecosystem (United States)

    Nelson, Abigail A.; Kauffman, Matthew; Middleton, A.D.; Jimenez, M.D.; McWhirter, D. E.; Gerow, K.


    Little research has evaluated how the migration and distribution of native prey influence patterns of livestock depredation by large carnivores. Previous research suggests that the presence of native prey can increase depredation rates by attracting predators (prey tracking hypothesis). Alternatively, the absence of native prey may facilitate predation on livestock (prey scarcity hypothesis). In this study, we evaluated support for these competing hypotheses through analysis of 4 years of cattle (Bos taurus L., 1758) depredation data (n = 39 kills), 2 years of summer and fall wolf (Canis lupus L., 1758) predation and tracking data (n = 4 wolves), and 3 years of elk (Cervus elaphus L., 1758) movement data (n = 70 elk). We used logistic regression to compare the relative influence of landscape features and elk distribution on the risk of livestock depredation in areas with migratory and resident elk. Cattle depredations occurred in habitats with increased encounter rates between wolves and livestock. In resident elk areas, depredation sites were associated with elk distribution and open roads. In migratory elk areas, depredation sites were associated with wolf dens, streams, and open habitat. Patterns of carnivore–livestock conflicts are complex, and using ungulate distribution data can predict and minimize such instances.

  8. Echinococcus granulosus in gray wolves and ungulates in Idaho and Montana, USA. (United States)

    Foreyt, William J; Drew, Mark L; Atkinson, Mark; McCauley, Deborah


    We evaluated the small intestines of 123 gray wolves (Canis lupus) that were collected from Idaho, USA (n=63), and Montana, USA (n=60), between 2006 and 2008 for the tapeworm Echinococcus granulosus. The tapeworm was detected in 39 of 63 wolves (62%) in Idaho, USA, and 38 of 60 wolves (63%) in Montana, USA. The detection of thousands of tapeworms per wolf was a common finding. In Idaho, USA, hydatid cysts, the intermediate form of E. granulosus, were detected in elk (Cervus elaphus), mule deer (Odocoileus hemionus), and a mountain goat (Oreamnos americanus). In Montana, USA, hydatid cysts were detected in elk. To our knowledge, this is the first report of adult E. granulosus in Idaho, USA, or Montana, USA. It is unknown whether the parasite was introduced into Idaho, USA, and southwestern Montana, USA, with the importation of wolves from Alberta, Canada, or British Columbia, Canada, into Yellowstone National Park, Wyoming, USA, and central Idaho, USA, in 1995 and 1996, or whether the parasite has always been present in other carnivore hosts, and wolves became a new definitive host. Based on our results, the parasite is now well established in wolves in these states and is documented in elk, mule deer, and a mountain goat as intermediate hosts. PMID:19901399

  9. Aspen Ecology in Rocky Mountain National Park: Age Distribution, Genetics, and the Effects of Elk Herbivory

    Energy Technology Data Exchange (ETDEWEB)

    Tuskan, Gerald A [ORNL; Yin, Tongming [ORNL


    Lack of aspen (Populus tremuloides) recruitment and canopy replacement of aspen stands that grow on the edges of grasslands on the low-elevation elk (Cervus elaphus) winter range of Rocky Mountain National Park (RMNP) in Colorado has been a cause of concern for more than 70 years (Packard, 1942; Olmsted, 1979; Stevens, 1980; Hess, 1993; R.J. Monello, T.L. Johnson, and R.G. Wright, Rocky Mountain National Park, 2006, written commun.). These aspen stands are a significant resource since they are located close to the park's road system and thus are highly visible to park visitors. Aspen communities are integral to the ecological structure of montane and subalpine landscapes because they contain high native species richness of plants, birds, and butterflies (Chong and others, 2001; Simonson and others, 2001; Chong and Stohlgren, 2007). These low-elevation, winter range stands also represent a unique component of the park's plant community diversity since most (more than 95 percent) of the park's aspen stands grow in coniferous forest, often on sheltered slopes and at higher elevations, while these winter range stands are situated on the low-elevation ecotone between the winter range grasslands and some of the park's drier coniferous forests.

  10. Evaluating cost-efficiency and accuracy of hunter harvest survey designs (United States)

    Lukacs, P.M.; Gude, J.A.; Russell, R.E.; Ackerman, B.B.


    Effective management of harvested wildlife often requires accurate estimates of the number of animals harvested annually by hunters. A variety of techniques exist to obtain harvest data, such as hunter surveys, check stations, mandatory reporting requirements, and voluntary reporting of harvest. Agencies responsible for managing harvested wildlife such as deer (Odocoileus spp.), elk (Cervus elaphus), and pronghorn (Antilocapra americana) are challenged with balancing the cost of data collection versus the value of the information obtained. We compared precision, bias, and relative cost of several common strategies, including hunter self-reporting and random sampling, for estimating hunter harvest using a realistic set of simulations. Self-reporting with a follow-up survey of hunters who did not report produces the best estimate of harvest in terms of precision and bias, but it is also, by far, the most expensive technique. Self-reporting with no followup survey risks very large bias in harvest estimates, and the cost increases with increased response rate. Probability-based sampling provides a substantial cost savings, though accuracy can be affected by nonresponse bias. We recommend stratified random sampling with a calibration estimator used to reweight the sample based on the proportions of hunters responding in each covariate category as the best option for balancing cost and accuracy. ?? 2011 The Wildlife Society.

  11. Northwest Montana Wildlife Habitat Enhancement: Hungry Horse Elk Mitigation Project: Monitoring and Evaluation Plan.

    Energy Technology Data Exchange (ETDEWEB)

    Casey, Daniel; Malta, Patrick


    Portions of two important elk (Cervus elaphus) winter ranges totalling 8749 acres were lost due to the construction of the Hungry Horse Dam hydroelectric facility. This habitat loss decreased the carrying capacity of the both the elk and the mule deer (Odocoileus hemionus). In 1985, using funds from the Bonneville Power Administration (BPA) as authorized by the Northwest Power Act, the Montana Department of Fish, Wildlife and Parks (FWP) completed a wildlife mitigation plan for Hungry Horse Reservoir. This plan identified habitat enhancement of currently-occupied winter range as the most cost-efficient, easily implemented mitigation alternative available to address these large-scale losses of winter range. The Columbia Basin Fish and Wildlife Program, as amended in 1987, authorized BPA to fund winter range enhancement to meet an adjusted goal of 133 additional elk. A 28-month advance design phase of the BPA-funded project was initiated in September 1987. Primary goals of this phase of the project included detailed literature review, identification of enhancement areas, baseline (elk population and habitat) data collection, and preparation of 3-year and 10-year implementation plans. This document will serve as a site-specific habitat and population monitoring plan which outlines our recommendations for evaluating the results of enhancement efforts against mitigation goals. 25 refs., 13 figs., 7 tabs.

  12. Demographics of an experimentally released population of elk in Great Smoky Mountains National Park (United States)

    Murrow, Jennifer L.; Clark, Joseph D.; Delozier, E. Kim


    We assessed the potential for reestablishing elk (Cervus elaphus) in Great Smoky Mountains National Park (GSMNP), USA, by estimating vital rates of experimentally released animals from 2001 to 2006. Annual survival rates for calves ranged from 0.333 to 1.0 and averaged 0.592. Annual survival for subadult and adult elk (i.e., ≥1 yr of age) ranged from 0.690 to 0.933, depending on age and sex. We used those and other vital rates to model projected population growth and viability using a stochastic individual-based model. The annual growth rate (λ) of the modeled population over a 25-year period averaged 0.996 and declined from 1.059 the first year to 0.990 at year 25. The modeled population failed to attain a positive 25-year mean growth rate in 46.0% of the projections. Poor calf recruitment was an important determinant of low population growth. Predation by black bears (Ursus americanus) was the dominant calf mortality factor. Most of the variance of growth projections was due to demographic variation resulting from the small population size (n  =  61). Management actions such as predator control may help increase calf recruitment, but our projections suggest that the GSMNP elk population may be at risk for some time because of high demographic variation.

  13. Bottom-up factors influencing riparian willow recovery in Yellowstone National Park (United States)

    Tercek, M.T.; Stottlemyer, R.; Renkin, R.


    After the elimination of wolves (Canis lupis L.) in the 1920s, woody riparian plant communities on the northern range of Yellowstone National Park (YNP) declined an estimated 50%. After the reintroduction of wolves in 19951996, riparian willows (Salix spp.) on YNP's northern range showed significant growth for the first time since the 1920s. However, the pace of willow recovery has not been uniform. Some communities have exceeded 400 cm, while others are still at pre-1995 levels of 250 cm max. height) willow sites where willows had escaped elk (Cervus elaphus L.) browsing with "short" willow sites that could still be browsed. Unlike studies that manipulated willow height with fences and artificial dams, we examined sites that had natural growth differences in height since the reintroduction of wolves. Tall willow sites had greater water availability, more-rapid net soil nitrogen mineralization, greater snow depth, lower soil respiration rates, and cooler summer soil temperatures than nearby short willow sites. Most of these differences were measured both in herbaceous areas adjacent to the willow patches and in the willow patches themselves, suggesting that they were not effects of varying willow height recovery but were instead preexisting site differences that may have contributed to increased plant productivity. Our results agree with earlier studies in experimental plots which suggest that the varying pace of willow recovery has been influenced by abiotic limiting factors that interact with top-down reductions in willow browsing by elk. ?? 2010 Western North American Naturalist.

  14. Inferences about ungulate population dynamics derived from age ratios (United States)

    Harris, N.C.; Kauffman, M.J.; Mills, L.S.


    Age ratios (e.g., calf:cow for elk and fawn:doe for deer) are used regularly to monitor ungulate populations. However, it remains unclear what inferences are appropriate from this index because multiple vital rate changes can influence the observed ratio. We used modeling based on elk (Cervus elaphus) life-history to evaluate both how age ratios are influenced by stage-specific fecundity and survival and how well age ratios track population dynamics. Although all vital rates have the potential to influence calf:adult female ratios (i.e., calf:xow ratios), calf survival explained the vast majority of variation in calf:adult female ratios due to its temporal variation compared to other vital rates. Calf:adult female ratios were positively correlated with population growth rate (??) and often successfully indicated population trajectories. However, calf:adult female ratios performed poorly at detecting imposed declines in calf survival, suggesting that only the most severe declines would be rapidly detected. Our analyses clarify that managers can use accurate, unbiased age ratios to monitor arguably the most important components contributing to sustainable ungulate populations, survival rate of young and ??. However, age ratios are not useful for detecting gradual declines in survival of young or making inferences about fecundity or adult survival in ungulate populations. Therefore, age ratios coupled with independent estimates of population growth or population size are necessary to monitor ungulate population demography and dynamics closely through time.

  15. Using Pellet Groups To Assess Response Of Elk and Deer to Roads and Energy Development

    Directory of Open Access Journals (Sweden)

    Matthew R. Dzialak


    Full Text Available Development and extraction of resources such as oil and gas has directly and indirectly reduced available habitat to wildlife through changes in behavior and resource use. To assess how elk (Cervus elaphus and deer (Odocoileus spp. were spatially distributed relative to roads and coal-bed natural gas well pads, we collected pellet group data during 2 summers in south-central Colorado. We used generalized linear mixed models to assess the relative probability of use of elk and deer in relation to roads and well pads. We found relative probability of use was positively associated with distance from roads, indicating greater use of areas farther away from roads. Relative probability of use was negatively associated with distance to well pads, potentially as a result of plant phenology and reseeding in disturbed areas around well pads. Other factors such as elevation, slope and vegetative security cover also influenced elk and deer spatial distributions. Based on these data, it appears resource use may be driven by forage and security cover more than disturbance features. Pellet group surveys appear to be an appropriate technique for evaluating resource use of populations across large spatial extents when logistical and financial constraints limit the use of more advanced technology such as very high frequency and global positioning system collars.

  16. Environmental factors shaping ungulate abundances in Poland. (United States)

    Borowik, Tomasz; Cornulier, Thomas; Jędrzejewska, Bogumiła


    Population densities of large herbivores are determined by the diverse effects of density-dependent and independent environmental factors. In this study, we used the official 1998-2003 inventory data on ungulate numbers from 462 forest districts and 23 national parks across Poland to determine the roles of various environmental factors in shaping country-wide spatial patterns of ungulate abundances. Spatially explicit generalized additive mixed models showed that different sets of environmental variables explained 39 to 50 % of the variation in red deer Cervus elaphus, wild boar Sus scrofa, and roe deer Capreolus capreolus abundances. For all of the studied species, low forest cover and the mean January temperature were the most important factors limiting their numbers. Woodland cover above 40-50 % held the highest densities for these species. Wild boar and roe deer were more numerous in deciduous or mixed woodlands within a matrix of arable land. Furthermore, we found significant positive effects of marshes and water bodies on wild boar abundances. A juxtaposition of obtained results with ongoing environmental changes (global warming, increase in forest cover) may indicate future growth in ungulate distributions and numbers. PMID:24244044

  17. Shapes of Differential Pulse Voltammograms and Level of Metallothionein at Different Animal Species

    Directory of Open Access Journals (Sweden)

    Rene Kizek


    Full Text Available Metallothioneins play a key role in maintaining homeostasis of essential metalsand in protecting of cells against metal toxicity as well as oxidative damaging. Exceptinghumans, blood levels of metallothionein have not yet been reported from any animalspecies. Blood plasma samples of 9 animal species were analysed by the adsorptive transferstripping technique to obtain species specific voltammograms. Quite distinct records wereobtained from the Takin (Budorcas taxicolor, while other interesting records were observedin samples from the European Bison (Bison bonasus bonasus and the Red-eared Slider(Trachemys scripta elegans. To quantify metallothionein the catalytic peak Cat2 was used,well developed in the Domestic Fowl (Gallus gallus f. domestica and showing a very lowsignal in the Red Deer (Cervus elaphus. The highest levels of metallothionein reachingover 20 μM were found in the Domestic Fowl. High levels of MT were also found in theBearded Dragon (Pogona vitticeps and the Grey Wolf (Canis lupus lupus. The lowestvalues of about 1-3 μM were determined in the Red-eared Slider, Takin and Red Deer. Employing a simple electrochemical detection it was possible to examine variation in blood metallothionein in different species of vertebrates.

  18. Shapes of Differential Pulse Voltammograms and Level of Metallothionein at Different Animal Species (United States)

    Adam, Vojtech; Beklova, Miroslava; Pikula, Jiri; Hubalek, Jaromir; Trnkova, Libuse; Kizek, Rene


    Metallothioneins play a key role in maintaining homeostasis of essential metals and in protecting of cells against metal toxicity as well as oxidative damaging. Excepting humans, blood levels of metallothionein have not yet been reported from any animal species. Blood plasma samples of 9 animal species were analysed by the adsorptive transfer stripping technique to obtain species specific voltammograms. Quite distinct records were obtained from the Takin (Budorcas taxicolor), while other interesting records were observed in samples from the European Bison (Bison bonasus bonasus) and the Red-eared Slider (Trachemys scripta elegans). To quantify metallothionein the catalytic peak Cat2 was used, well developed in the Domestic Fowl (Gallus gallus f. domestica) and showing a very low signal in the Red Deer (Cervus elaphus). The highest levels of metallothionein reaching over 20 µM were found in the Domestic Fowl. High levels of MT were also found in the Bearded Dragon (Pogona vitticeps) and the Grey Wolf (Canis lupus lupus). The lowest values of about 1-3 µM were determined in the Red-eared Slider, Takin and Red Deer. Employing a simple electrochemical detection it was possible to examine variation in blood metallothionein in different species of vertebrates.

  19. Climate-mediated shifts in Neandertal subsistence behaviors at Pech de l'Azé IV and Roc de Marsal (Dordogne Valley, France). (United States)

    Hodgkins, Jamie; Marean, Curtis W; Turq, Alain; Sandgathe, Dennis; McPherron, Shannon J P; Dibble, Harold


    Neandertals disappeared from Europe just after 40,000 years ago. Some hypotheses ascribe this to numerous population crashes associated with glacial cycles in the late Pleistocene. The goal of this paper is to test the hypothesis that glacial periods stressed Neandertal populations. If cold climates stressed Neandertals, their subsistence behaviors may have changed-requiring intensified use of prey through more extensive nutrient extraction from faunal carcasses. To test this, an analysis of Neandertal butchering was conducted on medium sized bovid/cervid remains composed of predominately red deer (Cervus elaphus), reindeer (Rangifer tarandus), and roe deer (Capreolus caprelous) deposited during global warm and cold phases from two French sites: Pech de l'Azé IV (Pech IV, Bordes' excavation) and Roc de Marsal (RDM). Analysis of surface modification on high survival long bones and proximal and middle phalanges demonstrates that skeletal elements excavated from the cold levels (RDM Level 4, Pech IV Level I2) at each cave have more cut marks and percussion marks than elements from the warm levels (RDM Level 9, Pech IV Level Y-Z) after controlling for fragment size. At both sites, epiphyseal fragments are rare, and although this pattern can result from carnivore consumption, carnivore tooth marks are almost nonexistent (support for the hypothesis that Neandertals were processing faunal remains more heavily during glacial periods, suggesting a response to increased nutritional stress during colder time periods. PMID:27343769

  20. Mapping brucellosis increases relative to elk density using hierarchical Bayesian models.

    Directory of Open Access Journals (Sweden)

    Paul C Cross

    Full Text Available The relationship between host density and parasite transmission is central to the effectiveness of many disease management strategies. Few studies, however, have empirically estimated this relationship particularly in large mammals. We applied hierarchical Bayesian methods to a 19-year dataset of over 6400 brucellosis tests of adult female elk (Cervus elaphus in northwestern Wyoming. Management captures that occurred from January to March were over two times more likely to be seropositive than hunted elk that were killed in September to December, while accounting for site and year effects. Areas with supplemental feeding grounds for elk had higher seroprevalence in 1991 than other regions, but by 2009 many areas distant from the feeding grounds were of comparable seroprevalence. The increases in brucellosis seroprevalence were correlated with elk densities at the elk management unit, or hunt area, scale (mean 2070 km(2; range = [95-10237]. The data, however, could not differentiate among linear and non-linear effects of host density. Therefore, control efforts that focus on reducing elk densities at a broad spatial scale were only weakly supported. Additional research on how a few, large groups within a region may be driving disease dynamics is needed for more targeted and effective management interventions. Brucellosis appears to be expanding its range into new regions and elk populations, which is likely to further complicate the United States brucellosis eradication program. This study is an example of how the dynamics of host populations can affect their ability to serve as disease reservoirs.

  1. Estimation of Correlation between the Number of Individuals and Biogenic Capacity of the Hunting Terrain 56, Forest District Lunca Timişului, for 13 Hunting Species in 2006-2010 Period

    Directory of Open Access Journals (Sweden)

    Dorel Dronca


    Full Text Available Integration of the Romania in the UE, is imposing a special attention to hunting animals populations. The aim of the present paper was to study the quantitative evolution of the hunting population for the 13th species, in the period 2006-2010, in the hunting terrain 56 Chevereş, from Forest Domain – Lunca Timişului, with a total surface of 9109ha. After the observations were performed, the present paper is stating that on this hunting ground had no good correlation between the number of individuals and the biogenic capacity of the hunting fond at the following species: Red Deer (Cervus elaphus L., Fallow Deer (Dama dama L, Roe Deer (Caproleus Caproleus L., Wild hog (Sus scrofa L., European hare (Lepus europaeus P., in turn at the rest of the studied species the correlation is good. For the species in regress the observations are recommending the following with attention of the natural selection and the improvement of the artificial selection.

  2. Seroprevalence of Toxoplasma gondii in wild boars, red deer and roe deer in Poland

    Directory of Open Access Journals (Sweden)

    Witkowski Lucjan


    Full Text Available Little is known about the prevalence of Toxoplasma gondii in wild life, particularly game animals in Poland. Meat juice collected during the 2009/2010 and 2010/2011 hunting seasons from 552 red deer (Cervus elaphus, 367 wild boars (Sus scrofa and 92 roe deer (Capreolus capreolus was tested for T. gondii antibodies using the multi-species ID Screen Toxoplasmosis Indirect kit (IDvet, Montpellier, France. Antibodies to T. gondii were detected in 24.1% of red deer (95% CI: 20.7%, 27.8%, 37.6% of wild boar (95% CI: 32.8%, 42.7% and 30.4% of roe deer (95% CI: 22.0%, 40.5%. To the authors’ best knowledge, this is the first epidemiological report of T. gondii prevalence in red deer, roe deer and wild boars in Poland. T. gondii is present in wildlife animal tissues and consumption of the game may be a potential source of infection for humans.

  3. Estimation of Correlation between the Number of Individuals and Biogenic Capacity of the Hunting Terrain 54 Padureni, Forest District Lunca Timişului, for 13 Hunting Species in 2007-2011 Period

    Directory of Open Access Journals (Sweden)

    Dorel Dronca


    Full Text Available Integration of the Romania in the EU is imposing a special attention to hunting animals populations. The aim of thepresent paper was to study the quantitative evolution of the hunting population for the 13th species, in the period2007-2011, in the hunting terrain 54 Padureni, from Forest Domain – Lunca Timişului, with a total surface of11,963ha. The paper shows that form the 13th species studied 5 were not identified on this hunting terrain Red Deer(Cervus elaphus L., Wildcat (Felis silvestres L, European Pine Marten (Martes martes L., Least Weasel (Mustelanivolis L. Muskrat (Ondatra zibethica L.. For the other species identified the individuals number evolutiondemonstrated that there is a god correlation between the number of individuals and it-s biogenic capacity. Also thepaper recommends a special attention to natural selection and the efficient use of artificial selection, especially forthe following 3 species: Roe Deer (Capreolus Capreolus L., Wild hog (Sus scrofa L. and Common Pheasant(Phasianus colchicus L..

  4. Serological survey of avian influenza virus infection in non-avian wildlife in Xinjiang, China. (United States)

    Wei, Yu-Rong; Yang, Xue-Yun; Li, Yuan-Guo; Wei, Jie; Ma, Wen-Ge; Ren, Zhi-Guang; Guo, Hui-Ling; Wang, Tie-Cheng; Mi, Xiao-Yun; Adili, Gulizhati; Miao, Shu-Kui; Shaha, Ayiqiaolifan; Gao, Yu-Wei; Huang, Jiong; Xia, Xian-Zhu


    We conducted a serological survey to detect antibodies against avian influenza virus (AIV) in Gazella subgutturosa, Canis lupus, Capreolus pygargus, Sus scrofa, Cervus elaphus, Capra ibex, Ovis ammon, Bos grunniens and Pseudois nayaur in Xinjiang, China. Two hundred forty-six sera collected from 2009 to 2013 were assayed for antibodies against H5, H7 and H9 AIVs using hemagglutination inhibition (HI) tests and a pan-influenza competitive ELISA. Across all tested wildlife species, 4.47 % harbored anti-AIV antibodies that were detected by the HI assay. The seroprevalence for each AIV subtype across all species evaluated was 0 % for H5 AIV, 0.81 % for H7 AIV, and 3.66 % for H9 AIV. H7-reactive antibodies were found in Canis lupus (9.09 %) and Ovis ammon (4.55 %). H9-reactive antibodies were found in Gazella subgutturosa (4.55 %), Canis lupus (27.27 %), Pseudois nayaur (23.08 %), and Ovis ammon (4.55 %). The pan-influenza competitive ELISA results closely corresponded to the cumulative prevalence of AIV exposure as measured by subtype-specific HI assays, suggesting that H7 and H9 AIV subtypes predominate in the wildlife species evaluated. These data provide evidence of prior infection with H7 and H9 AIVs in non-avian wildlife in Xinjiang, China. PMID:26733295

  5. Outbreak of Mycobacterium bovis infection in a wild animal park. (United States)

    Schmidbauer, S-M; Wohlsein, P; Kirpal, G; Beineke, A; Müller, G; Müller, H; Moser, I; Baumgartner, W


    An outbreak of tuberculosis due to Mycobacterium bovis occurred in a wild animal park. Three pot-bellied pigs (Sus scrofa vittatus), one red deer (Cervus elaphus), one buffalo (Bison bonasus) and two European lynxes (Lynx lynx) were affected and showed clinical signs including weight loss, enlarged lymph nodes and paralysis of the hindlimbs. Postmortem examinations revealed multifocal granulomatous lesions in various organs, including the lymph nodes, lungs, intestines, kidneys and the central nervous system. Acid-fast organisms were demonstrated in various organs histologically and bacteriologically. Spoligotyping of 17 isolates from various organs of the affected animals confirmed an infection by M bovis and revealed an identical pattern indicating a common origin. The spoligotype was different from the pattern of M bovis recorded in the cattle population in Germany between 2000 and 2006. Investigations of sentinel animals such as an aged silver fox (Vulpes vulpes), a badger (Meles meles), a ferret (Mustela putorius) and rodents, and tuberculin skin tests of the animal attendants and randomly collected faecal samples from the enclosures were all negative for M bovis. PMID:17766809

  6. Iberian red deer: paraphyletic nature at mtDNA but nuclear markers support its genetic identity. (United States)

    Carranza, Juan; Salinas, María; de Andrés, Damián; Pérez-González, Javier


    Red deer populations in the Iberian glacial refugium were the main source for postglacial recolonization and subspecific radiation in north-western Europe. However, the phylogenetic history of Iberian red deer (Cervus elaphus hispanicus) and its relationships with northern European populations remain uncertain. Here, we study DNA sequences at the mitochondrial control region along with STR markers for over 680 specimens from all the main red deer populations in Spain and other west European areas. Our results from mitochondrial and genomic DNA show contrasting patterns, likely related to the nature of these types of DNA markers and their specific processes of change over time. The results, taken together, bring support to two distinct, cryptic maternal lineages for Iberian red deer that predated the last glacial maximum and that have maintained geographically well differentiated until present. Haplotype relationships show that only one of them contributed to the northern postglacial recolonization. However, allele frequencies of nuclear markers evidenced one main differentiation between Iberian and northern European subspecies although also supported the structure of both matrilines within Iberia. Thus, our findings reveal a paraphyletic nature for Iberian red deer but also its genetic identity and differentiation with respect to northern subspecies. Finally, we suggest that maintaining the singularity of Iberian red deer requires preventing not only restocking practices with red deer specimens belonging to other European populations but also translocations between both Iberian lineages. PMID:26843924

  7. Wild ungulates as sentinel of BTV-8 infection in piedmont areas. (United States)

    Grego, E; Sossella, M; Bisanzio, D; Stella, M C; Giordana, G; Pignata, L; Tomassone, L


    Bluetongue caused by the genotype 8 virus (BTV-8) appeared for the first time in BTV free areas in northern Italy in 2008. The presence of domestic animals outbreaks, abundant wild ungulates populations, and ongoing regional BTV control plans, made this area interesting to evaluate the role of wild ruminants in BTV-8 epidemiology. We analyzed spleen samples from hunted red deer (Cervus elaphus), roe deer (Capreolus capreolus) and Alpine chamois (Rupicapra rupicapra) by quantitative RT-PCR. Samples were collected from 2008 to 2011 in two provinces of Piedmont region. BTV-8 was detected in all ungulate species, confirming their receptivity to the infection. However, the viral load in the positive specimens was low, and decreased from 2008 to 2011. These results, together with the extinction of the epidemic following a regional livestock vaccination campaign, lead to hypothesize that wild ungulates were an epiphenomenon and they had not an important role in the domestic transmission cycle of BTV-8 in this area. In spite of this, wild ruminants appear to be good sentinels of BTV circulation and their monitoring could be useful for surveillance in piedmont areas. PMID:25306211

  8. A simple solar radiation index for wildlife habitat studies (United States)

    Keating, Kim A.; Gogan, Peter J.; Vore, John N.; Irby, Lynn R.


    Solar radiation is a potentially important covariate in many wildlife habitat studies, but it is typically addressed only indirectly, using problematic surrogates like aspect or hillshade. We devised a simple solar radiation index (SRI) that combines readily available information about aspect, slope, and latitude. Our SRI is proportional to the amount of extraterrestrial solar radiation theoretically striking an arbitrarily oriented surface during the hour surrounding solar noon on the equinox. Because it derives from first geometric principles and is linearly distributed, SRI offers clear advantages over aspect-based surrogates. The SRI also is superior to hillshade, which we found to be sometimes imprecise and ill-behaved. To illustrate application of our SRI, we assessed niche separation among 3 ungulate species along a single environmental axis, solar radiation, on the northern Yellowstone winter range. We detected no difference between the niches occupied by bighorn sheep (Ovis canadensis) and elk (Cervus elaphus; P = 0.104), but found that mule deer (Odocoileus hemionus) tended to use areas receiving more solar radiation than either of the other species (P solar radiation component.

  9. Vaccination of elk (Cervus canadensis with Brucella abortus strain RB51 overexpressing superoxide dismutase and glycosyltransferase genes does not induce adequate protection against experimental Brucella abortus challenge

    Directory of Open Access Journals (Sweden)

    Pauline eNol


    Full Text Available In recent years, elk (Cervus canadensis have been implicated as the source of Brucella abortus infection for numerous cattle herds in the Greater Yellowstone Area. In the face of environmental and ecological changes on the landscape, the range of infected elk is expanding. Consequently, the development of effective disease management strategies for wild elk herds is of utmost importance, not only for the prevention of reintroduction of brucellosis to cattle, but also for the overall health of the Greater Yellowstone Area elk populations. In two studies, we evaluated the efficacy of B. abortus strain RB51 over-expressing superoxide dismutase and glycosytransferase for protecting elk from infection and disease caused by B. abortus after experimental infection with a virulent B. abortus strain. Our data indicate that the recombinant vaccine does not protect elk against brucellosis. Further work is needed for development of an effective brucellosis vaccine for use in elk

  10. Solar Radiation Determines Site Occupancy of Coexisting Tropical and Temperate Deer Species Introduced to New Zealand Forests.

    Directory of Open Access Journals (Sweden)

    Robert B Allen

    Full Text Available Assemblages of introduced taxa provide an opportunity to understand how abiotic and biotic factors shape habitat use by coexisting species. We tested hypotheses about habitat selection by two deer species recently introduced to New Zealand's temperate rainforests. We hypothesised that, due to different thermoregulatory abilities, rusa deer (Cervus timorensis; a tropical species would prefer warmer locations in winter than red deer (Cervus elaphus scoticus; a temperate species. Since adult male rusa deer are aggressive in winter (the rut, we also hypothesised that rusa deer and red deer would not use the same winter locations. Finally, we hypothesised that in summer both species would prefer locations with fertile soils that supported more plant species preferred as food. We used a 250 × 250 m grid of 25 remote cameras to collect images in a 100-ha montane study area over two winters and summers. Plant composition, solar radiation, and soil fertility were also determined for each camera location. Multiseason occupancy models revealed that direct solar radiation was the best predictor of occupancy and detection probabilities for rusa deer in winter. Multistate, multiseason occupancy models provided strong evidence that the detection probability of adult male rusa deer was greater in winter and when other rusa deer were present at a location. Red deer mostly vacated the study area in winter. For the one season that had sufficient camera images of both species (summer 2011 to allow two-species occupancy models to be fitted, the detection probability of rusa deer also increased with solar radiation. Detection probability also varied with plant composition for both deer species. We conclude that habitat use by coexisting tropical and temperate deer species in New Zealand likely depends on the interplay between the thermoregulatory and behavioural traits of the deer and the abiotic and biotic features of the habitat.

  11. Solar Radiation Determines Site Occupancy of Coexisting Tropical and Temperate Deer Species Introduced to New Zealand Forests. (United States)

    Allen, Robert B; Forsyth, David M; Allen, Roy K J; Affeld, Kathrin; MacKenzie, Darryl I


    Assemblages of introduced taxa provide an opportunity to understand how abiotic and biotic factors shape habitat use by coexisting species. We tested hypotheses about habitat selection by two deer species recently introduced to New Zealand's temperate rainforests. We hypothesised that, due to different thermoregulatory abilities, rusa deer (Cervus timorensis; a tropical species) would prefer warmer locations in winter than red deer (Cervus elaphus scoticus; a temperate species). Since adult male rusa deer are aggressive in winter (the rut), we also hypothesised that rusa deer and red deer would not use the same winter locations. Finally, we hypothesised that in summer both species would prefer locations with fertile soils that supported more plant species preferred as food. We used a 250 × 250 m grid of 25 remote cameras to collect images in a 100-ha montane study area over two winters and summers. Plant composition, solar radiation, and soil fertility were also determined for each camera location. Multiseason occupancy models revealed that direct solar radiation was the best predictor of occupancy and detection probabilities for rusa deer in winter. Multistate, multiseason occupancy models provided strong evidence that the detection probability of adult male rusa deer was greater in winter and when other rusa deer were present at a location. Red deer mostly vacated the study area in winter. For the one season that had sufficient camera images of both species (summer 2011) to allow two-species occupancy models to be fitted, the detection probability of rusa deer also increased with solar radiation. Detection probability also varied with plant composition for both deer species. We conclude that habitat use by coexisting tropical and temperate deer species in New Zealand likely depends on the interplay between the thermoregulatory and behavioural traits of the deer and the abiotic and biotic features of the habitat. PMID:26061426

  12. A relapsing fever group Borrelia sp. similar to Borrelia lonestari found among wild sika deer (Cervus nippon yesoensis) and Haemaphysalis spp. ticks in Hokkaido, Japan. (United States)

    Lee, Kyunglee; Takano, Ai; Taylor, Kyle; Sashika, Mariko; Shimozuru, Michito; Konnai, Satoru; Kawabata, Hiroki; Tsubota, Toshio


    A relapsing fever Borrelia sp. similar to Borrelia lonestari (herein referred to as B. lonestari-like) was detected from wild sika deer (Cervus nippon yesoensis) and Haemaphysalis ticks in the eastern part of Hokkaido, Japan. The total prevalence of this Borrelia sp. in tested deer blood samples was 10.6% using conventional PCR and real-time PCR. The prevalence was significantly higher in deer fawns compared to adults (21.9% and 9.4%, respectively). Additionally, there was significant regional difference between our two sampling areas, Shiretoko and Shibetsu with 17% and 2.8% prevalence, respectively. Regional differences were also found in tick species collected from field and on deer. In the Shiretoko region, Haemaphysalis spp. were more abundant than Ixodes spp., while in Shibetsu, Ixodes spp. were more abundant. Using real-time PCR analysis, B. lonestari-like was detected from 2 out of 290 adult Haemaphysalis spp. ticks and 4 out of 76 pools of nymphs. This is the first report of a B. lonestari-like organism in Haemaphysalis spp. ticks, and the first phylogenetic analysis of this B. lonestari-like organism in Asia. Based on our results, Haemaphysalis spp. are the most likely candidates to act as a vector for B. lonestari-like; furthermore, regional variation of B. lonestari-like prevalence in sika deer may be dependent on the population distribution of these ticks. PMID:25108784

  13. A Molecular and Serological Survey of Rickettsiales Bacteria in Wild Sika Deer (Cervus nippon nippon) in Shizuoka Prefecture, Japan: High Prevalence of Anaplasma Species. (United States)

    Wu, Dongxing; Wuritu; Yoshikawa, Yuko; Gaowa; Kawamori, Fumihiko; Ikegaya, Asaka; Ohtake, Masayoshi; Ohashi, Masataka; Shimada, Masahiko; Takada, Ayumi; Iwai, Katsuki; Ohashi, Norio


    We surveyed Rickettsiales bacteria, including Rickettsia, Ehrlichia, Anaplasma, and Neoehrlichia, in wild sika deer (Cervus nippon nippon) from Shizuoka prefecture, Japan. In spleen samples from 187 deer, Anaplasma phagocytophilum (deer type), A. bovis, and A. centrale were successfully detected by PCR assay targeting to 16S rDNA or p44/msp2, and their positive rates were 96.3% (180/187), 53.5% (100/187), and 78.1% (146/187), respectively. Additionally, 2 or 3 Anaplasma species could be detected from a single deer in 165 spleen samples (88.2%), indicating dual or triple infection. In contrast, A. phagocytophilum (human type) 16S rDNA, Rickettsia gltA, Ehrlichia p28/omp-1, and Neoehrlichia 16S rDNA could not be amplified. The serological test of 105 deer serum samples by immunofluorescence assay showed that the detection of antibodies against antigens of A. phagocytophilum HZ (US-human isolate) and Rickettsia japonica YH were 29.5% (31/105) and 75.2% (79/105), respectively. These findings suggest that A. phagocytophilum (deer type), A. centrale, and A. bovis are highly dominant and prevalent in wild sika deer from Shizuoka, a central region of Japan, and that the antibodies against some Rickettsiales bacteria have also been retained in deer blood. PMID:25971318

  14. Mismatch repair mRNA and protein expression in intestinal adenocarcinoma in sika deer (Cervus nippon) resembling heritable non-polyposis colorectal cancer in man. (United States)

    Jahns, H; Browne, J A


    Intestinal adenocarcinomas seen in an inbred herd of farmed sika deer (Cervus nippon) morphologically resembled human hereditary non-polyposis colorectal cancer (HNPCC). Features common to both included multiple de novo sites of tumourigenesis in the proximal colon, sessile and non-polyposis mucosal changes, the frequent finding of mucinous type adenocarcinoma, lymphocyte infiltration into the neoplastic tubules and Crohn's-like lymphoid follicles at the deep margin of the tumour. HNPCC is defined by a germline mutation of mismatch repair (MMR) genes resulting in their inactivation and loss of expression. To test the hypothesis that similar MMR gene inactivation occurs in the deer tumours, the expression of the four most important MMR genes, MSH2, MLH1, MSH6 and PMS2, was examined at the mRNA level by reverse transcriptase polymerase chain reaction (n = 12) and at the protein level by immunohistochemistry (n = 40) in tumour and control tissues. All four genes were expressed equally in normal and neoplastic tissues, so MMR gene inactivation could not be implicated in the carcinogenesis of this tumour in sika deer. PMID:25678423

  15. Effect of the Velvet Antler of Formosan Sambar Deer (Cervus unicolor swinhoei on the Prevention of an Allergic Airway Response in Mice

    Directory of Open Access Journals (Sweden)

    Ching-Yun Kuo


    Full Text Available Two mouse models were used to assay the antiallergic effects of the velvet antler (VA of Formosan sambar deer (Cervus unicolor swinhoei in this study. The results using the ovalbumin- (OVA- sensitized mouse model showed that the levels of total IgE and OVA-specific IgE were reduced after VA powder was administrated for 4 weeks. In addition, the ex vivo results indicated that the secretion of T helper cell 1 (Th1, regulatory T (Treg, and Th17 cytokines by splenocytes was significantly increased (P<0.05 when VA powder was administered to the mice. Furthermore, OVA-allergic asthma mice that have been orally administrated with VA powder showed a strong inhibition of Th2 cytokine and proinflammatory cytokine production in bronchoalveolar fluid compared to control mice. An increase in the regulatory T-cell population of splenocytes in the allergic asthma mice after oral administration of VA was also observed. All the features of the asthmatic phenotype, including airway inflammation and the development of airway hyperresponsiveness, were reduced by treatment with VA. These findings support the hypothesis that oral feeding of VA may be an effective way of alleviating asthmatic symptoms in humans.

  16. Population genetic structure of wild and farmed rusa deer (Cervus timorensis russa) in New-Caledonia inferred from polymorphic microsatellite loci. (United States)

    de Garine-Wichatitsky, M; de Meeûs, T; Chevillon, C; Berthier, D; Barré, N; Thévenon, S; Maillard, J-C


    Historical records indicate that 12 rusa deer (Cervus timorensis russa) were introduced in New-Caledonia during the 1870s. We used eight polymorphic microsatellite DNA loci to assess the genetic differentiation and diversity of farmed and wild deer populations. Past genetic bottlenecks were detected in both sub-populations, although higher genetic diversity was maintained in farmed populations, probably due to the regular introduction of reproducers from wild populations and from other farms. The genetic structure of farmed and wild populations differed significantly. There was a significant isolation by distance for wild populations, whereas farmed populations were significantly differentiated between farms independently from their geographical proximity. Wild rusa deer consisted of small populations (with effective population sizes ranging between 7 and 19 individuals depending on the methods used), with a low parent-offspring dispersion range (0.20-2.02 km). Genetic tools and direct observations provided congruent estimates of dispersion and population sizes. We discuss the relevance of our results for management purposes. PMID:19680748

  17. A Possible Role for Rusa Deer (Cervus timorensis russa and Wild Pigs in Spread of Trypanosoma evansi from Indonesia to Papua New Guinea

    Directory of Open Access Journals (Sweden)

    SA Reid


    Full Text Available Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were monitored each second day for 120 days. Trypanosomes were observed in haematocrit tubes at the plasma-buffy coat interface of jugular blood of deer and pigs on 86% and 37% of sampling occasions respectively. Parasitaemia was at a high level in deer for 35% of the time but for only 11.5% of the time in pigs. Results indicate that both Rusa deer and pigs have a high tolerance for infection with T. evansi. The deer suffered mild anaemia evidenced by a 25% reduction in packed cell volume (PCV 14 days after infection which coincided with the initial peak in parasitaemia. However, PCV had returned to pre infection values by the end of the experiment. The pigs showed no change in PCV. There were no visual indications of disease in either species and appetite was not noticeably affected. It was concluded that both Rusa deer and pigs were capable reservoir hosts for T. evansi but that Rusa deer, with their more persistent higher levels of parasitaemia, have more potential to spread T. evansi into Papua New Guinea from West Irian than pigs.

  18. A possible role for rusa deer (Cervus timorensis russa) and wild pigs in spread of Trypanosoma evansi from Indonesia to Papua New Guinea. (United States)

    Reid, S; Husein, A; Hutchinson, G; Copeman, D


    Movement of transmigrants and livestock from western Indonesia to southeastern areas of Irian Jaya near the border with Papua New Guinea may pose a risk of introducing Trypanosoma evansi into Papua New Guinea via feral Rusa deer (Cervus timorensis russa) and wild pigs which inhabit these areas in large numbers. Pilot experimental studies were conducted to observe infection in pigs and Rusa deer with a strain of T. evansi isolated in Indonesia. Parasitaemia and signs of clinical disease were monitored each second day for 120 days. Trypanosomes were observed in haematocrit tubes at the plasma-buffy coat interface of jugular blood of deer and pigs on 86% and 37% of sampling occasions respectively. Parasitaemia was at a high level in deer for 35% of the time but for only 11.5% of the time in pigs. Results indicate that both Rusa deer and pigs have a high tolerance for infection with T. evansi. The deer suffered mild anaemia evidenced by a 25% reduction in packed cell volume (PCV) 14 days after infection which coincided with the initial peak in parasitaemia. However, PCV had returned to pre infection values by the end of the experiment. The pigs showed no change in PCV. There were no visual indications of disease in either species and appetite was not noticeably affected. It was concluded that both Rusa deer and pigs were capable reservoir hosts for T. evansi but that Rusa deer, with their more persistent higher levels of parasitaemia, have more potential to spread T. evansi into Papua New Guinea from West Irian than pigs. PMID:10224527

  19. Effects of supplemental feeding and aggregation on fecal glucocorticoid metabolite concentrations in elk (United States)

    Forristal, Victoria E.; Creel, Scott; Taper, Mark L.; Scurlock, Brandon M.; Cross, Paul C.


    Habitat modifications and supplemental feeding artificially aggregate some wildlife populations, with potential impacts upon contact and parasite transmission rates. Less well recognized, however, is how increased aggregation may affect wildlife physiology. Crowding has been shown to induce stress responses, and increased glucocorticoid (GC) concentrations can reduce immune function and increase disease susceptibility. We investigated the effects of supplemental feeding and the aggregation that it induces on behavior and fecal glucocorticoid metabolite concentrations (fGCM) in elk (Cervus elaphus) using observational and experimental approaches. We first compared fGCM levels of elk on supplemental feedgrounds to neighboring elk populations wintering in native habitats using data from 2003 to 2008. We then experimentally manipulated the distribution of supplemental food on feedgrounds to investigate whether more widely distributed food would result in lower rates of aggression and stress hormone levels. Contrary to some expectations that fed elk may be less stressed than unfed elk during the winter, we found that elk on feedgrounds had fecal GC levels at least 31% higher than non-feedground populations. Within feedgrounds, fGCM levels were strongly correlated with local measures of elk density (r2 = 0.81). Dispersing feed more broadly, however, did not have a detectable effect on fGCM levels or aggression rates. Our results suggest that increases in aggregation associated with winter feedgrounds affects elk physiology, and the resulting increases in fGCM levels are not likely to be mitigated by management efforts that distribute the feed more widely. Additional research is needed to assess whether these increases in fGCMs directly alter parasite transmission and disease dynamics.

  20. A large survey of Croatian wild mammals for Giardia duodenalis reveals a low prevalence and limited zoonotic potential. (United States)

    Beck, Relja; Sprong, Hein; Lucinger, Snjezana; Pozio, Edoardo; Cacciò, Simone M


    Wild mammals are considered an important source of potentially zoonotic Giardia duodenalis parasites, yet surprisingly little information is available on the actual prevalence and the genetic identity of the species they harbor. A large survey was conducted in Croatia by collecting 832 fecal samples from red deer (Cervus elaphus, n = 374), roe deer (Capreolus capreolus, n = 21), wild boars (Sus scrofa, n = 144), foxes (Vulpes vulpes, n = 66), bears (Ursus arctos, n = 19), wolves (Canis lupus, n = 127), jackals (Canis aureus, n = 8), and hares (Lepus europeus, n = 73). Fecal samples were tested for the presence of Giardia cysts using fluorescent microscopy. The observed prevalence ranged from low (1% in red deer, 1.7% in wild boars, and 4.5% in foxes) to moderate (10% in wolves and 12.5% in jackals) to high (24% in roe deer). No cysts were observed in bears and hares. Polymerase chain reaction was performed on microscopically positive samples to amplify fragments of the small subunit ribosomal gene, the ribosomal 5.8S gene and the two flanking internal transcribed sequences, and the triose phosphate isomerase gene. Sequence analysis showed a predominance of G. duodenalis assemblage A in both ruminants (genotypes A1 and A3) and carnivores (genotype A1). G. duodenalis assemblages B, C, and D, as well as Giardia microti, were also detected in this study. This is the first molecular description of the parasite from the red deer, the wolf, and the jackal. The data point to a minor role of wild mammals as reservoirs of zoonotic assemblages of G. duodenalis, albeit cycling between sylvatic and domestic animals is possible. PMID:21142957

  1. Seeded Amplification of Chronic Wasting Disease Prions in Nasal Brushings and Recto-anal Mucosa-Associated Lymphoid Tissues from Elk by Real-Time Quaking-Induced Conversion. (United States)

    Haley, Nicholas J; Siepker, Chris; Hoon-Hanks, Laura L; Mitchell, Gordon; Walter, W David; Manca, Matteo; Monello, Ryan J; Powers, Jenny G; Wild, Margaret A; Hoover, Edward A; Caughey, Byron; Richt, Jürgen A


    Chronic wasting disease (CWD), a transmissible spongiform encephalopathy of cervids, was first documented nearly 50 years ago in Colorado and Wyoming and has since been detected across North America and the Republic of Korea. The expansion of this disease makes the development of sensitive diagnostic assays and antemortem sampling techniques crucial for the mitigation of its spread; this is especially true in cases of relocation/reintroduction or prevalence studies of large or protected herds, where depopulation may be contraindicated. This study evaluated the sensitivity of the real-time quaking-induced conversion (RT-QuIC) assay of recto-anal mucosa-associated lymphoid tissue (RAMALT) biopsy specimens and nasal brushings collected antemortem. These findings were compared to results of immunohistochemistry (IHC) analysis of ante- and postmortem samples. RAMALT samples were collected from populations of farmed and free-ranging Rocky Mountain elk (Cervus elaphus nelsoni;n= 323), and nasal brush samples were collected from a subpopulation of these animals (n= 205). We hypothesized that the sensitivity of RT-QuIC would be comparable to that of IHC analysis of RAMALT and would correspond to that of IHC analysis of postmortem tissues. We found RAMALT sensitivity (77.3%) to be highly correlative between RT-QuIC and IHC analysis. Sensitivity was lower when testing nasal brushings (34%), though both RAMALT and nasal brush test sensitivities were dependent on both thePRNPgenotype and disease progression determined by the obex score. These data suggest that RT-QuIC, like IHC analysis, is a relatively sensitive assay for detection of CWD prions in RAMALT biopsy specimens and, with further investigation, has potential for large-scale and rapid automated testing of antemortem samples for CWD. PMID:26888899

  2. An increase in herbivory of cottonwood in yellowstone national park (United States)

    Keigley, R.B.


    This study examined an effect of elk (Cervus elaphus nelsoni) on narrowleaf cottonwood (Populus angustifolia) in northern Yellowstone National Park, where stands consist of old trees and younger, densely-branched bushes. The elk herd increased from a census of 3,172 in 1968 to a census of 18,913 in 1988. The purposes of this study were to: 1) document the height-growth of cottonwood bushes, 2) determine if the height of browsing corresponded with snow depth, and 3) determine if there has been a recent increase in cottonwood herbivory. In 5 stands of different age (ranging ca. 9-45 y old), I measured the height of live previous-year-growth and the height of the oldest stems killed by browsing. The tallest previous-year-growth was 80 cm; all stems taller than 29 cm had been browsed. Stems were killed by browsing closer to the ground in younger stands (respectively, 87, 62, 28, 14, and 9 cm; P herbivory since respective stand creation. The large variances in the height of browse-killed stems in older stands (745, 399, and 291 cm2) were likely caused by an initial period of light-to-moderate herbivory followed by an increase in herbivory that killed the stem tips at the heights existing at the time. The bush growth-form apparently results from an increase in herbivory that occurred between 1968 and 1977, a period in which the elk winter census increased from 3,172 to 8,981. The weight of evidence suggests that EuroAmerican influences have caused the northern elk herd to increase in number since the establishment of the park. If herbivory does not decrease, cottonwood may be eliminated from Yellowstone's northern range.

  3. The West Central Alberta Woodland Caribou Landscape Plan: Using a Modeling Approach to Develop Alternative Scenarios

    Directory of Open Access Journals (Sweden)

    Anne Hubbs


    Full Text Available Woodland caribou (Rangifer tarandus are classified as threatened in Alberta. In support of Canada's Species at Risk Act, a Recovery Plan for Woodland Caribou in Alberta was completed in 2004 which required local implementation plans to be completed within 5 areas of the province. The West Central Alberta Caribou Landscape Plan (WCCLP is the first of these to be initiated and it addresses the recovery strategies for 4 herds. Two aspatial computer models built on the STELLA© modelling platform (ISee Systems, 2007 were used to assist the planning team in evaluating cumulative effects and alternative scenarios for caribou conservation. The ALCES© (Forem Technologies 2008 modelling tool was used to forecast potential changes in the west central Alberta landscape over time. Yearly landscape condition outputs from ALCES© were then exported into a caribou-specific population model, REMUS© (Weclaw, 2004, that was used to project potential population responses by woodland caribou, other primary prey species [moose (Alces alces, elk (Cervus elaphus and deer (Odocoileus sp.] and wolves (Canis lupus (Weclaw & Hudson, 2004. Simulated habitat management strategies that resulted in the highest likelihood of caribou recovery included the maintenance of a high proportion of old forest, the aggregation of industrial footprints and the reclamation of historic seismic lines (although the latter took decades to provide real dividends. Sharing of industrial roads, protection of fragments of old-growth, and expanding an already aggressive fire control strategy in Alberta had little additional effect on caribou recovery. Simulated population management strategies that were successful all involved decades of intensive wolf control, either directly or indirectly through intensive primary prey control (with the exception of woodland caribou until old-growth forests recovered to densities that provided caribou habitat and decreased alternate prey of wolves. Although

  4. Animal migration amid shifting patterns of phenology and predation: Lessons from a Yellowstone elk herd (United States)

    Middleton, Arthur D.; Kauffman, Matthew J.; McWhirter, Douglas E.; Cook, John G.; Cook, Rachel C.; Nelson, Abigail A.; Jimenez, Michael D.; Klaver, Robert W.


    Migration is a striking behavioral strategy by which many animals enhance resource acquisition while reducing predation risk. Historically, the demographic benefits of such movements made migration common, but in many taxa the phenomenon is considered globally threatened. Here we describe a long-term decline in the productivity of elk (Cervus elaphus) that migrate through intact wilderness areas to protected summer ranges inside Yellowstone National Park, USA. We attribute this decline to a long-term reduction in the demographic benefits that ungulates typically gain from migration. Among migratory elk, we observed a 21-year, 70% reduction in recruitment and a 4-year, 19% depression in their pregnancy rate largely caused by infrequent reproduction of females that were young or lactating. In contrast, among resident elk, we have recently observed increasing recruitment and a high rate of pregnancy. Landscape-level changes in habitat quality and predation appear to be responsible for the declining productivity of Yellowstone migrants. From 1989 to 2009, migratory elk experienced an increasing rate and shorter duration of green-up coincident with warmer spring–summer temperatures and reduced spring precipitation, also consistent with observations of an unusually severe drought in the region. Migrants are also now exposed to four times as many grizzly bears (Ursus arctos) and wolves (Canis lupus) as resident elk. Both of these restored predators consume migratory elk calves at high rates in the Yellowstone wilderness but are maintained at low densities via lethal management and human disturbance in the year-round habitats of resident elk. Our findings suggest that large-carnivore recovery and drought, operating simultaneously along an elevation gradient, have disproportionately influenced the demography of migratory elk. Many migratory animals travel large geographic distances between their seasonal ranges. Changes in land use and climate that disparately influence

  5. Are wolves saving Yellowstone's aspen? A landscape-level test of a behaviorally mediated trophic cascade. (United States)

    Kauffman, Matthew J; Brodie, Jedediah F; Jules, Erik S


    Behaviorally mediated trophic cascades (BMTCs) occur when the fear of predation among herbivores enhances plant productivity. Based primarily on systems involving small-bodied predators, BMTCs have been proposed as both strong and ubiquitous in natural ecosystems. Recently, however, synthetic work has suggested that the existence of BMTCs may be mediated by predator hunting mode, whereby passive (sit-and-wait) predators have much stronger effects than active (coursing) predators. One BMTC that has been proposed for a wide-ranging active predator system involves the reintroduction of wolves (Canis lupus) to Yellowstone National Park, USA, which is thought to be leading to a recovery of trembling aspen (Populus tremuloides) by causing elk (Cervus elaphus) to avoid foraging in risky areas. Although this BMTC has been generally accepted and highly popularized, it has never been adequately tested. We assessed whether wolves influence aspen by obtaining detailed demographic data on aspen Stands using tree rings and by monitoring browsing levels in experimental elk exclosures arrayed across a gradient of predation risk for three years. Our study demonstrates that the historical failure of aspen to regenerate varied widely among stands (last recruitment year ranged from 1892 to 1956), and our data do not indicate an abrupt cessation of recruitment. This pattern of recruitment failure appears more consistent with a gradual increase in elk numbers rather than a rapid behavioral shift in elk foraging following wolf extirpation. In addition, our estimates of relative survivorship of young browsable aspen indicate that aspen are not currently recovering in Yellowstone, even in the presence of a large wolf population. Finally, in an experimental test of the BMTC hypothesis we found that the impacts of elk browsing on aspen demography are not diminished in sites where elk are at higher risk of predation by wolves. These findings suggest the need to further evaluate how trophic

  6. Linking habitat selection to fitness-related traits in herbivores: the role of the energy landscape. (United States)

    Long, Ryan A; Bowyer, R T; Porter, Warren P; Mathewson, Paul; Monteith, Kevin L; Findholt, Scott L; Dick, Brian L; Kie, John G


    Animals may partially overcome environmental constraints on fitness by behaviorally adjusting their exposure to costs and supplies of energy. Few studies, however, have linked spatiotemporal variation in the energy landscape to behaviorally mediated measures of performance that ostensibly influence individual fitness. We hypothesized that strength of selection by North American elk (Cervus elaphus) for areas that reduced costs of thermoregulation and activity, and increased access to high-quality forage, would influence four energetically mediated traits related to fitness: birth mass of young, nutritional condition of adult females at the onset of winter, change in nutritional condition of females between spring and winter, and neonatal survival. We used a biophysical model to map spatiotemporally explicit costs of thermoregulation and activity experienced by elk in a heterogeneous landscape. We then combined model predictions with data on forage characteristics, animal locations, nutritional condition, and mass and survival of young to evaluate behaviorally mediated effects of the energy landscape on fitness-related traits. During spring, when high-quality forage was abundant, female elk that consistently selected low-cost areas before parturition gave birth to larger young than less-selective individuals, and birth mass had a strong, positive influence on probability of survival. As forage quality declined during autumn, however, lactating females that consistently selected the highest quality forage available accrued more fat and entered winter in better condition than less-selective individuals. Results of our study highlight the importance of understanding the dynamic nature of energy landscapes experienced by free-ranging animals. PMID:27003702

  7. Seasonal foraging ecology of non-migratory cougars in a system with migrating prey.

    Directory of Open Access Journals (Sweden)

    L Mark Elbroch

    Full Text Available We tested for seasonal differences in cougar (Puma concolor foraging behaviors in the Southern Yellowstone Ecosystem, a multi-prey system in which ungulate prey migrate, and cougars do not. We recorded 411 winter prey and 239 summer prey killed by 28 female and 10 male cougars, and an additional 37 prey items by unmarked cougars. Deer composed 42.4% of summer cougar diets but only 7.2% of winter diets. Males and females, however, selected different proportions of different prey; male cougars selected more elk (Cervus elaphus and moose (Alces alces than females, while females killed greater proportions of bighorn sheep (Ovis canadensis, pronghorn (Antilocapra americana, mule deer (Odocoileus hemionus and small prey than males. Kill rates did not vary by season or between males and females. In winter, cougars were more likely to kill prey on the landscape as: 1 elevation decreased, 2 distance to edge habitat decreased, 3 distance to large bodies of water decreased, and 4 steepness increased, whereas in summer, cougars were more likely to kill in areas as: 1 elevation decreased, 2 distance to edge habitat decreased, and 3 distance from large bodies of water increased. Our work highlighted that seasonal prey selection exhibited by stationary carnivores in systems with migratory prey is not only driven by changing prey vulnerability, but also by changing prey abundances. Elk and deer migrations may also be sustaining stationary cougar populations and creating apparent competition scenarios that result in higher predation rates on migratory bighorn sheep in winter and pronghorn in summer. Nevertheless, cougar predation on rare ungulates also appeared to be influenced by individual prey selection.

  8. Tall Grass Invasion After Grassland Abandonment Influences the Availability of Palatable Plants for Wild Herbivores: Insight into the Conservation of the Apennine Chamois Rupicapra pyrenaica ornata (United States)

    Corazza, Marcello; Tardella, Federico Maria; Ferrari, Carlo; Catorci, Andrea


    Invasion of the tall grass Brachypodium genuense was observed in an area of the central Apennines (Italy) where the population size of Apennine chamois ( Rupicapra pyrenaica ornata) was in strong decline. Since this dominant tall grass threatens biodiversity and forage quality, our hypothesis was that B. genuense abundance influenced that of palatable species for the chamois, depending on their functional traits and distribution patterns. Our sampling design used plots of 10 × 10 m and 1 × 1 m to investigate the plant community level and fine-scale interactions. We analyzed data using correlation, generalized linear models, and redundancy analyses. We found that B. genuense can reach high abundance values on the deepest soils. Its high cover value influences plant community composition by competitive exclusion of subordinate species and suppression of functional features because of temporal or spatial niche overlap. This leads to low cover of palatable species at a fine scale, and to poor pasture quality for chamois at a wider scale. Therefore, we postulated that B. genuense invasion, enhanced by long-term grazing cessation, may reduce the availability of palatable plants for Apennine chamois, especially below the potential timberline (1900-2000 m a.s.l.). The high abundance of B. genuense may amplify the effect of other negative factors, such as competition with red deer ( Cervus elaphus) and climate change, in restricting the suitable habitat of the Apennine chamois to the higher sectors of the central Apennines. Thus, we suggested that B. genuense spread should be monitored carefully and plans to control its invasion should be implemented.

  9. Are wolves saving Yellowstone's aspen? A landscape-level test of a behaviorally mediated trophic cascade (United States)

    Kauffman, Matthew J.; Brodie, Jedediah F.; Jules, Erik S.


    Behaviorally mediated trophic cascades (BMTCs) occur when the fear of predation among herbivores enhances plant productivity. Based primarily on systems involving small-bodied predators, BMTCs have been proposed as both strong and ubiquitous in natural ecosystems. Recently, however, synthetic work has suggested that the existence of BMTCs may be mediated by predator hunting mode, whereby passive (sit-and-wait) predators have much stronger effects than active (coursing) predators. One BMTC that has been proposed for a wide-ranging active predator system involves the reintroduction of wolves (Canis lupus) to Yellowstone National Park, USA, which is thought to be leading to a recovery of trembling aspen (Populus tremuloides) by causing elk (Cervus elaphus) to avoid foraging in risky areas. Although this BMTC has been generally accepted and highly popularized, it has never been adequately tested. We assessed whether wolves influence aspen by obtaining detailed demographic data on aspen stands using tree rings and by monitoring browsing levels in experimental elk exclosures arrayed across a gradient of predation risk for three years. Our study demonstrates that the historical failure of aspen to regenerate varied widely among stands (last recruitment year ranged from 1892 to 1956), and our data do not indicate an abrupt cessation of recruitment. This pattern of recruitment failure appears more consistent with a gradual increase in elk numbers rather than a rapid behavioral shift in elk foraging following wolf extirpation. In addition, our estimates of relative survivorship of young browsable aspen indicate that aspen are not currently recovering in Yellowstone, even in the presence of a large wolf population. Finally, in an experimental test of the BMTC hypothesis we found that the impacts of elk browsing on aspen demography are not diminished in sites where elk are at higher risk of predation by wolves. These findings suggest the need to further evaluate how trophic

  10. Using NDVI and EVI to Map Spatiotemporal Variation in the Biomass and Quality of Forage for Migratory Elk in the Greater Yellowstone Ecosystem

    Directory of Open Access Journals (Sweden)

    Erica L. Garroutte


    Full Text Available The Normalized Difference Vegetation Index (NDVI and the Enhanced Vegetation Index (EVI have gained considerable attention in ecological research and management as proxies for landscape-scale vegetation quantity and quality. In the Greater Yellowstone Ecosystem (GYE, these indices are especially important for mapping spatiotemporal variation in the forage available to migratory elk (Cervus elaphus. Here, we examined how the accuracy of using MODIS-derived NDVI and EVI as proxies for forage biomass and quality differed across elevation-related phenology and land use gradients, determined if polynomial NDVI/EVI, site, and season effects improved these models, and then mapped spatiotemporal variation in the abundance of high quality forage available to elk across the Upper Yellowstone River Basin (UYRB of the GYE. Models with a polynomial NDVI effect explained 19%–55% more variation in biomass than the linear NDVI and EVI models. Models with linear season effect explained 14%–20% more variation in chlorophyll, 37%–69% more variation in crude protein, and 26%–50% more variation in in vitro dry matter digestibility (IVDMD than the linear NDVI and EVI models. Linear NDVI models explained more variation in biomass and quality across the UYRB than the linear EVI models. The accuracy of these models was lowest in grasslands with late onset of growth, in irrigated agriculture, and after the peak in biomass. Forage biomass and quality varied across the elevation-related phenology and land use gradients in the UYRB throughout the season. At their seasonal peak, the abundance of high quality forage for elk was 50% greater in grasslands with late onset of growth and 200% greater in irrigated agriculture than in all other grasslands, suggesting that these grasslands play an especially important role in the movement and fitness of migratory elk. These results provide novel information on the utility of NDVI and EVI for mapping spatiotemporal patterns of

  11. Oral administration of heat-inactivated Mycobacterium bovis reduces the response of farmed red deer to avian and bovine tuberculin. (United States)

    López, Vladimir; González-Barrio, David; Lima-Barbero, José Francisco; Ortiz, José Antonio; Domínguez, Lucas; Juste, Ramón; Garrido, Joseba M; Sevilla, Iker A; Alberdi, Pilar; de la Fuente, José; Gortázar, Christian


    Orally delivered mycobacterial antigens may not sensitize the immunized animals causing a positive tuberculin skin test response. As the first step to address this critical issue, we characterized the response of farmed red deer (Cervus elaphus) to orally delivered heat-inactivated Mycobacterium bovis. Thirty-two adult red deer hinds from a farm known to be free of tuberculosis (TB) were randomly assigned to two different treatment groups, immunized (n=24) and control (n=8). Immunized hinds were dosed orally with 2ml of PBS containing 6×10(6) heat-inactivated M. bovis. The mean skin test response of immunized deer to both avian purified protein derivative (aPPD) and bovine PPD (bPPD) was consistently lower in immunized than in control hinds. One year after immunization, immunized hinds had a significant reduction in the skin test response to aPPD and in the ELISA antibody levels against both aPPD and bPPD (24-36% reduction; Ptest response to phytohaemagglutinin, or in the ELISA antibody levels against the M. bovis specific antigen MPB70. The mRNA levels for C3, IFN-γ and IL-1β and serum protein levels for IFN-γ and IL-1β did not vary between immunized and control deer. However, serum C3 protein levels were significantly higher (P=0.001) in immunized than in control deer six months after immunization. These results confirm that oral heat-inactivated M. bovis does not sensitize farmed red deer and therefore does not cause false-positive responses in the tuberculin skin test. The absence of sensitization in orally immunized deer opens the possibility of testing the vaccine in deer and possibly other ruminants without the risk of causing false-positive reactions in TB-tests. This study also provided the first evidence that orally-delivered inactivated mycobacterial antigens elicit some kind of immune response in a ruminant. PMID:27032499

  12. Sex-biased differences in the effects of host individual, host population and environmental traits driving tick parasitism in red deer

    Directory of Open Access Journals (Sweden)

    Francisco eRuiz-Fons


    Full Text Available The interactions between host individual, host population, and environmental factors modulate parasite abundance in a given host population. Since adult exophilic ticks are highly aggregated in red deer (Cervus elaphus and this ungulate exhibits significant sexual size dimorphism, life history traits and segregation, we hypothesized that tick parasitism on males and hinds would be differentially influenced by each of these factors. To test the hypothesis, ticks from 306 red deer − 182 males and 124 females − were collected during 7 years in a red deer population in south-central Spain. By using generalized linear models, with a negative binomial error distribution and a logarithmic link function, we modeled tick abundance on deer with 20 potential predictors. Three models were developed: one for red deer males, another for hinds, and one combining data for males and females and including "sex" as factor. Our rationale was that if tick burdens on males and hinds relate to the explanatory factors in a differential way, it is not possible to precisely and accurately predict the tick burden on one sex using the model fitted on the other sex, or with the model that combines data from both sexes. Our results showed that deer males were the primary target for ticks, the weight of each factor differed between sexes, and each sex specific model was not able to accurately predict burdens on the animals of the other sex. That is, results support for sex-biased differences. The higher weight of host individual and population factors in the model for males show that intrinsic deer factors more strongly explain tick burden than environmental host-seeking tick abundance. In contrast, environmental variables predominated in the models explaining tick burdens in hinds.

  13. Seroprevalences of antibodies to Neospora caninum and Toxoplasma gondii in zoo animals. (United States)

    Sedlák, K; Bártová, E


    Neospora caninum is an apicomplexan parasite that causes neuromuscular disease in dogs and abortions in cattle. Little is known about the prevalence of antibodies to this parasite in zoo animals. Sera from 556 animals, from 13 Czech and Slovak zoos were tested for antibodies to N. caninum and Toxoplasma gondii by indirect fluorescent antibody test. Antibodies to N. caninum were found in 31 of 556 zoo animals (5.6%), representing 18 of 114 species tested: Eurasian wolf (Canis lupus lupus), Maned wolf (Chrysocyon brachyurus), fennec (Vulpes zerda), cheetah (Acinonyx jubatus), jaguarundi (Herpailurus yaguarondi), Eurasian lynx (Lynx lynx), Indian lion (Panthera leo goojratensis), fisher (Martes pennanti), blackbuck (Antilope cervicapra), European bison (Bison bonasus), lechwe (Kobus leche), African buffalo (Syncerus caffer caffer), eland (Taurotragus oryx), sitatunga (Tragelaphus spekei gratus), Thorold's deer (Cervus albirostris), Eastern elk (C. elaphus canadensis), Vietnam sika deer (C. nippon pseudaxis) and Père David's deer (Elaphurus davidianus). Titres ranged from 1:40 to 1:2560. The highest prevalence 50% was found in family mustelidae of the order carnivora. Antibodies to T. gondii were detected in 193 of 556 zoo animals (34.7%) representing 72 of 114 species tested, with titres ranging from 1:40 to 1:40960. The highest prevalence 100% was found in families: hyaenidae, mustelidae, ursidae and viveridae of the order carnivora. The results of this study indicate that zoo animals have more exposure to T. gondii than to N. caninum. It is the first report of seroprevalence of antibodies to N. caninum in European zoo animals. PMID:16387445

  14. Molecular epidemiology of bovine tuberculosis in wild animals in Spain: a first approach to risk factor analysis. (United States)

    Parra, A; Larrasa, J; García, A; Alonso, J M; de Mendoza, J Hermoso


    In human tuberculosis (Mycobacterium tuberculosis), molecular epidemiology has accurately indicated the risk factors involved in active transmission of the disease, by comparing individuals whose isolates belong to a cluster with patients whose strains are considered unique. Nevertheless, this application has not been used in bovine tuberculosis (Mycobacterium bovis). Our study describes the integration of epidemiological data into molecular classification data on M. bovis isolates. These were isolated from wild ungulates in Extremadura (western Spain) with the objective of detecting the risk factors linked to the association of strains in clades, which are indicators of the active spread of the disease. The molecular markers used were spoligotyping + VNTR typing (loci: VNTR 2165, VNTR 2461, VNTR 0577, VNTR 0580, VNTR 3192 VNTR 2163a and VNTR 2163b) on a population of 59 M. bovis strains isolated from deer (Cervus elaphus), 112 from wild boar (Sus scrofa), six from bovines, 28 from pigs and 2 from goats (n=207). Epidemiological variables included the animal species from which the strain was isolated, pathological condition of the host (incipient lesion, early and late generalisation), date of sampling (during or after the reproductive period) and hunting season. Bivariant analysis was used to establish the risk factors connected to the association of strains and later, the variables were evaluated by means of logistic regression. Molecular typing grouped a total of 131 strains (64.21%) in 28 clusters and 76 isolates shows unique profiles. The association of strains was connected to the appearance of macroscopic lesions during the reproductive period (O.R. 4.80; 95% CI 1.09-22.99, PActive spread was not connected to any species in particular, or to any concrete pathological condition. PMID:16143470

  15. Ecosystem scale declines in elk recruitment and population growth with wolf colonization: a before-after-control-impact approach.

    Directory of Open Access Journals (Sweden)

    David Christianson

    Full Text Available The reintroduction of wolves (Canis lupus to Yellowstone provided the unusual opportunity for a quasi-experimental test of the effects of wolf predation on their primary prey (elk--Cervus elaphus in a system where top-down, bottom-up, and abiotic forces on prey population dynamics were closely and consistently monitored before and after reintroduction. Here, we examined data from 33 years for 12 elk population segments spread across southwestern Montana and northwestern Wyoming in a large scale before-after-control-impact analysis of the effects of wolves on elk recruitment and population dynamics. Recruitment, as measured by the midwinter juvenile∶female ratio, was a strong determinant of elk dynamics, and declined by 35% in elk herds colonized by wolves as annual population growth shifted from increasing to decreasing. Negative effects of population density and winter severity on recruitment, long recognized as important for elk dynamics, were detected in uncolonized elk herds and in wolf-colonized elk herds prior to wolf colonization, but not after wolf colonization. Growing season precipitation and harvest had no detectable effect on recruitment in either wolf treatment or colonization period, although harvest rates of juveniles∶females declined by 37% in wolf-colonized herds. Even if it is assumed that mortality due to predation is completely additive, liberal estimates of wolf predation rates on juvenile elk could explain no more than 52% of the total decline in juvenile∶female ratios in wolf-colonized herds, after accounting for the effects of other limiting factors. Collectively, these long-term, large-scale patterns align well with prior studies that have reported substantial decrease in elk numbers immediately after wolf recolonization, relatively weak additive effects of direct wolf predation on elk survival, and decreased reproduction and recruitment with exposure to predation risk from wolves.

  16. Country, cover or protection: what shapes the distribution of red deer and roe deer in the Bohemian Forest Ecosystem?

    Directory of Open Access Journals (Sweden)

    Marco Heurich

    Full Text Available The Bohemian Forest Ecosystem encompasses various wildlife management systems. Two large, contiguous national parks (one in Germany and one in the Czech Republic form the centre of the area, are surrounded by private hunting grounds, and hunting regulations in each country differ. Here we aimed at unravelling the influence of management-related and environmental factors on the distribution of red deer (Cervus elaphus and roe deer (Capreolus capreolus in this ecosystem. We used the standing crop method based on counts of pellet groups, with point counts every 100 m along 218 randomly distributed transects. Our analysis, which accounted for overdispersion as well as zero inflation and spatial autocorrelation, corroborated the view that both human management and the physical and biological environment drive ungulate distribution in mountainous areas in Central Europe. In contrast to our expectations, protection by national parks was the least important variable for red deer and the third important out of four variables for roe deer; protection negatively influenced roe deer distribution in both parks and positively influenced red deer distribution in Germany. Country was the most influential variable for both red and roe deer, with higher counts of pellet groups in the Czech Republic than in Germany. Elevation, which indicates increasing environmental harshness, was the second most important variable for both species. Forest cover was the least important variable for roe deer and the third important variable for red deer; the relationship for roe deer was positive and linear, and optimal forest cover for red deer was about 70% within a 500 m radius. Our results have direct implications for the future conservation management of deer in protected areas in Central Europe and show in particular that large non-intervention zones may not cause agglomerations of deer that could lead to conflicts along the border of protected, mountainous areas.

  17. What cues do ungulates use to assess predation risk in dense temperate forests?

    Directory of Open Access Journals (Sweden)

    Dries P J Kuijper

    Full Text Available Anti-predator responses by ungulates can be based on habitat features or on the near-imminent threat of predators. In dense forest, cues that ungulates use to assess predation risk likely differ from half-open landscapes, as scent relative to sight is predicted to be more important. We studied, in the Białowieża Primeval Forest (Poland, whether perceived predation risk in red deer (Cervus elaphus and wild boar (Sus scrofa is related to habitat visibility or olfactory cues of a predator. We used camera traps in two different set-ups to record undisturbed ungulate behavior and fresh wolf (Canis lupus scats as olfactory cue. Habitat visibility at fixed locations in deciduous old growth forest affected neither vigilance levels nor visitation rate and cumulative visitation time of both ungulate species. However, red deer showed a more than two-fold increase of vigilance level from 22% of the time present on control plots to 46% on experimental plots containing one wolf scat. Higher vigilance came at the expense of time spent foraging, which decreased from 32% to 12% while exposed to the wolf scat. These behavioral changes were most pronounced during the first week of the experiment but continuous monitoring of the plots suggested that they might last for several weeks. Wild boar did not show behavioral responses indicating higher perceived predation risk. Visitation rate and cumulative visitation time were not affected by the presence of a wolf scat in both ungulate species. The current study showed that perceived predation risk in red deer and wild boar is not related to habitat visibility in a dense forest ecosystem. However, olfactory cues of wolves affected foraging behavior of their preferred prey species red deer. We showed that odor of wolves in an ecologically equivalent dose is sufficient to create fine-scale risk factors for red deer.

  18. Time-dependence of 137Cs activity concentration in wild game meat in Knyszyn Primeval Forest (Poland)

    International Nuclear Information System (INIS)

    Wild game meat samples were analysed from the region of the Podlasie province (Knyszyn Primeval Forest). 137Cs content in meat was determined by gamma spectrometry in 2003 (33 samples), 2009 (22 samples) and 2012 (26 samples). The samples were collected in the autumn of 2003, 2009 and 2012 and were compared with data from 1996. Mean concentrations of 137Cs in the respective years were as follow: 42.2 Bq kg−1, 33.7 Bq kg−1 and 30.5 Bq kg−1, respectively. On the basis of mean values of 137Cs in the meat samples of red deer (Cervus elaphus), roe deer (Capreolus capreolus) and wild boars (Sus scrofa) between 1996/2012, the effective half-life of 137Cs was determined for specific species. For red deer equaled 8.9 years, for roe deer 11.6 years while for wild boar it exceeded the physical half-life and equaled 38.5 years. Mean value CR obtained for all three species equaled 1.7 ± 1.5 out of 102 measurements in animals muscles. - Highlights: • 137Cs activity concentrations in wild game meat from North-east Poland are presented. • The determined T1/2eff for 137Cs for red deer, wild boar and roe deer. • The results of 16 years of observation are presented. • Significant scattering of results for wild boars was observed. • Concentration ratio (CR) values were calculated out of the results for three species

  19. Elk and deer studies related to the Basalt Waste Isolation Project

    International Nuclear Information System (INIS)

    A study of elk (Cervus elaphus) and deer (Odocoileus hemionus) was conducted in the vicinity of planned site characterization activities for the Basalt Waste Isolation Project (BWIP). Both species are known to be sensitive to disturbance and are considered important species because they are recreationally and/or commercially valuable. The principal objectives of the study were to (1) estimate pre-activity (site characterization) recruitment of deer and elk, (2) characterize deer and elk use of limited habitats critical to their survival (e.g., riparian areas), (3) describe preferential habitat use by deer and elk during critical seasons (i.e., winter and summer), and (4) document pre-activity distributions of seasonal home range centers of deer and elk. Early termination of BWIP prevented some of the objectives from being fully addressed. Fifteen adult elk (11 females and 4 males) and 19 female deer equipped with radio transmitters were studied on the Arid Lands Ecology (ALE) Reserve from February through December 1987. More than 1800 relocations of the marked elk and deer were made during aerial and ground tracking sessions. Deer confined their activities to within 2 km of water sources. In contrast, elk used 6-12 times the average area used by deer. As with deer, female elk were closely associated with available water sources during the summer and fall, presumably because of the physiological demands of lactation. However, during the winter, female elk showed no preference for areas near water, as did male elk throughout the study. Riparian areas, which are scarce on the arid Hanford Site, are particularly valuable habitat to both elk and deer because they provide drinking water and succulent forage during the dry summer and early fall months

  20. Vaccination with BM86, subolesin and akirin protective antigens for the control of tick infestations in white tailed deer and red deer. (United States)

    Carreón, Diana; de la Lastra, José M Pérez; Almazán, Consuelo; Canales, Mario; Ruiz-Fons, Francisco; Boadella, Mariana; Moreno-Cid, Juan A; Villar, Margarita; Gortázar, Christian; Reglero, Manuel; Villarreal, Ricardo; de la Fuente, José


    Red deer (Cervus elaphus) and white-tailed deer (Odocoileus virginianus) are hosts for different tick species and tick-borne pathogens and play a role in tick dispersal and maintenance in some regions. These factors stress the importance of controlling tick infestations in deer and several methods such as culling and acaricide treatment have been used. Tick vaccines are a cost-effective alternative for tick control that reduced cattle tick infestations and tick-borne pathogens prevalence while reducing the use of acaricides. Our hypothesis is that vaccination with vector protective antigens can be used for the control of tick infestations in deer. Herein, three experiments were conducted to characterize (1) the antibody response in red deer immunized with recombinant BM86, the antigen included in commercial tick vaccines, (2) the antibody response and control of cattle tick infestations in white-tailed deer immunized with recombinant BM86 or tick subolesin (SUB) and experimentally infested with Rhipicephalus (Boophilus) microplus, and (3) the antibody response and control of Hyalomma spp. and Rhipicephalus spp. field tick infestations in red deer immunized with mosquito akirin (AKR), the SUB ortholog and candidate protective antigen against different tick species and other ectoparasites. The results showed that deer produced an antibody response that correlated with the reduction in tick infestations and was similar to other hosts vaccinated previously with these antigens. The overall vaccine efficacy was similar between BM86 (E=76%) and SUB (E=83%) for the control of R. microplus infestations in white-tailed deer. The field trial in red deer showed a 25-33% (18-40% when only infested deer were considered) reduction in tick infestations, 14-20 weeks after the first immunization. These results demonstrated that vaccination with vector protective antigens could be used as an alternative method for the control of tick infestations in deer to reduce tick populations

  1. Measured elemental transfer factors for boreal hunter/gatherer scenarios: fish, game and berries

    International Nuclear Information System (INIS)

    The environmental assessment of long-term nuclear waste management requires data to estimate food chain transfers for radionuclides in various environmental settings. For key elements such as iodine (I) and chlorine (Cl), there is a paucity of transfer factor data, particularly outside of agricultural food chains. This study dealt with transfers of I, Cl and 28 other elements to foods that would be typical of boreal hunter/gatherer lifestyles, as well as being common foods for modern recreational and subsistence hunters. Food/substrate concentration ratios (CRs) and related transfer factors for eight species of widely distributed fish, whitetail deer (Odocoileus virginianus), Canada geese (Branta canadensis) and wild blueberries (Vaccinium myrtilloides) were measured and compared to the literature. Limited data were obtained for caribou (Rangifer tarandus), elk (Cervus elaphus) and moose (Alces americanus). Freshwater sediment Kd values and CRs for a ubiquitous freshwater macrophyte were also obtained. The CRs for I in fish were 29 L kg-1 in edible muscle (fillets) of large-bodied species and 85 L kg-1 for whole, small-bodied fish. The log CRs for fish and macrophytes were correlated across elements. For several elements, the Kds for sediments in deep water were ∼4-fold higher than for littoral samples. The elemental transfers to wild animals for some elements were notably different than the literature indicates for domestic animals. It is argued that the transfer data obtained using indigenous elements from real environmental settings, as opposed to contaminant elements in experimental or impacted environments, are especially relevant to assessment of long-term impacts.

  2. Chronic effects of lead (Pb) on bone properties in red deer and wild boar: Relationship with vitamins A and D3

    International Nuclear Information System (INIS)

    Here we study the occurrence of abnormalities on bone tissue composition and turnover mechanisms through the Pb-mediated disruption of vitamins A and D in wild ungulates living in a lead (Pb)-polluted mining area. Red deer (Cervus elaphus) and wild boar (Sus scrofa) from the mining area had significantly higher liver and bone Pb levels than controls, which were associated with the depletion of liver retinyl esters and the corresponding increase of free retinol levels both in deer and boar from the mining area. Pb-exposed adult deer had lower carbonate content in bone mineral than controls, which was associated with the increased free retinol percentage. In wild boar, the degree of bone mineralization was also positively associated with higher burdens of retinyl esters. These results suggest that Pb-associated changes in bone composition and mineralization is likely influenced by the depletion of vitamin A in wildlife exposed to environmental Pb pollution. Highlights: ► We studied the effects of Pb pollution on bone and vitamins in wild ungulates from a mining area. ► Pb decreased the carbonate content in bone mineral in adult red deer. ► Pb increased the ratio of free retinol:retinyl esters in red deer and wild boar. ► Changes in vitamin A status were associated with changes in the carbonate content in bone mineral. ► Adverse effect of Pb on vitamin A status may be involved with toxic effects of Pb in bone tissue. -- The effect of Pb on vitamin A status could be involved in disturbances on bone biomeralization in red deer and wild boar living in Pb-polluted mining areas

  3. Sporormiella as a proxy for non-mammalian herbivores in island ecosystems (United States)

    Wood, Jamie R.; Wilmshurst, Janet M.; Worthy, Trevor H.; Cooper, Alan


    Spores of the dung-fungi Sporormiella are routinely used as a proxy for past megaherbivore biomass and to pinpoint the timing of extinctions. Further ecological insight can also be gained into the impacts that followed initial human arrival in a region through correlation of spore abundance with other proxies (e.g. pollen, charcoal). Currently, the use of Sporormiella as a palaeoecological proxy has been restricted to landmasses where large-herbivore guilds are dominated by mammals. Here, we use New Zealand as a case study to show that the method can also be applied effectively to islands dominated by large avian herbivores. We examine 44 dung samples from 7 localities to show that Sporormiella spores were widely distributed in the dung of endemic avian herbivores (South Island takahe ( Porphyrio hochstetteri), kakapo ( Strigops habroptilus), and several species of extinct moa, identified by ancient DNA analysis). In addition, we show that Sporormiella spores in a forest soil core from the Murchison Mountains, South Island, accurately trace the post-settlement decline of native avian herbivores, and combined with high-resolution radiocarbon dating reveal severely reduced local herbivore populations by the late 17th Century AD. The spores also trace the subsequent spread of Red deer ( Cervus elaphus) introduced to the area in the early 20th Century AD. Our results suggest Sporormiella spores may provide a useful new tool for examining extinctions on numerous islands where terrestrial herbivore guilds were dominated by birds or reptiles. Our findings also highlight the need to consider entire herbivore communities (including birds and reptiles) when examining Late Pleistocene continental Sporormiella records, where the focus has often been tracing the decline of populations of large mammals.

  4. Long-range gene flow and the effects of climatic and ecological factors on genetic structuring in a large, solitary carnivore: the Eurasian lynx.

    Directory of Open Access Journals (Sweden)

    Mirosław Ratkiewicz

    Full Text Available Due to their high mobility, large terrestrial predators are potentially capable of maintaining high connectivity, and therefore low genetic differentiation among populations. However, previous molecular studies have provided contradictory findings in relation to this. To elucidate patterns of genetic structure in large carnivores, we studied the genetic variability of the Eurasian lynx, Lynx lynx throughout north-eastern Europe using microsatellite, mitochondrial DNA control region and Y chromosome-linked markers. Using SAMOVA we found analogous patterns of genetic structure based on both mtDNA and microsatellites, which coincided with a relatively little evidence for male-biased dispersal. No polymorphism for the cytochrome b and ATP6 mtDNA genes and Y chromosome-linked markers were found. Lynx inhabiting a large area encompassing Finland, the Baltic countries and western Russia formed a single genetic unit, while some marginal populations were clearly divergent from others. The existence of a migration corridor was suggested to correspond with distribution of continuous forest cover. The lowest variability (in both markers was found in lynx from Norway and Białowieża Primeval Forest (BPF, which coincided with a recent demographic bottleneck (Norway or high habitat fragmentation (BPF. The Carpathian population, being monomorphic for the control region, showed relatively high microsatellite diversity, suggesting the effect of a past bottleneck (e.g. during Last Glacial Maximum on its present genetic composition. Genetic structuring for the mtDNA control region was best explained by latitude and snow cover depth. Microsatellite structuring correlated with the lynx's main prey, especially the proportion of red deer (Cervus elaphus in its diet. Eurasian lynx are capable of maintaining panmictic populations across eastern Europe unless they are severely limited by habitat continuity or a reduction in numbers. Different correlations of mtDNA and

  5. Association analysis of PRNP gene region with chronic wasting disease in Rocky Mountain elk

    Directory of Open Access Journals (Sweden)

    Spraker Terry R


    Full Text Available Abstract Background Chronic wasting disease (CWD is a transmissible spongiform encephalopathy (TSE of cervids including white-tailed (Odocoileus virginianus and mule deer (Odocoileus hemionus, Rocky Mountain elk (Cervus elaphus nelsoni, and moose (Alces alces. A leucine variant at position 132 (132L in prion protein of Rocky Mountain elk confers a long incubation time with CWD, but not complete resistance. However, variants in regulatory regions outside the open reading frame of PRNP have been associated with varying degrees of susceptibility to prion disease in other species, and some variants have been observed in similar regions of Rocky Mountain elk PRNP. Thus, additional genetic variants might provide increased protection, either alone or in combination with 132L. Findings This study provided genomic sequence of all exons for PRNP of Rocky Mountain elk. Many functional sites in and around the PRNP gene region were sequenced, and this report approximately doubled (to 75 the number of known variants in this region. A haplotype-tagging approach was used to reduce the number of genetic variants required to survey this variation in the PRNP gene region of 559 Rocky Mountain elk. Eight haplotypes were observed with frequencies over 1.0%, and one haplotype was present at 71.2% frequency, reflecting limited genetic diversity in the PRNP gene region. Conclusions The presence of 132L cut odds of CWD by more than half (Odds Ratio = 0.43; P = 0.0031, which was similar to a previous report. However after accounting for 132L, no association with CWD was found for any additional variants in the PRNP region (P > 0.05.

  6. Cost–Benefit Analyses of Mitigation Measures Aimed at Reducing Collisions with Large Ungulates in the United States and Canada: a Decision Support Tool

    Directory of Open Access Journals (Sweden)

    Robert J. Ament


    Full Text Available Wildlife–vehicle collisions, especially with deer (Odocoileus spp., elk (Cervus elaphus, and moose (Alces alces are numerous and have shown an increasing trend over the last several decades in the United States and Canada. We calculated the costs associated with the average deer–, elk–, and moose–vehicle collision, including vehicle repair costs, human injuries and fatalities, towing, accident attendance and investigation, monetary value to hunters of the animal killed in the collision, and cost of disposal of the animal carcass. In addition, we reviewed the effectiveness and costs of 13 mitigation measures considered effective in reducing collisions with large ungulates. We conducted cost–benefit analyses over a 75-year period using discount rates of 1%, 3%, and 7% to identify the threshold values (in 2007 U.S. dollars above which individual mitigation measures start generating benefits in excess of costs. These threshold values were translated into the number of deer–, elk–, or moose–vehicle collisions that need to occur per kilometer per year for a mitigation measure to start generating economic benefits in excess of costs. In addition, we calculated the costs associated with large ungulate–vehicle collisions on 10 road sections throughout the United States and Canada and compared these to the threshold values. Finally, we conducted a more detailed cost analysis for one of these road sections to illustrate that even though the average costs for large ungulate–vehicle collisions per kilometer per year may not meet the thresholds of many of the mitigation measures, specific locations on a road section can still exceed thresholds. We believe the cost–benefit model presented in this paper can be a valuable decision support tool for determining mitigation measures to reduce ungulate–vehicle collisions.

  7. Immune responses of elk to initial and booster vaccinations with Brucella abortus strain RB51 or 19. (United States)

    Olsen, S C; Fach, S J; Palmer, M V; Sacco, R E; Stoffregen, W C; Waters, W R


    Previous studies have suggested that currently available brucellosis vaccines induce poor or no protection in elk (Cervus elaphus nelsoni). In this study, we characterized the immunologic responses of elk after initial or booster vaccination with Brucella abortus strains RB51 (SRB51) and 19 (S19). Elk were vaccinated with saline or 10(10) CFU of SRB51 or S19 (n=seven animals/treatment) and booster vaccinated with a similar dosage of the autologous vaccine at 65 weeks. Compared to nonvaccinates, elk vaccinated with SRB51 or S19 had greater (PS19 after initial vaccination and after booster vaccination. Compared to nonvaccinated elk, greater (PS19 (22 weeks) treatment groups. In general, proliferative responses of vaccinates to nonautologous antigens did not differ (P>0.05) from the responses of nonvaccinated elk. Gamma interferon production in response to autologous or nonautologous Brucella antigens did not differ (P>0.05) between controls and vaccinates after booster vaccination. Flow cytometric techniques suggested that proliferation occurred more frequently in immunoglobulin M-positive cells, with differences between vaccination and control treatments in CD4+ and CD8+ subset proliferation detected only at 22 weeks after initial vaccination. After booster vaccination, one technique ([3H]thymidine incorporation) suggested that proliferative responses to SRB51 antigen, but not S19 antigen, were greater (PBrucella antigens in S19 or SRB51 vaccinates after booster vaccination. Although some cellular immune responses were detected after initial or booster vaccination of elk with SRB51 or S19, our data suggest that responses tend to be transient and much less robust than previously reported in SRB51-vaccinated cattle (Bos taurus) or bison (Bison bison). These data may explain why the vaccination of elk with S19 and SRB51 induces poor protection against brucellosis. PMID:17028213

  8. The effect of human activities and their associated noise on ungulate behavior.

    Directory of Open Access Journals (Sweden)

    Casey L Brown

    Full Text Available BACKGROUND: The effect of anthropogenic noise on terrestrial wildlife is a relatively new area of study with broad ranging management implications. Noise has been identified as a disturbance that has the potential to induce behavioral responses in animals similar to those associated with predation risk. This study investigated potential impacts of a variety of human activities and their associated noise on the behavior of elk (Cervus elaphus and pronghorn (Antilocapra americana along a transportation corridor in Grand Teton National Park. METHODOLOGY/PRINCIPAL FINDINGS: We conducted roadside scan surveys and focal observations of ungulate behavior while concurrently recording human activity and anthropogenic noise. Although we expected ungulates to be more responsive with greater human activity and noise, as predicted by the risk disturbance hypothesis, they were actually less responsive (less likely to perform vigilant, flight, traveling and defensive behaviors with increasing levels of vehicle traffic, the human activity most closely associated with noise. Noise levels themselves had relatively little effect on ungulate behavior, although there was a weak negative relationship between noise and responsiveness in our scan samples. In contrast, ungulates did increase their responsiveness with other forms of anthropogenic disturbance; they reacted to the presence of pedestrians (in our scan samples and to passing motorcycles (in our focal observations. CONCLUSIONS: These findings suggest that ungulates did not consistently associate noise and human activity with an increase in predation risk or that they could not afford to maintain responsiveness to the most frequent human stimuli. Although reduced responsiveness to certain disturbances may allow for greater investment in fitness-enhancing activities, it may also decrease detections of predators and other environmental cues and increase conflict with humans.

  9. Assessing Nutritional Parameters of Brown Bear Diets among Ecosystems Gives Insight into Differences among Populations.

    Directory of Open Access Journals (Sweden)

    Claudia López-Alfaro

    Full Text Available Food habit studies are among the first steps used to understand wildlife-habitat relationships. However, these studies are in themselves insufficient to understand differences in population productivity and life histories, because they do not provide a direct measure of the energetic value or nutritional composition of the complete diet. Here, we developed a dynamic model integrating food habits and nutritional information to assess nutritional parameters of brown bear (Ursus arctos diets among three interior ecosystems of North America. Specifically, we estimate the average amount of digestible energy and protein (per kilogram fresh diet content in the diet and across the active season by bears living in western Alberta, the Flathead River (FR drainage of southeast British Columbia, and the Greater Yellowstone Ecosystem (GYE. As well, we estimate the proportion of energy and protein in the diet contributed by different food items, thereby highlighting important food resources in each ecosystem. Bear diets in Alberta had the lowest levels of digestible protein and energy through all seasons, which might help explain the low reproductive rates of this population. The FR diet had protein levels similar to the recent male diet in the GYE during spring, but energy levels were lower during late summer and fall. Historic and recent diets in GYE had the most energy and protein, which is consistent with their larger body sizes and higher population productivity. However, a recent decrease in consumption of trout (Oncorhynchus clarki, whitebark pine nuts (Pinus albicaulis, and ungulates, particularly elk (Cervus elaphus, in GYE bears has decreased the energy and protein content of their diet. The patterns observed suggest that bear body size and population densities are influenced by seasonal availability of protein an energy, likely due in part to nutritional influences on mass gain and reproductive success.

  10. Carnivore repatriation and holarctic prey: narrowing the deficit in ecological effectiveness. (United States)

    Berger, Joel


    The continuing global decline of large carnivores has catalyzed great interest in reintroduction to restore populations and to reestablish ecologically functional relationships. I used variation in the distribution of four Holarctic prey species and their behavior as proxies to investigate the pace and intensity by which responses are lost or reinvigorated by carnivore repatriation. By simulating the presence of wolves (Canis lupus), tigers (Panthera tigris), and brown bears (Ursus arctos) at 19 transcontinental sites, I assayed three metrics of prey performance in areas with no large terrestrial carnivores (the polar islands of Greenland and Svalbard), extant native carnivores (Eastern Siberian Shield, boreal Canada, and Alaska); and repatriated carnivores (the Yellowstone region and Rocky Mountains). The loss and reestablishment of large carnivores changed the ecological effectiveness of systems by (1) dampening immediate group benefits, diminishing awareness, and diminishing flight reaction in caribou (Rangifer tarandus) where predation was eliminated and (2) reinstituting sensitivity to carnivores by elk (Cervus elaphus) and moose (Alces alces) in the Yellowstone region to levels observed in Asian elk when sympatric with Siberian tigers and wolves or in Alaskan moose sympatric with wolves. Behavioral compensation to reintroduced carnivores occurred within a single generation, but only the vigilance reaction of bison (Bison bison) in Yellowstone exceeded that of their wolf-exposed conspecifics from boreal Canada. Beyond these overt responses by prey, snow depth and distance to suitably vegetated habitat was related to heightened vigilance in moose and elk, respectively, but only at sites with carnivores. These findings are insufficient to determine whether similar patterns might apply to other species or in areas with alien predators, and they suggest that the presumed excessive vulnerability of naïve prey to repatriated carnivores may be ill-founded. Although

  11. Tall Grass Invasion After Grassland Abandonment Influences the Availability of Palatable Plants for Wild Herbivores: Insight into the Conservation of the Apennine Chamois Rupicapra pyrenaica ornata. (United States)

    Corazza, Marcello; Tardella, Federico Maria; Ferrari, Carlo; Catorci, Andrea


    Invasion of the tall grass Brachypodium genuense was observed in an area of the central Apennines (Italy) where the population size of Apennine chamois (Rupicapra pyrenaica ornata) was in strong decline. Since this dominant tall grass threatens biodiversity and forage quality, our hypothesis was that B. genuense abundance influenced that of palatable species for the chamois, depending on their functional traits and distribution patterns. Our sampling design used plots of 10 × 10 m and 1 × 1 m to investigate the plant community level and fine-scale interactions. We analyzed data using correlation, generalized linear models, and redundancy analyses. We found that B. genuense can reach high abundance values on the deepest soils. Its high cover value influences plant community composition by competitive exclusion of subordinate species and suppression of functional features because of temporal or spatial niche overlap. This leads to low cover of palatable species at a fine scale, and to poor pasture quality for chamois at a wider scale. Therefore, we postulated that B. genuense invasion, enhanced by long-term grazing cessation, may reduce the availability of palatable plants for Apennine chamois, especially below the potential timberline (1900-2000 m a.s.l.). The high abundance of B. genuense may amplify the effect of other negative factors, such as competition with red deer (Cervus elaphus) and climate change, in restricting the suitable habitat of the Apennine chamois to the higher sectors of the central Apennines. Thus, we suggested that B. genuense spread should be monitored carefully and plans to control its invasion should be implemented. PMID:26899738

  12. A hybrid double-observer sightability model for aerial surveys (United States)

    Griffin, Paul C.; Lubow, Bruce C.; Jenkins, Kurt J.; Vales, David J.; Moeller, Barbara J.; Reid, Mason; Happe, Patricia J.; Mccorquodale, Scott M.; Tirhi, Michelle J.; Schaberi, Jim P.; Beirne, Katherine


    Raw counts from aerial surveys make no correction for undetected animals and provide no estimate of precision with which to judge the utility of the counts. Sightability modeling and double-observer (DO) modeling are 2 commonly used approaches to account for detection bias and to estimate precision in aerial surveys. We developed a hybrid DO sightability model (model MH) that uses the strength of each approach to overcome the weakness in the other, for aerial surveys of elk (Cervus elaphus). The hybrid approach uses detection patterns of 2 independent observer pairs in a helicopter and telemetry-based detections of collared elk groups. Candidate MH models reflected hypotheses about effects of recorded covariates and unmodeled heterogeneity on the separate front-seat observer pair and back-seat observer pair detection probabilities. Group size and concealing vegetation cover strongly influenced detection probabilities. The pilot's previous experience participating in aerial surveys influenced detection by the front pair of observers if the elk group was on the pilot's side of the helicopter flight path. In 9 surveys in Mount Rainier National Park, the raw number of elk counted was approximately 80–93% of the abundance estimated by model MH. Uncorrected ratios of bulls per 100 cows generally were low compared to estimates adjusted for detection bias, but ratios of calves per 100 cows were comparable whether based on raw survey counts or adjusted estimates. The hybrid method was an improvement over commonly used alternatives, with improved precision compared to sightability modeling and reduced bias compared to DO modeling.

  13. Listeria monocytogenes in Different Specimens from Healthy Red Deer and Wild Boars. (United States)

    Weindl, Lucia; Frank, Elisabeth; Ullrich, Ulrike; Heurich, Marco; Kleta, Sylvia; Ellerbroek, Lüppo; Gareis, Manfred


    In the past, Listeria monocytogenes has been isolated from game feces and meat. However, less information is available on the occurrence of L. monocytogenes in other specimens originating from game animals. Hence, the aim of this study was to get an overview of the occurrence and distribution of L. monocytogenes in game animals by characterization of isolates from different matrices. For that purpose, samples were collected from red deer (Cervus elaphus), wild boars (Sus scrofa), and feed during the hunting season 2011-2012 in three different regions of Germany and Austria. Six samples from each animal were examined: tonsils, content of the rumen or the stomach, liver, intestinal lymph nodes, cecum content, and feces. Nineteen of 45 red deer and 12 of 49 wild boars were found to be positive for L. monocytogenes as well as 4 of 22 pooled feed samples. L. monocytogenes was isolated most frequently from the rumen of red deer (14 of 19) and the tonsils of wild boars (7 of 12). Serotypes 1/2a, 1/2b, 4a, and 4b were detected in samples of game animals and feed, and serotypes 1/2a and 4b were the most prevalent serotypes. The presence of L. monocytogenes serotype 4a had not yet been described in red deer. This might be due to the fact that it was only isolated from the content of rumen and that no other study has yet examined ruminal content. Pulsed-field gel electrophoresis showed a wide variety of strains. Some strains occurred in both species and feed samples, but one strain was dominant in one region. The results show that red deer and wild boars can be carriers of L. monocytogenes in different matrices, although the feces samples can be negative. PMID:27159352


    San Miguel, José M; Gutiérrez-Expósito, Daniel; Aguado-Martínez, Adriana; González-Zotes, Elena; Pereira-Bueno, Juana; Gómez-Bautista, Mercedes; Rubio, Pedro; Ortega-Mora, Luis M; Collantes-Fernández, Esther; Álvarez-García, Gema


    Toxoplasma gondii and Neospora caninum are two major abortifacient protozoans in domestic small ruminants and cattle, respectively, and they also parasitize a wide range of wildlife. Numerous serosurveys have been conducted in wild ruminants worldwide. However, the potential effect of different ecosystems and management practices on these infections has not been investigated. We studied the prevalence of antibodies to T. gondii and N. caninum in wild ruminants between 2007 and 2012 from four national wildlife reserves: three open space reserves in northwest Spain (Ancares, Mampodre, and Riaño) and a fenced reserve in central Spain (Quintos de Mora). Sera from roe deer ( Capreolus capreolus ) and chamois ( Rupicapra rupicapra ) were collected in Ancares (roe deer), Mampodre (both species), and Riaño (both species), whereas red deer ( Cervus elaphus ) sera were collected only in Quintos de Mora. The results of immunofluorescence antibody tests showed a T. gondii antibody prevalence significantly higher in red deer (13%; 17/131) than in roe deer (2%; 5/228) and chamois (4%; 6/149) (Panimals (2/131 red deer, 2/228 roe deer, and 2/149 chamois). Management measures were implemented in the Quintos de Mora reserve and T. gondii antibody prevalence in red deer decreased from 13% to 2% after 5 yr. In contrast, N. caninum antibody prevalences were very low (hunting reservations studied, so interconnection between sylvatic and domestic life cycles is unlikely. Regardless, a sustainable exploitation of natural resources in wildlife reserves may help to reduce the prevalence of T. gondii infection. PMID:26967135

  15. Lead, cadmium and organochlorine pesticide residues in hunted red deer and wild boar from northern Italy. (United States)

    Chiari, Mario; Cortinovis, Cristina; Bertoletti, Marco; Alborali, Loris; Zanoni, Mariagrazia; Ferretti, Enrica; Caloni, Francesca


    The objectives of the present study were to assess heavy metal cadmium (Cd), lead (Pb) and organochlorine pesticide concentrations in tissues of red deer (Cervus elaphus) and wild boar (Sus scrofa) from nine hunting areas and to evaluate related risk factors for the host animal. Over a period of 2 years, a total of 1055 and 210 masseters, 424 and 201 livers, 642 and 152 kidneys were collected from wild boar and red deer, respectively, and concentrations of Cd, Pb and organochlorine pesticides were determined. Comparing the two species, Cd concentration in the kidney (3.72 mg/kg), liver (0.67 mg/kg) and muscle (0.02 mg/kg) of wild boar was found to be significantly higher than in the organs of red deer (1.02 mg/kg in the kidneys, 0.07 mg/kg in the liver and 0.006 mg/kg in muscle). Mean Pb concentrations were found to be similar in both animals, with 0.39, 0.52 and 2.60 mg/kg detected in the wild boar kidney, liver and muscle, respectively, and 0.24, 0.21 and 2.04 mg/kg in the respective organs of the red deer. No difference in concentrations were found based on age class, location of tissue sample or contaminant in the case of wild boar. By contrast, a significantly lower Cd concentration was found in the kidney of the young red deer. The search for organochlorine pesticides in both red deer and wild boar produced negative results with values below the limits of detection. Due to the high levels of renal Cd and muscle Pb detected in wild boar and red deer, further research needs to be carried out in an effort to identify the source of contamination and preserve the health of animals and humans. PMID:26365428

  16. Benefits for dominant red deer hinds under a competitive feeding system: food access behavior, diet and nutrient selection. (United States)

    Ceacero, Francisco; García, Andrés J; Landete-Castillejos, Tomás; Bartošová, Jitka; Bartoš, Ludek; Gallego, Laureano


    Social dominance is widely known to facilitate access to food resources in many animal species such as deer. However, research has paid little attention to dominance in ad libitum access to food because it was thought not to result in any benefit for dominant individuals. In this study we assessed if, even under ad libitum conditions, social rank may allow dominant hinds to consume the preferred components of food. Forty-four red deer hinds (Cervus elaphus) were allowed to consume ad libitum meal consisting of pellets of sunflower, lucerne and orange, and seeds of cereals, corn, cotton, and carob tree. The meal was placed only in one feeder, which reduced accessibility to a few individuals simultaneously. During seven days, feeding behavior (order of access, time to first feeding bout, total time spent feeding, and time per feeding bout) were assessed during the first hour. The relative abundance of each meal component was assessed at times 0, 1 and 5 h, as well as its nutritional composition. Social rank was positively related to the amount of time spent feeding during the 1(st) h (P = 0.048). Selection indices were positively correlated with energy (P = 0.018 during the 1(st) h and P = 0.047 from 1(st) to 5(th)) and fat (only during the 1(st) h; P = 0.036), but also negatively with certain minerals. Thus, dominant hinds could select high energy meal components for longer time under an ad libitum but restricted food access setting. Selection indices showed a higher selectivity when food availability was higher (1(st) hour respect to 1(st) to 5(th)). Finally, high and low ranking hinds had longer time per feeding bout than mid ones (P = 0.011), suggesting complex behavioral feeding tactics of low ranking social ungulates. PMID:22403707

  17. The larger mammal fauna from the Lower Paleolithic Schöningen Spear site and its contribution to hominin subsistence. (United States)

    Van Kolfschoten, Thijs; Buhrs, Elfi; Verheijen, Ivo


    The locality Schöningen (Germany) is an important source of knowledge about Lower Paleolithic hominin subsistence. The locality includes a series of sites dated to the late Middle Pleistocene with a Holsteinian (MIS 11) and Reinsdorf Interglacial (MIS 9) age. One of the youngest sites is Schöningen 13 II-4, the Spear Horizon site also known as the Horse Butchery site. The organic remains excavated here are exceptionally well-preserved as they were embedded in anaerobic, waterlogged sediments in an area where the groundwater is rich in calcium carbonate. The fossil assemblage is ideal for the study of patterns in hominin interference with the mammalian species encountered at the site. The vertebrate record is extensive and very diverse. The fossil larger carnivore guild of the Spear Horizon faunal assemblage includes saber-toothed cat, fox, and wolf. Herbivores are represented by an elephant species, two equid species, two rhinoceros species, two cervid species, and two large bovid species. Evidence of hominin interference presents itself as either marks on skeletal remains related to the use of bones as knapping tools or hammers, or as marks that indicate butchering activities such as skinning, dismembering, defleshing, filleting, and marrow extraction. The humerus of the saber-toothed cat clearly shows that the bone has been used as a knapping tool. The fossil remains of the other larger carnivores do not show any signs of hominin interference or exploitation. This also applies to the limited number of elephant and rhinoceros remains found at the site. The large horse Equus mosbachensis dominates the larger mammal record and played a major role in hominin subsistence. Marks on the horse bones indicate that a large number of carcasses have been butchered. Traces on the fossil remains of both red deer (Cervus elaphus) and the large bovids also indicate exploitation by Lower Paleolithic hominins. PMID:26607346

  18. Relationships between nutritional condition of adult females and relative carrying capacity for rocky mountain Elk (United States)

    Piasecke, J.R.; Bender, L.C.


    Lactation can have significant costs to individual and population-level productivity because of the high energetic demands it places on dams. Because the difference in condition between lactating and dry Rocky Mountain elk (Cervus elaphus nelsoni) cows tends to disappear as nutritional quality rises, the magnitude of that difference could be used to relate condition to habitat quality or the capability of habitats to support elk. We therefore compared nutritional condition of ???2.5-yr-old lactating and dry cows from six free-ranging RockyMountain elk populations throughout the United States.Our goal was to quantify differential accrual of body fat (BF) reserves to determine whether the condition of dry and lactating cows could be used to define relevant management thresholds of habitat quality (i.e., relative carrying capacity) and consequently potential performance of elk populations. Levels of BF that lactating cows were able to accrue in autumn and the proportional difference in BF between dry and lactating cows in autumn were related (F 1-2,10???16.2, Pnutritionally stressed condition, which may be limiting population performance. Using the logistic model to predict relative proximity to ecological carrying capacity (ECC), our population-years ranged from3-97%ofECCand proportion of the population lactating (an index of calf survival) was negatively related to proportion of ECC. Results indicate that the proportional difference in accrual of BF between lactating and dry cows can provide a sensitive index to where elk populations reside relative to the quality of their range.

  19. Evolution of habitat and environment of deer during the Late-glacial and early Holocene: the case of red deer in French Jura. (United States)

    Drucker, Dorothée.; Bridault, Anne; Hujic, Alisa; Bocherens, Hervé


    The Late-glacial and early Holocene transition is a key period of environmental changes in a context of to a global warming. In northwestern Europe, extensive studies have documented the vegetation and faunal recomposition with the replacement of the cold steppe-tundra ecosystem by the forested temperate ecosystem we can still observe. Paleoecological interest focused on the extinct large mammals species like the Mammoth. In comparison, little has been done to decipher the ecological adaptation of the surviving species, especially those that are still present in the very same region than in the past. A better knowledge of the impact of changing environmental conditions on the ecology would be useful to define the degree of selective pressure. Thus, we have studied the habitat and environment evolution of red deer (Cervus elaphus) during the Late-glacial and early Holocene using stable isotopes and radiocarbon investigations. The analyzed bone material was selected from archaeological sites in French Jura. Performing direct radiocarbon dating on the bone collagen of the selected remains solved the problem of possible chronological uncertainties of the stratigraphical record of the sites. The same bone collagen samples were used for stable isotope measurements. We investigated the relative abundances in 13C to examine changes in habitat closure (canopy effect), in 15N to decipher changes in pedogenic activities (soil maturation) of the animals dwelling, and in 18O to track changes in altitude and/or local temperatures of the occupied territories. The results demonstrate that the stable isotopic composition of red deer bone collagen can be a valuable and sensitive indicator of habitat use and environmental conditions. The associated direct dating allows us to reconstruct the chronology of ecological changes. The combined chronological and ecological results evidence local differences in red deer adaptation at a small geographical scale.

  20. Sarcoptic mange in red deer from Spain: improved surveillance or disease emergence? (United States)

    Oleaga, A; Casais, R; González-Quirós, P; Prieto, M; Gortázar, C


    Concern about emerging diseases has risen in recent years, and multihost situations have become increasingly relevant for wildlife management and conservation. We present data on Asturias, northern Spain, where 80 mangy red deer (Cervus elaphus) have been found since the beginning of the epizootic in chamois (Rupicapra pyrenaica parva) in 1993. We combine field and necropsy data with the results of a serosurvey using an in-house ELISA test to evaluate if deer mange due to Sarcoptes scabiei is an emerging disease in this area. The mean number of deer mange cases per year was 5, with a maximum of 16. No significant relationship was detected between monthly temperatures, rainfall or number of days with snow cover and the annual number of sarcoptic mange cases in red deer. Only 4 mangy red deer (5%) were detected outside the limits of scabietic chamois distribution during the same year, and all were less than 2500 m away from that limit. The longest distance reported between two consecutive mangy deer locations was 18 km. Mange cases were significantly more frequent in stags than in hinds and in adults than in juvenile deer. The time of the first mange detection in chamois in each sector, year with minimum number of chamois recorded, year with maximum chamois population decline rate and chamois density offered no significant correlation with red deer mange cases appearance moment and frequency. In the mange affected area, ELISA testing of 327 blood samples from hunter-harvested deer without obvious mange-compatible lesions revealed only 4 seropositive animals. All 83 sera from hunting preserves without clinical cases yielded negative ELISA results. According to these epidemiological data mange does not seem to threaten red deer populations in Asturias. However, continued monitoring of deer health and ELISA testing for sarcoptic mange is advisable. PMID:18430519

  1. Comparison and overlap of sympatric wild ungulate diet in Cazorla, segura and las Villas Natural Park

    Directory of Open Access Journals (Sweden)

    Martínez Martínez, T.


    Full Text Available This paper analyses the trophic relationships and the degree of overlap between the diet of Spanish ibex (Capra pyrenaica, red deer (Cervus elaphus, fallow deer (Dama dama and mouflon (Ovis musimon in the Cazorla, Segura and Las Villas National Park (Southeastern of Spain. Stomach content was used as the basis for diet evaluation. The most heavily consumed plant species by the four herbivores were Quercus rotundifolia, Phillyrea latifolia, Rosmarinus officinalis, Oryzopsis paradoxa and Festuca arundinacea. Spanish ibex and red deer were the ungulates with the most similar diet (53.7% overlap, both were browsers and consumed large amounts of woody matter. Fallow deer and mouflon had similar feeding habits, both are grazers and have a high intake of grasses. There were very low levels of overlap between the ibex and red deer diet with that of fallow deer and mouflon, respectively. Mouflon was the largest forbs consumer, fallow deer consumed most camephytes and red deer consumed most trees and shrubs. None of the four ungulates had absolutely definitive diets that could class them strictly as browsers or grazers, however certain trends suggested that ibex and red deer primarily behave as browsers while fallow deer and mouflon are grazers, although this was not a strict division.

    Nous avons étudié le degré de superposition entre la diète du bouquetin (Capra pyrenaica, cerf (Cervus elaphus, daim (Dama dama et mouflon (Ovis musimon dans le Parc National de Cazorla, Segura et Las Villas (SE de l'Espagne. Pour l'évaluation de la diète, nous nous sommes basés sur les contenus stomachaux. Les espèces les plus consommées par les quatre herbivores étaient Quercus rotundifolia, Phillyrea latifolia, Rosmarinus officinalis, Oryzopsis paradoxa et Festuca arundinacea. Le bouquetin et le cerf montraient la diète la plus semblable (53,77o de

  2. Current and simulated structure, growth parameters and regeneration of beech forests with different game management in the Lány Game Enclosure / Struktura, růstové parametry, obnova a modelový vývoj bukových porostů s odlišným způsobem mysliveckého hospodaření v podmínkách Lánské obory

    Directory of Open Access Journals (Sweden)

    Ambrož Robin


    Full Text Available V příspěvku jsou prezentovány výsledky studia struktury a dynamiky vývoje bukových porostů v Lánské oboře, která se nachází v Chráněné krajinné oblasti Křivoklátsko v České republice. Výzkum se uskutečnil v dospělém bukovém porostu na dvou trvalých výzkumných plochách (TVP, každá o velikosti 0,25 ha s použitím technologie FieldMap. Typologické, půdní, fytocenologické i porostní charakteristiky obou porovnávaných TVP jsou srovnatelné, odlišují se pouze způsobem ochrany proti zvěři. Výsledky ukázaly, že limitujícím faktorem zdárného vývoje přirozené obnovy buku (Fagus sylvatica L. je vysoká zvěř, a to jelen evropský (Cervus elaphus L. - 300 ks, jelen sika (Cervus nippon nippon Temm. - 300 ks, muflon (Ovis musimon Pallas - 250 ks a daněk skvrnitý (Dama dama L. - 300 ks. Přirozená obnova na TVP 1 s černou zvěří (Sus scrofa L. - 150 ks je dostatečná vzhledem ke stanovištním a porostním poměrům. Naproti tomu na TVP 2 s ostatními druhy zvěře se obnova nevyskytuje. Z výsledků biometrických měření a následných vizualizací pomocí simulátoru biodynamiky lesa Sibyla vyplývá, že se jedná o nevýrazně strukturované, dospělé, produktivní bukové porosty s absencí jedinců spodního stromového patra.

  3. Time Budget and Behavior Pattern of Semi-free Cervus nippon in spring%散放条件下春季梅花鹿行为时间分配的研究

    Institute of Scientific and Technical Information of China (English)

    刘振生; 吴建平; 滕丽微


    From April to May in 1998, time budget and behavior patterns of semi-free Cervus nippon were studied in Pingshan Wildlife Experimental Farm. The results showed that grazing behavior accounts the most for activity time in spring, next for ruminating and bedding behaviors, and the least for alerting and moving behaviors. In a day, there are three grazing peaks (namely, 7:00~10:00, 12:00~14:00 and 16:00~17:00). The female spend more moving time than the male do. The male spend more alert and bedding time than the female. C. nippong spend more grazing time in cloudy days than in fine and rainy days, whileC. nippon spends less alert and moving time in cloudy days. Sex and weather influence activity time budget of C. nippon. More significant differences exist between male and female's moving behaviors (F = 10.09,P < 0.01 ), while significant differences exist between bedding ( F = 5.96, P < 0.05) and alert ( F = 4.52, P < 0.05) be haviors. More significant differences exist between grazing ( F = 8.39, P < 0.01) and alert ( F = 6.11, P < 0.01 ) behav iors due to weather factor, while significant differences exist between bedding ( F = 4.27, P < 0.05) and moving ( F =5.32, P<0.05) behaviors.


    Directory of Open Access Journals (Sweden)

    Ştefan RUSU


    Full Text Available Studiul parazitofaunei la mamiferele sălbatice din Rezervaţia Naturală „Codrii”, Republica Moldova, a pus în evi­denţă un nivel înalt de infestare a lor cu fasciole, dicrocelii, strongiloizi, protişti. Cerbul-nobil (Cervus elaphus Linaeus, 1758 era infestat cu Dicrocoelium lanceolatum (12,8%, Fasciola hepatica (9,5%, larve de strongiloizi (88,0% şi oochişti de Eimeria spp. (28,2%; cerbul-cu-pete (Cervus nippon Temminsk, 1838 – cu D. lanceolatum (14,9%, F. hepatica (10,2%, larve de strongiloizi (79,8%, oochişti de Eimeria spp. (22,4%; căpriorul (Capreolus capreolus Linaeus, 1758 – cu D. lanceolatum (20,1%, F. hepatica (3,2%, larve de strongiloizi (89,4% şi oochişti de Eimeria spp. (38,1%. La mistreţ s-a constatat un nivel de infestare cu Dicrocoelium lanceolatum în 3,6% cazuri, larve de Stron­gy­loides ransomi – în 72,3% cazuri, Metastrongylus elongatus – în 87,5% cazuri şi cu Eimeria spp. – în 46,3% cazuri. La Iepurele-de-câmp s-a constatat un nivel de infestare cu D. lanceolatum în 28,2% cazuri şi cu Strongyloides papillosus – în 59,4% cazuri. Nivelul înalt de infestare a mamiferelor sălbatice cu diverşi agenţi parazitari demonstrează încă o dată că ele participă la menţinerea lanţului epizootic al acestor maladii şi au un rol important la infestarea omului şi a anima­lelor domestice. Prin urmare, este strict necesar ca maladiile parazitare la animalele sălbatice să fie anual monitorizate, stabilind în acest mod evoluţia lor, apariţia unor noi agenţi parazitari şi elaborarea măsurilor de combatere a acestora. POLIPARASITIC FAUNA OF WILD MAMMALS INHABITING NATURAL RESERVATION “COdrii” in THE Republic OF MOldovaThe study on parasitic fauna in wild mammals from natural reservation “Codrii” in Republic of Moldova has revealed the high level of their infestation with fascicles, dicrocelium, strongiles and protista. The red deer (Cervus elaphus Linaeus, 1758 have been infested

  5. Study on the Changes in Enzyme and Insulin-like Growth Factor-1 Concentrations in Blood Serum and Growth Characteristics of Velvet Antler during the Antler Growth Period in Sika Deer (Cervus nippon). (United States)

    Park, Jaehyun; Jeon, Byongtae; Kang, Sungki; Oh, Mirae; Kim, Myonghwa; Jang, Seyoung; Park, Pyojam; Kim, Sangwoo; Moon, Sangho


    This study was conducted to investigate changes in blood enzyme parameters and to evaluate the relationship between insulin-like growth factor-1 (IGF-1), antler growth and body weight during the antler growth of sika deer (Cervus nippon). Serum enzyme activity and IGF-1 concentrations were measured in blood samples collected from the jugular and femoral veins at regular intervals during the antler growth period. Blood samples were taken in the morning from fasted stags (n = 12) which were healthy and showed no clinical signs of disease. Alfalfa was available ad libitum and concentrates were given at 1% of body weight to all stags. The experimental diet was provided at 9 am with water available at all times. There were no significant differences in alkaline phosphatase, aspartate aminotransferase, and alanine aminotransferase during antler growth, but alkaline phosphatase concentrations increased with antler growth progression, and the highest alkaline phosphatase concentration was obtained 55 days after antler casting. Serum IGF-1 concentrations measured from blood samples taken from the jugular vein during antler growth, determined that levels of IGF-1 was associated with body weight and antler growth patterns. Serum IGF-1 concentrations were higher at the antler cutting date than other sampling dates. Antler length increased significantly during antler growth (p<0.001), and there was a similar trend to between right and left beams. Body weight increased with antler growth but was not significant. Consequently it appeared that serum alkaline phosphatase concentration was related to antler growth and both antler growth and body weight were associated positively with IGF-1 concentrations during antler growth. PMID:26194228

  6. 海南坡鹿栖息地的外来植物调查%Field Survey of Alien Plants in Habitats of Hainan Eld's Deer ( Cervus eldi hainanus )

    Institute of Scientific and Technical Information of China (English)

    符明利; 吴琳琳; 侯荣; 林思亮


    Hainan Eld's deer ( Cervus eldi hainanus ) is a national - level protected species and endemic to China. The stability and development of Eld's deer habitats play a significant role in population growth. Alien invasive plants can affect habitats ir- reversibly over long time periods. We surveyed the alien plants in Hainan Datian National Nature Reserve, where Hainan Eld's deer occur, using line transects and quadrats from 2009 to 2011. We recorded 115 alien plant species of 40 families and 95 genera. Among these, 80 herbs accounted for 70% and most are tropical species, 50% were introduced from the Americas and were mainly distributed in grasslands. The widely distributed alien plants impact the abundance and distribution of native spe- cies and may have a negative effect on Eld's deer food resource in future. We make several recommendations for effective man- agement and conservation. Our survey results can provide a basis for maintaining the stability of Hainan Eld's deer habitat.%海南坡鹿是中国特有的国家Ⅰ级重点保护野生动物,其栖息地的稳定和发展对该物种种群有重要意义。潜在的外来入侵植物会对栖息地产生长期不可恢复的影响。因此,我们于2009—2011年采用样方调查和线路调查相结合的方法对海南坡鹿的栖息地海南大田国家级自然保护区内的外来植物进行了调查,共记录外来植物40科95属115种。其中,草本植物80种,占总物种数的69.6%;不论从科区系还是属区系上看,外来植物的区系分布都具有热带性;50.4%的外来植物产自美洲,在草地中分布最多。保护区内分布广泛的外来植物已对乡土物种产生一定的影响,也将可能对坡鹿的食物资源产生不利影响。根据调查结果,我们提出了一些保护管理建议。

  7. Estimating the phenology of elk brucellosis transmission with hierarchical models of cause-specific and baseline hazards (United States)

    Cross, Paul C.; Maichak, Eric J.; Rogerson, Jared D.; Irvine, Kathryn M.; Jones, Jennifer D; Heisey, Dennis M.; Edwards, William H.; Scurlock, Brandon M.


    Understanding the seasonal timing of disease transmission can lead to more effective control strategies, but the seasonality of transmission is often unknown for pathogens transmitted directly. We inserted vaginal implant transmitters (VITs) in 575 elk (Cervus elaphus canadensis) from 2006 to 2014 to assess when reproductive failures (i.e., abortions or still births) occur, which is the primary transmission route of Brucella abortus, the causative agent of brucellosis in the Greater Yellowstone Ecosystem. Using a survival analysis framework, we developed a Bayesian hierarchical model that simultaneously estimated the total baseline hazard of a reproductive event as well as its 2 mutually exclusive parts (abortions or live births). Approximately, 16% (95% CI = 0.10, 0.23) of the pregnant seropositive elk had reproductive failures, whereas 2% (95% CI = 0.01, 0.04) of the seronegative elk had probable abortions. Reproductive failures could have occurred as early as 13 February and as late as 10 July, peaking from March through May. Model results suggest that less than 5% of likely abortions occurred after 6 June each year and abortions were approximately 5 times more likely in March, April, or May compared to February or June. In western Wyoming, supplemental feeding of elk begins in December and ends during the peak of elk abortions and brucellosis transmission (i.e., Mar and Apr). Years with more snow may enhance elk-to-elk transmission on supplemental feeding areas because elk are artificially aggregated for the majority of the transmission season. Elk-to-cattle transmission will depend on the transmission period relative to the end of the supplemental feeding season, elk seroprevalence, population size, and the amount of commingling. Our statistical approach allowed us to estimate the probability density function of different event types over time, which may be applicable to other cause-specific survival analyses. It is often challenging to assess the

  8. Probable causes of increasing brucellosis in free-ranging elk of the Greater Yellowstone Ecosystem (United States)

    Cross, P.C.; Cole, E.K.; Dobson, A.P.; Edwards, W.H.; Hamlin, K.L.; Luikart, G.; Middleton, A.D.; Scurlock, B.M.; White, P.J.


    While many wildlife species are threatened, some populations have recovered from previous overexploitation, and data linking these population increases with disease dynamics are limited. We present data suggesting that free-ranging elk (Cervus elaphus) are a maintenance host for Brucella abortus in new areas of the Greater Yellowstone Ecosystem (GYE). Brucellosis seroprevalence in free-ranging elk increased from 0-7% in 1991-1992 to 8-20% in 2006-2007 in four of six herd units around the GYE. These levels of brucellosis are comparable to some herd units where elk are artificially aggregated on supplemental feeding grounds. There are several possible mechanisms for this increase that we evaluated using statistical and population modeling approaches. Simulations of an age-structured population model suggest that the observed levels of seroprevalence are unlikely to be sustained by dispersal from supplemental feeding areas with relatively high seroprevalence or an older age structure. Increases in brucellosis seroprevalence and the total elk population size in areas with feeding grounds have not been statistically detectable. Meanwhile, the rate of seroprevalence increase outside the feeding grounds was related to the population size and density of each herd unit. Therefore, the data suggest that enhanced elk-to-elk transmission in free-ranging populations may be occurring due to larger winter elk aggregations. Elk populations inside and outside of the GYE that traditionally did not maintain brucellosis may now be at risk due to recent population increases. In particular, some neighboring populations of Montana elk were 5-9 times larger in 2007 than in the 1970s, with some aggregations comparable to the Wyoming feeding-ground populations. Addressing the unintended consequences of these increasing populations is complicated by limited hunter access to private lands, which places many ungulate populations out of administrative control. Agency-landowner hunting access

  9. Wear Fast, Die Young: More Worn Teeth and Shorter Lives in Iberian Compared to Scottish Red Deer. (United States)

    Pérez-Barbería, F J; Carranza, J; Sánchez-Prieto, C


    Teeth in Cervidae are permanent structures that are not replaceable or repairable; consequently their rate of wear, due to the grinding effect of food and dental attrition, affects their duration and can determine an animal's lifespan. Tooth wear is also a useful indicator of accumulative life energy investment in intake and mastication and their interactions with diet. Little is known regarding how natural and sexual selection operate on dental structures within a species in contrasting environments and how these relate to life history traits to explain differences in population rates of tooth wear and longevity. We hypothesised that populations under harsh environmental conditions should be selected for more hypsodont teeth while sexual selection may maintain similar sex differences within different populations. We investigated the patterns of tooth wear in males and females of Iberian red deer (Cervus elaphus hispanicus) in Southern Spain and Scottish red deer (C. e. scoticus) across Scotland, that occur in very different environments, using 10343 samples from legal hunting activities. We found higher rates of both incisor and molar wear in the Spanish compared to Scottish populations. However, Scottish red deer had larger incisors at emergence than Iberian red deer, whilst molars emerged at a similar size in both populations and sexes. Iberian and Scottish males had earlier tooth depletion than females, in support of a similar sexual selection process in both populations. However, whilst average lifespan for Iberian males was 4 years shorter than that for Iberian females and Scottish males, Scottish males only showed a reduction of 1 year in average lifespan with respect to Scottish females. More worn molars were associated with larger mandibles in both populations, suggesting that higher intake and/or greater investment in food comminution may have favoured increased body growth, before later loss of tooth efficiency due to severe wear. These results

  10. Wear Fast, Die Young: More Worn Teeth and Shorter Lives in Iberian Compared to Scottish Red Deer.

    Directory of Open Access Journals (Sweden)

    F J Pérez-Barbería

    Full Text Available Teeth in Cervidae are permanent structures that are not replaceable or repairable; consequently their rate of wear, due to the grinding effect of food and dental attrition, affects their duration and can determine an animal's lifespan. Tooth wear is also a useful indicator of accumulative life energy investment in intake and mastication and their interactions with diet. Little is known regarding how natural and sexual selection operate on dental structures within a species in contrasting environments and how these relate to life history traits to explain differences in population rates of tooth wear and longevity. We hypothesised that populations under harsh environmental conditions should be selected for more hypsodont teeth while sexual selection may maintain similar sex differences within different populations. We investigated the patterns of tooth wear in males and females of Iberian red deer (Cervus elaphus hispanicus in Southern Spain and Scottish red deer (C. e. scoticus across Scotland, that occur in very different environments, using 10343 samples from legal hunting activities. We found higher rates of both incisor and molar wear in the Spanish compared to Scottish populations. However, Scottish red deer had larger incisors at emergence than Iberian red deer, whilst molars emerged at a similar size in both populations and sexes. Iberian and Scottish males had earlier tooth depletion than females, in support of a similar sexual selection process in both populations. However, whilst average lifespan for Iberian males was 4 years shorter than that for Iberian females and Scottish males, Scottish males only showed a reduction of 1 year in average lifespan with respect to Scottish females. More worn molars were associated with larger mandibles in both populations, suggesting that higher intake and/or greater investment in food comminution may have favoured increased body growth, before later loss of tooth efficiency due to severe wear. These

  11. Assessing Wildlife Habitat And Range Utilization in Arizona Using Satellite Data (United States)

    Hutchinson, C. F.; Marsh, S. E.; Krausman, P. R.; Enns, R. M.; Howery, L. D.; Trobia, E.; Wallace, C. S.; Walker, J. J.; Mauz, K.; Boyd, H.; Salazar, H.


    Since their reintroduction in 1914, elk (Cervus elaphus) have grown to be a major issue in the western United States. Most land is controlled by federal or state agencies, but individual ranchers have agreements that permit them to graze cattle on much of this land. Elk often compete with cattle for forage, and damage infrastructure (i.e. fences, watering points, and crops). Conversely, environmentalists and hunters also have an interest in the management of elk populations. As a result, consequence of these conflicting interests, there is little agreement about the size of the elk population or the nature, location, and timing of conflicts that elk might cause. This study was intended to provide information that might help managers understand the distribution of elk in Arizona as a consequence of seasonal variation and in response to extreme climatic events (i.e. El Niño and La Niña). The first task involved modeling elk populations over time. There are no long term or large-scale studies of elk movements through continuous observation (i.e. radiocollars). A technique for modeling elk population has been developed that is based on harvest data, gender ratios, and estimates of male mortality. This provided estimates of elk populations for individual game management units (areas for which harvest is reported and within which elk are managed by the Arizona Game and Fish Department). The second task involved the use of satellite data to characterize vegetation responses to seasonal and interannual climate variation among vegetation associations within game management units. This involved the use of NOAA Advanced Very High Resolution Radiometer (AVHRR) time series data to describe temporal vegetation behavior, Landsat and Ikonos data to describe spatial vegetation distribution in conjunction with U.S. Forest Service vegetation maps. Elk population estimates were correlated with satellite-derived vegetation measures by vegetation association through time. The patterns

  12. The modification and evaluation of an ELISA test for the surveillance of Mycobacterium avium subsp. paratuberculosis infection in wild ruminants

    Directory of Open Access Journals (Sweden)

    Pruvot Mathieu


    Full Text Available Abstract Background Enzyme-linked immunosorbent assay (ELISA is often used to test wildlife samples for Mycobacterium avium subsp. paratuberculosis (MAP infection. However, commercially available kits are only validated for use with domestic ruminant species. A literature review was performed to document the current use of MAP serum ELISA in wild and semi-domestic ruminants. We then modified and evaluated a commercial ELISA kit (IDEXX Mycobacterium paratuberculosis Antibody Test Kit for use with species for which it was not originally developed: elk (Cervus elaphus, bison (Bison bison and caribou (Rangifer tarandus. We tested the affinity of different conjugates for immunoglobulin G (IgG isolated from these species, performed checkerboard tests to determine the optimal dilutions of samples and conjugates, and established cut-off values using two different methods: a Receiver Operational Curve on a panel of known samples for elk, and an alternate method involving a panel of unknown serum samples for the three species. Results We found that the anti-bovine conjugate included in the IDEXX ELISA kit has limited affinity for elk, bison, and caribou IgG. Protein G showed good affinity for IgG of all three species, while anti-deer conjugate also bound elk and caribou IgG. Using Protein G with elk serum, a cut-off sample-to-positive (S/P value of 0.22 was selected, resulting in a sensitivity and specificity of 73% and 90%, respectively, whereas, using an anti-deer conjugate with elk serum, an S/P cut-off value of 0.29 gave a sensitivity of 68%, with 100% specificity. Cut-off values for bison and caribou using the Protein G conjugate were 0.17 and 0.25 respectively. Conclusions Due to incomplete reporting and a lack of test validation, it is difficult to critically appraise results of many sero-surveys that have previously been done for MAP in wildlife. Commercial ELISA kits may have limited or no capacity to detect antibodies from species other than for

  13. Elevated Rocky Mountain elk numbers prevent positive effects of fire on quaking aspen (Populus tremuloides) recruitment (United States)

    Smith, David Solance; Fettig, Stephen M.; Bowker, Matthew A.


    Quaking aspen (Populus tremuloides) is the most widespread tree species in North America and has supported a unique ecosystem for tens of thousands of years, yet is currently threatened by dramatic loss and possible local extinctions. While multiple factors such as climate change and fire suppression are thought to contribute to aspen’s decline, increased browsing by elk (Cervus elaphus), which have experienced dramatic population increases in the last ∼80 years, may severely inhibit aspen growth and regeneration. Fires are known to favor aspen recovery, but in the last several decades the spatial scale and intensity of wildfires has greatly increased, with poorly understood ramifications for aspen growth. Here, focusing on the 2000 Cerro Grande fire in central New Mexico – one of the earliest fires described as a “mega-fire” - we use three methods to examine the impact of elk browsing on aspen regeneration after a mega-fire. First, we use an exclosure experiment to show that aspen growing in the absence of elk were 3× taller than trees growing in the presence of elk. Further, aspen that were both protected from elk and experienced burning were 8.5× taller than unburned trees growing in the presence of elk, suggesting that the combination of release from herbivores and stimulation from fire creates the largest aspen growth rates. Second, using surveys at the landscape level, we found a correlation between elk browsing intensity and aspen height, such that where elk browsing was highest, aspen were shortest. This relationship between elk browsing intensity and aspen height was stronger in burned (r = −0.53) compared to unburned (r = −0.24) areas. Third, in conjunction with the landscape-level surveys, we identified possible natural refugia, microsites containing downed logs, shrubs etc. that may inhibit elk browsing by physically blocking aspen from elk or by impeding elk’s ability to move through the forest patch. We did not find any

  14. Effects of wolves on elk and cattle behaviors: implications for livestock production and wolf conservation.

    Directory of Open Access Journals (Sweden)

    Isabelle Laporte

    Full Text Available BACKGROUND: In many areas, livestock are grazed within wolf (Canis lupus range. Predation and harassment of livestock by wolves creates conflict and is a significant challenge for wolf conservation. Wild prey, such as elk (Cervus elaphus, perform anti-predator behaviors. Artificial selection of cattle (Bos taurus might have resulted in attenuation or absence of anti-predator responses, or in erratic and inconsistent responses. Regardless, such responses might have implications on stress and fitness. METHODOLOGY/PRINCIPAL FINDINGS: We compared elk and cattle anti-predator responses to wolves in southwest Alberta, Canada within home ranges and livestock pastures, respectively. We deployed satellite- and GPS-telemetry collars on wolves, elk, and cattle (n = 16, 10 and 78, respectively and measured seven prey response variables during periods of wolf presence and absence (speed, path sinuosity, time spent head-up, distance to neighboring animals, terrain ruggedness, slope and distance to forest. During independent periods of wolf presence (n = 72, individual elk increased path sinuosity (Z = -2.720, P = 0.007 and used more rugged terrain (Z = -2.856, P = 0.004 and steeper slopes (Z = -3.065, P = 0.002. For cattle, individual as well as group behavioral analyses were feasible and these indicated increased path sinuosity (Z = -2.720, P = 0.007 and decreased distance to neighbors (Z = -2.551, P = 0.011. In addition, cattle groups showed a number of behavioral changes concomitant to wolf visits, with variable direction in changes. CONCLUSIONS/SIGNIFICANCE: Our results suggest both elk and cattle modify their behavior in relation to wolf presence, with potential energetic costs. Our study does not allow evaluating the efficacy of anti-predator behaviors, but indicates that artificial selection did not result in their absence in cattle. The costs of wolf predation on livestock are often compensated considering just the market value of the animal killed

  15. Prioritizing conservation of ungulate calving resources in multiple-use landscapes.

    Directory of Open Access Journals (Sweden)

    Matthew R Dzialak

    Full Text Available BACKGROUND: Conserving animal populations in places where human activity is increasing is an ongoing challenge in many parts of the world. We investigated how human activity interacted with maternal status and individual variation in behavior to affect reliability of spatially-explicit models intended to guide conservation of critical ungulate calving resources. We studied Rocky Mountain elk (Cervus elaphus that occupy a region where 2900 natural gas wells have been drilled. METHODOLOGY/PRINCIPAL FINDINGS: We present novel applications of generalized additive modeling to predict maternal status based on movement, and of random-effects resource selection models to provide population and individual-based inference on the effects of maternal status and human activity. We used a 2×2 factorial design (treatment vs. control that included elk that were either parturient or non-parturient and in areas either with or without industrial development. Generalized additive models predicted maternal status (parturiency correctly 93% of the time based on movement. Human activity played a larger role than maternal status in shaping resource use; elk showed strong spatiotemporal patterns of selection or avoidance and marked individual variation in developed areas, but no such pattern in undeveloped areas. This difference had direct consequences for landscape-level conservation planning. When relative probability of use was calculated across the study area, there was disparity throughout 72-88% of the landscape in terms of where conservation intervention should be prioritized depending on whether models were based on behavior in developed areas or undeveloped areas. Model validation showed that models based on behavior in developed areas had poor predictive accuracy, whereas the model based on behavior in undeveloped areas had high predictive accuracy. CONCLUSIONS/SIGNIFICANCE: By directly testing for differences between developed and undeveloped areas, and by

  16. Application of Landsat 5-TM and GIS data to elk habitat studies in northern Idaho (United States)

    Hayes, Stephen Gordon


    An extensive geographic information system (GIS) database and a large radiotelemetry sample of elk (n = 153) were used to study habitat use and selection differences between cow and bull elk (Cervus elaphus) in the Coeur d'Alene Mountains of Idaho. Significant sex differences in 40 ha area use, and interactive effects of sex and season on selection of 40 ha areas from home ranges were found. In all seasons, bulls used habitats with more closed canopy forest, more hiding cover, and less shrub and graminoid cover, than cows. Cows selected areas with shrub and graminoid cover in winter and avoided areas with closed canopy forest and hiding cover in winter and summer seasons. Both sexes selected 40 ha areas of unfragmented hiding cover and closed canopy forest during the hunting season. Bulls also avoided areas with high open road densities during the rut and hunting season. These results support present elk management recommendations, but our observations of sexual segregation provide biologists with an opportunity to refine habitat management plans to target bulls and cows specifically. Furthermore, the results demonstrate that hiding cover and canopy closure can be accurately estimated from Landsat 5-TM imagery and GIS soil data at a scale and resolution to which elk respond. As a result, our habitat mapping methods can be applied to large areas of private and public land with consistent, cost-efficient results. Non-Lambertian correction models of Landsat 5-TM imagery were compared to an uncorrected image to determine if topographic normalization increased the accuracy of elk habitat maps of forest structure in northern Idaho. The non-Lambertian models produced elk habitat maps with overall and kappa statistic accuracies as much as 21.3% higher (p < 0.0192) than the uncorrected image. Log-linear models and power analysis were used to study the dependence of commission and omission error rates on topographic normalization, vegetation type, and solar incidence angle

  17. Behavioural flexibility in migratory behaviour in a long-lived large herbivore. (United States)

    Eggeman, Scott L; Hebblewhite, Mark; Bohm, Holger; Whittington, Jesse; Merrill, Evelyn H


    Migratory animals are predicted to enhance lifetime fitness by obtaining higher quality forage and/or reducing predation risk compared to non-migratory conspecifics. Despite evidence for behavioural flexibility in other taxa, previous research on large mammals has often assumed that migratory behaviour is a fixed behavioural trait. Migratory behaviour may be plastic for many species, although few studies have tested for individual-level flexibility using long-term monitoring of marked individuals, especially in large mammals such as ungulates. We tested variability in individual migratory behaviour using a 10-year telemetry data set of 223 adult female elk (Cervus elaphus) in the partially migratory Ya Ha Tinda population in Alberta, Canada. We used net squared displacement (NSD) to classify migratory strategy for each individual elk-year. Individuals switched between migrant and resident strategies at a mean rate of 15% per year, and migrants were more likely to switch than residents. We then tested how extrinsic (climate, elk/wolf abundance) and intrinsic (age) factors affected the probability of migrating, and, secondly, the decision to switch between migratory strategies. Over 630 individual elk-years, the probability of an individual elk migrating increased following a severe winter, in years of higher wolf abundance, and with increasing age. At an individual elk level, we observed 148 switching events of 430 possible transitions in elk monitored at least 2 years. We found switching was density-dependent, where migrants switched to a resident strategy at low elk abundance, but residents switched more to a migrant strategy at high elk abundance. Precipitation during the previous summer had a weak carryover effect, with migrants switching slightly more following wetter summers, whereas residents showed the opposite pattern. Older migrant elk rarely switched, whereas resident elk switched more frequently to migrate at older ages. Our results show migratory

  18. Use of stable isotopes to identify dietary differences across subpopulations and sex for a free-ranging generalist herbivore. (United States)

    Walter, W David


    Carbon and nitrogen isotopes in tissues can be used to understand plants consumed by various taxa, but can they provide additional information about consumers? Values of δ(13)C and δ(15)N were assessed from tissue of free-ranging elk (Cervus elaphus) occupying disparate habitats of mixed prairie-oak savannah that contained C3 agricultural crops in a C4-dominated landscape and in key plants consumed by elk. Muscle and hoof samples were collected from female and male elk in two subpopulations (forested land and grassland) from private land and one subpopulation from the Wichita Mountains Wildlife Refuge (refuge) in 2001-2006. Previous research identified differences between mean muscle δ(13)C and δ(15)N and mean hoof δ(13)C and δ(15)N indicating that isotopes differed between tissues of varying metabolic activity. Mean δ(13)C in hoof of elk on forested land and grassland were lower than hoof δ(13)C from elk in the refuge indicating greater long-term consumption of C3 plants by elk on forested land and grassland subpopulations. The δ(15)N in hoof was greater for elk outside the refuge than that for elk in the refuge. Interaction of sex and subpopulation only occurred for hoof δ(15)N suggesting that factors such as tissue type, sex, and habitat need to be considered to understand free-ranging ecology of generalist herbivores using stable isotopes. Availability of C3 agricultural crops high in percent nitrogen on a nearly annual basis in a C4-dominated landscape was likely driving differences in tissue δ(13)C and δ(15)N among subpopulations of free-ranging elk. An increase in tissue δ(15)N resulted from an increase in the consumption of higher δ(15)N in forage for sexes and subpopulations of a free-ranging ungulate in North America but δ(15)N should be further evaluated as an index of nutrition for subpopulations of generalist herbivores. PMID:24450704

  19. Elk and Deer Study, Material Disposal Area G, Technical Area 54: Source document

    International Nuclear Information System (INIS)

    As nuclear research has become more prevalent, environmental contamination from the disposal of radioactive waste has become a prominent issue. At Los Alamos National Laboratory (LANL) in northern New Mexico, radioactive contamination from disposal operations has raised some very specific concerns. Material Disposal Area G (Area G) is the primary low-level radioactive waste disposal site at LANL and occupies an area adjacent to land belonging to the Native American community of the Pueblo of San Ildefonso. Analyses of soil and vegetation collected from the perimeter of Area G have shown concentrations of radionuclides greater than background concentrations established for northern New Mexico. As a result, Pueblo residents had become concerned that contaminants from Area G could enter tribal lands through various ecological pathways. The residents specifically questioned the safety of consuming meat from elk and deer that forage near Area G and then migrate onto tribal lands. Consequently, this study addresses the uptake of 3H, 90Sr, totU, 238Pu, 239Pu, 241Am, and 137Cs by elk (Cervus elaphus) and deer (Odocoileus hemionus) that forage around the perimeter of Area G and the associated doses to the animals and to humans who consume these animals. Radionuclide uptake by and internal dose to animals was estimated using equations modified from National Council on Radiological Protection Report 76. The Residual Radiation computer code was used to estimate the external dose to animals and the dose to humans consuming meat. Soil and water concentrations from the perimeter of Area G and from background regions in northern New Mexico were averaged over 4 years (1993--1996) and used as input data for the models. Concentration estimates generated by the model correspond to the concentration range measured in actual tissue samples from elk and deer collected at LANL. The highest dose estimates for both animals (0.028 mrad/d) and humans (0.072 mrem/y) were well below guidelines

  20. Elk migration patterns and human activity influence wolf habitat use in the Greater Yellowstone Ecosystem. (United States)

    Nelson, Abigail A; Kauffman, Matthew J; Middleton, Arthur D; Jimenez, Michael D; McWhirter, Douglas E; Barber, Jarrett; Gerow, Kenneth


    Identifying the ecological dynamics underlying human-wildlife conflicts is important for the management and conservation of wildlife populations. In landscapes still occupied by large carnivores, many ungulate prey species migrate seasonally, yet little empirical research has explored the relationship between carnivore distribution and ungulate migration strategy. In this study, we evaluate the influence of elk (Cervus elaphus) distribution and other landscape features on wolf (Canis lupus) habitat use in an area of chronic wolf-livestock conflict in the Greater Yellowstone Ecosystem, USA. Using three years of fine-scale wolf (n = 14) and elk (n = 81) movement data, we compared the seasonal habitat use of wolves in an area dominated by migratory elk with that of wolves in an adjacent area dominated by resident elk. Most migratory elk vacate the associated winter wolf territories each summer via a 40-60 km migration, whereas resident elk remain accessible to wolves year-round. We used a generalized linear model to compare the relative probability of wolf use as a function of GIS-based habitat covariates in the migratory and resident elk areas. Although wolves in both areas used elk-rich habitat all year, elk density in summer had a weaker influence on the habitat use of wolves in the migratory elk area than the resident elk area. Wolves employed a number of alternative strategies to cope with the departure of migratory elk. Wolves in the two areas also differed in their disposition toward roads. In winter, wolves in the migratory elk area used habitat close to roads, while wolves in the resident elk area avoided roads. In summer, wolves in the migratory elk area were indifferent to roads, while wolves in resident elk areas strongly avoided roads, presumably due to the location of dens and summering elk combined with different traffic levels. Study results can help wildlife managers to anticipate the movements and establishment of wolf packs as they expand into areas

  1. Survey of selected pathogens and blood parameters of northern yellowstone elk: Wolf sanitation effect implications (United States)

    Barber-Meyer, S. M.; White, P.J.; Mech, L.D.


    The restoration or conservation of predators could reduce seroprevalences of certain diseases in prey if predation selectively removes animals exhibiting clinical signs. We assessed disease seroprevalences and blood parameters of 115 adult female elk (Cervus elaphus) wintering on the northern range of Yellowstone National Park [YNP] during 2000-2005 and compared them to data collected prior to wolf (Canis lupus) restoration (WR) in 1995 and to two other herds in Montana to assess this prediction. Blood parameters were generally within two standard deviations of the means observed in other Montana herds (Gravelly-Snowcrest [GS] and Garnet Mountain [GM]), but Yellowstone elk had higher seroprevalences of parainfluenza-3 virus (95% CI YNP = 61.1-78.6, GS = 30.3-46.5) and bovine-virus-diarrhea virus type 1 (95% CI YNP = 15.9-31.9, GM = 0). In comparisons between pre-wolf restoration [pre-WR] (i.e., prior to 1995) seroprevalences with those post-wolf restoration [post-WR] in Yellowstone, we found lower seroprevalences for some disease-causing agents post-wolf restoration (e.g., bovine-virus-diarrhea virus type-1 [95% CI pre-WR = 73.1-86.3, post-WR = 15.9-31.9] and bovine-respiratory syncytial virus [95% CI pre-WR = 70.0-83.8, post-WR = 0]), but similar (e.g., Brucella abortus [95% CI pre-WR = 0-4.45, post-WR = 0-4.74] and epizootic hemorrhagic disease virus [95% CI pre-WR = 0, post-WR = 0]) or higher for others (e.g., Anaplasma marginale [95% CI pre-WR = 0, post-WR = 18.5-38.7] and Leptospira spp. [95% CI pre-WR = 0.5-6.5, post-WR = 9.5-23.5]). Though we did not detect an overall strong predation effect through reduced disease seroprevalence using retrospective comparisons with sparse data, our reference values will facilitate future assessments of this issue.

  2. Spatially explicit modeling of animal tuberculosis at the wildlife-livestock interface in Ciudad Real province, Spain. (United States)

    LaHue, Nathaniel P; Baños, Joaquín Vicente; Acevedo, Pelayo; Gortázar, Christian; Martínez-López, Beatriz


    Eurasian wild boar (Sus scrofa) and red deer (Cervus elaphus) are the most important wildlife reservoirs for animal tuberculosis (TB) caused by the Mycobacterium tuberculosis complex (MTC), in Mediterranean Spain. These species are considered to play an important role in the transmission and persistence of MTC in cattle in some regions; however the factors contributing to the risk of transmission at the wildlife-livestock interface and the areas at highest risk for such transmission are largely unknown. This study sought to identify geographic areas where wildlife-livestock interactions are most likely to occur and to characterize the environmental and management factors at this interface contributing to persistence, incidence, and occurrence of TB on cattle farms, in one of the provinces with higher TB prevalence in Spain, Ciudad Real. We used spatially explicit, ecological niche models to evaluate the importance of factors such as wildlife demographics and hunting management, land use, climatic, and environmental variables as well as TB status in wildlife for TB breakdown (model 1), persistence (model 2) and new infection (model 3) on cattle farms and to generate high resolution maps of predicted TB occurrence to guide risk-based interventions. Models revealed that land use, particularly open area and woodland, high wild boar TB prevalence, and close proximity to fenced hunting estates were the most important factors associated with TB infection on cattle farms. This is the first time that local TB prevalence in wild boar for individual hunting estates has been significantly associated with TB occurrence on cattle farms at a local scale. Prediction maps identified two areas with high likelihood of TB occurrence in the southwest and northwest of the province where wildlife-livestock interactions and TB occurrence are highly likely and where TB preventative and mitigation strategies (e.g. targeted vaccination, increased biosecurity, etc.) should be prioritized

  3. Leave before it's too late: anthropogenic and environmental triggers of autumn migration in a hunted ungulate population. (United States)

    Rivaud, Inger Maren; Bischof, Richard; Meisingset, Erling L; Zimmermann, Barbara; Loe, Leif Egil; Mysterud, Atle


    Autumn has to a large extent been neglected in the climate effect literature, yet autumn events, e.g., plant senescence and animal migration, affect fitness of animals differently than spring events. Understanding how variables including plant phenology influence timing of autumn migrations is important to gain a comprehensive understanding of the full annual cycle of migratory species. Here we use 13 yr of data from 60 male and 168 female red deer (Cervus elaphus) to identify triggers of autumn migration. We relate the timing of autumn migration to environmental variables like snow fall, temperature, and plant phenology (NDVI), and to onset of hunting, sex, and migration distance. Severe weather has been suggested as the main trigger of autumn migration, but we found that the majority of the individuals had left the summer range well before snow fall (80.3%) and frost (70.5%), and also before the peak deterioration in forage quality (71.9%). Declining temperatures were associated with a higher daily migration potential. Onset of hunting showed the largest effect on migration potential, with a marked increase during the first days of hunting. Individuals still present in the summer range when snow fall, frost, or peak forage deterioration occurred showed a significantly higher migration potential around these events. Males were less responsive to environmental cues, suggesting rutting activity, starting earlier in males, initiate movement prior to such conditions. Also, individuals with longer migration distances had a higher migration potential late in the season than individuals with shorter migration distances. Our study shows that factors beyond weather and plant phenology, such as onset of hunting, may be important triggers of autumn migration. Severe weather and forage deterioration were important triggers for the individuals experiencing this, which suggests a hierarchical response to environmental cues. The trade-off between staying longer in the summer

  4. Life in the Fast Lane: Road Crossing Behavior of Mule Deer in a Wildland-Urban Interface

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, Leslie A. [Los Alamos National Laboratory; Biggs, James [Northern New Mexico College; Bennett, Kathryn D. [Los Alamos National Laboratory; Bare, Carey [Bare and Associates, LLC; Sherwood, Sherri R. [Los Alamos National Laboratory


    In 2009, approximately 260,000 animal-vehicle collisions were reported in the United States, resulting in 12,000 human injuries and 173 human fatalities. Research has focused on identifying factors associated with high densities of animal-vehicle collisions, including variables such as traffic speed and volume, road design, topographic features, vegetative cover, and local deer or elk (Cervus elaphus) abundance. The purposes of this study were to document how often and where mule deer (Odocoileus hemionus) crossed roads in a western United States wildland-urban interface area, and to relate deer road-crossing behavior to deer-vehicle collision locations. Seven adult mule deer (four males [M] and three females [F]) were captured and collared with GPS-enabled collars during December 2001 and January 2002. Five of the seven deployed collars were recovered. None of the roads in the study area appeared to act as a substantial barrier to deer passage. Deer home ranges straddled highways and primary, secondary, and tertiary arterial roads. Deer crossed all types of roads. The average number of times deer crossed road during 24 hours of monitoring ranged from 2.1 to 7.0. Deer in the Los Alamos townsite avoided crossing roads during day and before sunset. Deer-vehicle accidents occurred at 350 percent of the level expected after sunset. All other time periods had fewer accidents than expected. The distribution of accidents across time periods was not similar to the distribution of road crossings across time periods for any deer. Within Los Alamos County there was a clear trend for deer-vehicle collisions to occur on roads with speed limits > 35 mph. Deer in the townsite frequently crossed roads with lower speed limits; therefore, the reason for the paucity of accidents along these roads was evidently the ability of drivers to detect deer (or the ability of deer to detect vehicles) and respond before an accident occurred. There was a significant but not strong correlation

  5. The role of wild ruminants as reservoirs of Besnoitia besnoiti infection in cattle. (United States)

    Gutiérrez-Expósito, Daniel; Arnal, María C; Martínez-Durán, David; Regidor-Cerrillo, Javier; Revilla, Miguel; L Fernández de Luco, Daniel; Jiménez-Meléndez, Alejandro; Calero-Bernal, Rafael; Habela, Miguel Angel; García-Bocanegra, Ignacio; Arenas-Montes, Antonio; Ortega-Mora, Luis M; Álvarez-García, Gema


    Bovine besnoitiosis, a parasitic disease caused by Besnoitia besnoiti, has been reported mainly in beef cattle raised under extensive pastoral systems and is considered to be re-emerging in Western Europe. Horizontal transmission probably occurs either by means of blood sucking arthropods or as a consequence of direct contact between infected and non-infected cattle. However, the role that wild ruminants (e.g., red deer (Cervus elaphus) and roe deer (Capreolus capreolus)) may play in the parasite life cycle as putative reservoirs remains elusive. Thus, we investigated the presence of Besnoitia spp. infection in 2608 wild ruminants located in areas where bovine besnoitiosis is present and identified the Besnoitia species detected. First, a serosurvey was conducted in red deer (n=309), roe deer (n=417), Pyrenean chamois (Rupicapra p. pyrenaica, n=383) and Iberian wild goat (Capra pyrenaica hispanica, n=288) from two areas of Aragon, northeastern Spain, where bovine besnoitiosis is endemic. Second, red deer (n=820), roe deer (n=37), fallow deer (Dama dama, n=166), Iberian wild goat (n=86) and European mouflon (Ovis orientalis musimon, n=102) from southwestern Spain, where new outbreaks have recently been reported, were also sampled. The presence of Besnoitia spp.-specific antibodies was confirmed by western blot in one red deer and one roe deer from the Pyrenees, and Besnoitia spp. DNA was detected by ITS1-PCR in the seropositive red deer. Besnoitia genotyping based on 6 microsatellite (MS) analyses was carried out in red deer samples and compared with B. besnoiti genotypes from 7 in vitro isolates and 3 infected bovines, B. tarandi (1 isolate) and B. bennetti (from tissues of an infected donkey) for Besnoitia spp. assignation. Multilocus MS analysis of B. besnoiti, B. tarandi and B. bennetti showed specific genotypes for each species. A restricted genetic diversity with two genotypes by variation in a unique MS marker was revealed among the 7 B. besnoiti isolates

  6. Gli Ungulati in Italia: status, gestione e ricerca scientifica

    Directory of Open Access Journals (Sweden)

    Marco Apollonio


    Full Text Available Abstract Ungulates in Italy: status, management and scientific research Ungulates in Italy have experienced in the last decade a further increase of their distribution and, possibly, consistence. This trend has been very obvious in the central and northern part of Italy, on the contrary, in south Italy the increase of ungulates populations is quite slow if any. A partial exception is Sardinia where Sardinian red deer (Cervus elaphus corsicanus has been reintroduced into the four provinces of the island. In this frame the relevance of the increase of ungulates for the increase of wolves (Canis lupus in Italy must be emphasized. Ungulates management has also experienced a general development in the last decade, even if deep differences between south and central-north Italy still persist. Well conducted reintroductions have allowed to fill many gaps in the species distribution. Ungulates hunting bags size, suggest an increased importance of ungulates in the hunting activities in Italy. Selective hunting with rifles on cervids and bovids was established in wide areas of north and central Italy, mainly as consequence of roe deer (Capreolus capreolus widespread presence. Wild boar (Sus scrofa hunting still represents a problem for ungulate management in Italy. Almost 50% of the provinces where wild boar is hunted does not collect hunting bag statistics, and only 35% of them try to roughly estimate the consistence of the populations. The traditional dogs hunting of wild boar has expanded to areas where wild boar was recently and illegally reintroduced, as south Italy and the Alps region, and this is a serious problem for the development of a more rational and correct hunting practices. New possibilities of hunting management of red deer in central Italy, and in the future of alpine ibex (Capra ibex, are to be considered. An increase of the presence of trained wildlife

  7. Status sulle conoscenze dei mammiferi molisani

    Directory of Open Access Journals (Sweden)

    Nicola Norante


    reintrodotta. Dubbie le segnalazioni passate, i montanari la ricordano come ?Lupo cerviero? ma si è potuto trattare anche di felini di specie diversa, forse allevati da aristocratici. Sus scrofa (del quale è in programma uno studio sui mantelli per verificarne la variabilità, Cervus elaphus e Capreolus capreolus sono presenti con nuclei alloctoni reintrodotti. Presente anche Dama dama. Rupicapra pyrenaica distribuito in origine sulle Mainarde, risulta abbondante in tutta la fascia di rispetto al PNA e spesso è stato osservato a distanza, nei territori di Scapoli, Montaquila, Rocchetta, Cerro al Volturno. Per quanto riguarda i micromammiferi è in corso un censimento basato su trappolaggi e raccolta borre.

  8. Study on Deer Antler Growth Behavior of Captive Manchurian Wapiti%圈养东北马鹿鹿茸生长研究

    Institute of Scientific and Technical Information of China (English)

    郝京民; 何绍纯; 由玉岩


    2012年3月8日至5月22日,对北京动物园圈养的一只雄性东北马鹿鹿茸生长进行了研究。每间隔8~12d对鹿茸进行拍照,按比例测算鹿茸的相对长度,在锯鹿茸当日测定鹿茸重量。结果表明:圈养条件下,东北马鹿鹿茸主干生长随时间变化呈"S"型生长曲线,即呈缓慢、快速和减速生长3个阶段。第1阶段为第0~29天,平均生长速度为0.17cm/d;第2阶段为第30~56天,平均生长速度为1.30cm/d;第3阶段为第57天后,鹿茸平均生长速度为0.94cm/d。鹿茸3个阶段生长速率差异显著(P〈0.01)。第72天鹿茸锯下时重量4.0kg,平均增重0.05kg/d;右角主干长度54.5cm,平均生长速度0.76cm/d;左角主干长度56.5cm,平均生长速度0.78cm/d。%From March 8th,2012 to May 22nd,2012,the deer antler growth behavior of a male Cervus elaphus xanthopygus was studied in Beijing Zoo using focal animal sampling method. The sampling intervals were 8-12 days. Different stages of deer antler were taken pictures, the data of the deer antler relative lengths were calculated ,and the deer antler was weighted when amputated. The results showed that the growth of the deer antler main branch of the captive manchurian wapiti was in a ' S' shaped growth curve, which composed by three stages, with time going showed slow, fast and deceleration respectively. The first stage was at 0-29 days of the deer antler trunk growth ,with an average growth rate of 0.17 cm/d. The second stage was at 30-56 days, with an average growth rate of 1.30 cm/d. The third stage was after 57 days,with average growth rate of 0.94 cm/d. The growth rate in three stages were significantly different (P〈0.01).The deer antler was 4.0 kg when sawed after 72 days. The weight increased by 0.05kg/d.The right main branch of the deer antler was 54.5 cm in length, and the average growth rate was 0.76 cm/d. The left main branch of the deer antler was 56.5 cm in length, and the average growth rate was 0.78 cm/d.

  9. Melatonin promotes superovulation in sika deer (Cervus nippon). (United States)

    Wang, Liang; Zhuo, Zhi-Yong; Shi, Wen-Qing; Tan, Dun-Xian; Gao, Chao; Tian, Xiu-Zhi; Zhang, Lu; Zhou, Guang-Bin; Zhu, Shi-En; Yun, Peng; Liu, Guo-Shi


    In this study, the effects of melatonin (MT) on superovulation and reproductive hormones (melatonin, follicle-stimulating hormone (FSH), luteinizing hormone (LH) and PRL) were investigated in female sika deer. Different doses (40 or 80 mg/animal) of melatonin were subcutaneously implanted into deer before the breeding season. Exogenous melatonin administration significantly elevated the serum FSH levels at the time of insemination compared with levels in control animals. During superovulation, the serum LH levels in donor sika deer reached their highest values (7.1±2.04 ng/mL) at the point of insemination, compared with the baseline levels (4.98±0.07 ng/mL) in control animals. This high level of LH was sustained until the day of embryo recovery. In contrast, the serum levels of PRL in the 80 mg of melatonin-treated group were significantly lower than those of control deer. The average number of corpora lutea in melatonin-treated deer was significantly higher than that of the control (p0.05), which may be related to the relatively small sample size. In addition, embryonic development in melatonin-treated groups was delayed. PMID:25007067

  10. Melatonin Promotes Superovulation in Sika Deer (Cervus nippon)


    Liang Wang; Zhi-Yong Zhuo; Wen-Qing Shi; Dun-Xian Tan; Chao Gao; Xiu-Zhi Tian; Lu Zhang; Guang-Bin Zhou; Shi-En Zhu; Peng Yun; Guo-Shi Liu


    In this study, the effects of melatonin (MT) on superovulation and reproductive hormones (melatonin, follicle-stimulating hormone (FSH), luteinizing hormone (LH) and PRL) were investigated in female sika deer. Different doses (40 or 80 mg/animal) of melatonin were subcutaneously implanted into deer before the breeding season. Exogenous melatonin administration significantly elevated the serum FSH levels at the time of insemination compared with levels in control animals. During superovulation...

  11. Melatonin Promotes Superovulation in Sika Deer (Cervus nippon

    Directory of Open Access Journals (Sweden)

    Liang Wang


    Full Text Available In this study, the effects of melatonin (MT on superovulation and reproductive hormones (melatonin, follicle-stimulating hormone (FSH, luteinizing hormone (LH and PRL were investigated in female sika deer. Different doses (40 or 80 mg/animal of melatonin were subcutaneously implanted into deer before the breeding season. Exogenous melatonin administration significantly elevated the serum FSH levels at the time of insemination compared with levels in control animals. During superovulation, the serum LH levels in donor sika deer reached their highest values (7.1 ± 2.04 ng/mL at the point of insemination, compared with the baseline levels (4.98 ± 0.07 ng/mL in control animals. This high level of LH was sustained until the day of embryo recovery. In contrast, the serum levels of PRL in the 80 mg of melatonin-treated group were significantly lower than those of control deer. The average number of corpora lutea in melatonin-treated deer was significantly higher than that of the control (p < 0.05. The average number of embryos in the deer treated with 40 mg of melatonin was higher than that of the control; however, this increase did not reach significant difference (p > 0.05, which may be related to the relatively small sample size. In addition, embryonic development in melatonin-treated groups was delayed.

  12. Capture myopathy in red deer and wild goat

    Directory of Open Access Journals (Sweden)

    Mirian, J.


    Full Text Available This syndrome is a shock-like hyper metabolic myopathy triggered in susceptible animals by stress. Capture myopathy (C.M. is a commonly occurring condition in mammals following trapping and ransportation. In this case 12 to 24 hours after transportation of red deer (Cevus elaphus and wild goats (Capra ibex clinical signs such as: muscular tremor, ataxia, recumbency, hyperthermia, tachycardia, hyperventilation and red brown urine observed. According to symptoms Capture myoparthy was diagnosed Treatment was ineffective on one red deer and one wild goat. Necropsy findings of dead animals were included: hyperemia, petechial hemorrhage in pericardium and heart muscle, pale foci of leg and heart muscles and red brown urine in bladder. This case report represents the attention to Capture myopathy in wild animals and particular caution that should be exercised in capturing and handling of these animals.

  13. Taxonomy Icon Data: wapiti [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Cervus_canadensis_L.png Cervus_canadensis_NL.png Cervus_canadensis_S.png Cervus_canadensis_NS.png ...

  14. Zoogeografia storica e attuale dei carnivori e degli ungulati italiani

    Directory of Open Access Journals (Sweden)

    Marco Masseti


    L., 1758 Dama dama (L., 1758 Cervus elaphus L., 1758 Capreolus capreolus (L., 1758 Rupicapra pyrenaica Bonaparte, 1845 Rupicapra rupicapra (L., 1758 Capra aegagrus Erxleben, 1777 Capra ibex L., 1758 Ovis orientalis Gmelin, 1774

  15. The construction of cloned Sika deer embryos (Cervus nippon hortulorum) by demecolcine auxiliary enucleation. (United States)

    Yin, Y; Mei, M; Zhang, D; Zhang, S; Fan, A; Zhou, H; Li, Z


    The objective of our study was to establish the feasibility of experimental protocols for cloning sika deer. We performed auxiliary enucleation to improve the efficiency of nuclear transfer operation by optimizing the demecolcine concentration to induce cytoplasmic protrusions in the sika deer oocytes. In the present study,we had studied the impact of different demecolcine concentrations on cytoplasmic protrusions and enucleation rates. We determined that 95.9% of the sika deer oocytes formed cytoplasmic protrusions when treated for 1 h with 0.8 μg/ml demecolcine. The lowest observed rate of protrusion was 19.3% after overnight treatment with demecolcine. When the oocytes aged or had a poor cumulus expansion, they exhibited a significant decrease in the ability to form cytoplasmic protrusions. The rates of enucleation (94.9% vs 85.8%, p sika deer oocytes could be enucleated quickly and effectively using demecolcine auxiliary enucleation, which could enhance the enucleation rate, cell fusion rate and blastocyst rate of cloned embryos in vitro. PMID:24138424

  16. Maintenance Crude Protein Requirement of Penned Female Korean Spotted Deer (Cervus nippon)


    Yang, S Y; Oh, Y. K.; Ahn, H. S.; Kwak, W. S.


    This study was conducted to evaluate the protein requirement for maintenance of 2-year-old female Korean spotted deer. In the course of the experiment, each of three hand-reared female spotted deer was fed three diets that were iso-calorically formulated to contain low (approximately 7%), medium (12%), and high (17%) levels of crude protein (CP). Each of six trials included a 5-day transition, a 10-day preliminary, and a 7-day collection period. Dietary protein levels affected the apparent di...

  17. Prevalence of antibody to hepatitis E virus among wild sika deer, Cervus nippon, in Japan. (United States)

    Matsuura, Y; Suzuki, M; Yoshimatsu, K; Arikawa, J; Takashima, I; Yokoyama, M; Igota, H; Yamauchi, K; Ishida, S; Fukui, D; Bando, G; Kosuge, M; Tsunemitsu, H; Koshimoto, C; Sakae, K; Chikahira, M; Ogawa, S; Miyamura, T; Takeda, N; Li, T C


    We examined 976 sika deer serum samples, 159 liver tissue samples and 88 stool samples collected from 16 prefectures in Japan, and performed ELISA and RT-PCR assays to detect antibodies to HEV and HEV RNA, respectively. Although 25 (2.6%) of 976 samples were positive for anti-HEV IgG, the antibody titers were very low. The OD values ranged between 0.018 and 0.486, forming a single distribution rather than a bimodal distribution, suggesting that the antibody detected in this study was not induced by HEV infection, or that deer have low sensitivity to HEV. HEV RNA was not detected in these samples, also suggesting that deer may not play a role as an HEV reservoir. PMID:17431737

  18. Seroprevalence of Neospora caninum infection in farmed sika deer (Cervus nippon) in China. (United States)

    Meng, Qing-Feng; Li, Ying; Zhou, Yu; Bai, Ya-Duo; Wang, Wei-Lin; Wang, Wei-Li; Cong, Wei


    Neospora caninum is a worldwide protozoan that can induce neuromuscular disease in dogs and reproductive failure in domestic and wild ruminants. The objective of the present investigation was to determine the seroprevalence of N. caninum infection in farmed sika deer in China as little is known of this host-parasite relationship. A total of 1800 serum samples were collected during 2013 and 2014 from farmed sika deer in the major production areas of Liaoning, Jilin and Heilongjiang provinces.Assay by ELISA for N. caninum antibodies indicated a seroprevalence of 13.6% in 2013 and 15.8% in 2014, varying in different regions from 9.5% to 27.5%. Statistical analysis revealed that prevalence in animals aged >4 years (20.4%) was significantly higher than in the age ranges sika deer in herds with a history of miscarriage (41.9%) had a significantly higher seroprevalence than in those without (12.6%) (Psika deer in China and provides base-line data for the design and evaluation of measures for its control and prevention in this host. PMID:26073107

  19. Molecular detection and genetic characterization of Toxoplasma gondii infection in sika deer (Cervus nippon) in China. (United States)

    Cong, Wei; Qin, Si-Yuan; Meng, Qing-Feng; Zou, Feng-Cai; Qian, Ai-Dong; Zhu, Xing-Quan


    The objective of the present study was to investigate the prevalence and genetic characterization of Toxoplasma gondii infection in sika deer in China. During August 2014 to November 2014, a total of 450 tissue samples coming from 150 sika deer were collected to detect the T. gondii B1 gene using a nested PCR, and the positive samples were genotyped at 11 genetic markers (SAG1, 5'- and 3'-SAG2, alternative SAG2, SAG3, BTUB, GRA6, L358, PK1, c22-8, c29-2, and Apico) using multilocus polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) technology. Seventeen of 150 sika deer (11.33%) were tested positive by nested PCR. Six DNA samples from the 17 positive samples were completely typed, in which 4 samples from lung tissues, and 2 from muscular tissues, were identified as ToxoDB Genotype #9 ( The results of the present study revealed the existence of T. gondii infection in sika deer in China, which provided the information of T. gondii genetic diversity in this host species. This study also indicated that ToxoDB Genotype #9 has a wide distribution in sika deer that could be potential reservoirs for T. gondii transmission, which may pose a threat to human health. PMID:26772153

  20. Intestinal adenocarcinoma in a herd of farmed Sika deer (Cervus nippon): a novel syndrome. (United States)

    Kelly, P A; Toolan, D; Jahns, H


    Intestinal adenocarcinomas were identified in 76 adult deer from a closed herd of 193 breeding animals grazing pasture heavily infested with bracken fern (Pteridium aquilinum). Tumors were observed postmortem in 32 animals with rapid weight loss, and similar neoplasms were detected in a further 44 clinically normal deer at "cull." Tumors were located in distal ileum, cecum, and proximal colon and presented as single (26%) or multiple (74%), variably sized, pale-gray, firm, poorly circumscribed neoplasms with associated intestinal strictures. Histopathologically tumors were well-differentiated, locally infiltrative, low-grade adenocarcinomas of tubular (51%), mucinous (33.5%), or mixed (15.5%) types. Extraintestinal metastases were not observed. The high incidence of intestinal adenocarcinoma within this herd suggests a specific and novel syndrome, and genetic and/or environmental factors may be involved in the pathogenesis. PMID:24503440

  1. Isolation and characterization of novel microsatellite markers from the sika deer (Cervus nippon) genome. (United States)

    Li, Y M; Bai, C Y; Niu, W P; Yu, H; Yang, R J; Yan, S Q; Zhang, J Y; Zhang, M J; Zhao, Z H


    Microsatellite markers are widely and evenly distributed, and are highly polymorphic. Rapid and convenient detection through automated analysis means that microsatellite markers are widely used in the construction of plant and animal genetic maps, in quantitative trait loci localization, marker-assisted selection, identification of genetic relationships, and genetic diversity and phylogenetic tree construction. However, few microsatellite markers remain to be isolated. We used streptavidin magnetic beads to affinity-capture and construct a (CA)n microsatellite DNA-enriched library from sika deer. We selected sequences containing more than six repeats to design primers. Clear bands were selected, which were amplified using non-specific primers following PCR amplification to screen polymorphisms in a group of 65 unrelated sika deer. The positive clone rate reached 82.9% by constructing the enriched library, and we then selected positive clones for sequencing. There were 395 sequences with CA repeats, and the CA repeat number was 4-105. We selected sequences containing more than six repeats to design primers, of which 297 pairs were designed. We next selected clear bands and used non-specific primers to amplify following PCR amplification. In total, 245 pairs of primers were screened. We then selected 50 pairs of primers to randomly screen for polymorphisms. We detected 47 polymorphic and 3 monomorphic loci in 65 unrelated sika deer. These newly isolated and characterized microsatellite loci can be used to construct genetic maps and for lineage testing in deer. In addition, they can be used for comparative genomics between Cervidae species. PMID:26436393

  2. Molecular Cloning and Gene Expression Analysis of Ercc6l in Sika Deer (Cervus nippon hortulorum)


    Yin, Yupeng; Tang, Lina; Zhang, Jiabao; Tang, Bo; Li, Ziyi


    Background One important protein family that functions in nucleotide excision repair (NER) factors is the SNF2 family. A newly identified mouse ERCC6-like gene, Ercc6l (excision repair cross-complementing rodent repair deficiency, complementation group 6-like), has been shown to be another developmentally related member of the SNF2 family. Methodology/Principal Findings In this study, Sika deer Ercc6l cDNA was first cloned and then sequenced. The full-length cDNA of the Sika deer Ercc6l gene ...

  3. Neutron activation analysis of trace metals in the livers of Japanese sika deer (cervus Nippon)

    International Nuclear Information System (INIS)

    Neutron activation analysis facilities at the JMTR reactor was used to determine the levels of trace metals in the livers of nine Japanese sika deer. The samples were cut into pieces, pulverized in liquid nitrogen, freeze-dried, and finally fractionated through a stainless steel sieve of 200 mesh. Then the samples were irradiated for 6 or 24 hours by a neutron flux of 1.0x1014 n·cm-2·sec-1. In the present work, we analysed the concentrations of six elements (Ag, Co, Fe, Rb, Se, and Zn) in the livers of nine deer. (author)

  4. Dybowski's sika deer (Cervus nippon hortulorum): genetic diversity of native Primorian and introduced Czech populations

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Vallo, Peter; Voloshina, I. V.; Koubek, Petr

    Moscow : IUGB, 2009, s. 1-5. ISBN 978-5-7035-2118-2. [IUGB Congress /29./. Moscow (RU), 17.08.2009-22.08.2009] R&D Projects: GA ČR GA524/09/1569; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Dybowski's sika deer * genetic diversity Subject RIV: EB - Genetics ; Molecular Biology

  5. Grazing Habitat of the Rusa Deer (Cervus timorensis) in the Upland Kebar, Manokwari




    The general objective of the study was to provide current information on grassland communities as deer habitat and its future development plan for a sustainable forage management in upland Kebar, Papua. Quantitative estimation of forage production was carried out by measuring a biomass harvest in fresh weight bases, while occasional observations on ranging deer were done within habitat range with the aid of 7x50 binoculars verified by actual visitation of grazed area. The study indicated that...


    Directory of Open Access Journals (Sweden)

    N. Hanani


    Full Text Available The aim of this research was to determine the profit obtained from breeding of Timor deer commercially. This research was done in East Java. Survey method was used to answer the objective. The study location were selected by purposive sampling. Usually deer was develop in conservation area, but because the area was decrease so the number of deer also decrease. Model of deer raising development should be improved not only for conservation but also for commercial purpose. The optimum deer raising were considered and monitored with a purpose to maximize commercial Timor deer by using Multiple Objective Goal Programming (MOGP to find the Optimistic Rate Estimation. The result of this study showed to get the optimum benefit, it had to be applied together with conservation and commercial effort at the same time. Results of study showed that profit was taken from selling velvet was 164.46%. Profits taken from selling antler was 350.56%, from selling alive deer was 394.28%, from selling recreation tickets was 259.08%, from selling venison1 was 135.98%, and from selling deer leather was 141.24%. Operational cost spent were 168.46% for feeding cost, 213.23% for maintenance cost, and 232.04% for labors’ salaries. The amount of operational cost required in MOGP model, with lower expenses and commercial priority were 185.54% for feeding cost, 253.13% for maintenance cost, and 246.95% for paying labors’ salaries. The MOGP model result with commercial priority reached 335.21%, while in MOGP model with lower costs and commercial priority gave profit for breeders up to 381.26%.



    N. Hanani; B. A. Nugroho; Z. Fanani; S.I. Santoso


    The aim of this research was to determine the profit obtained from breeding of Timor deer commercially. This research was done in East Java. Survey method was used to answer the objective. The study location were selected by purposive sampling. Usually deer was develop in conservation area, but because the area was decrease so the number of deer also decrease. Model of deer raising development should be improved not only for conservation but also for commercial purpose. The optimum deer raisi...

  8. Grazing Habitat of the Rusa Deer (Cervus timorensis in the Upland Kebar, Manokwari

    Directory of Open Access Journals (Sweden)



    Full Text Available The general objective of the study was to provide current information on grassland communities as deer habitat and its future development plan for a sustainable forage management in upland Kebar, Papua. Quantitative estimation of forage production was carried out by measuring a biomass harvest in fresh weight bases, while occasional observations on ranging deer were done within habitat range with the aid of 7x50 binoculars verified by actual visitation of grazed area. The study indicated that Kebar was the only grazing area of deer varies in low layer vegetation composition that comprised of eleven grass species and five legume species. Imperata cylindrica, Paspalum conjugatum, Themeda arguens, Melinis minutiflora and Cyperus rotundus were identified as food plant of deer in Kebar. Among these species T. arguens, M. minutiflora, C. rotundus and I. cylindrica were the most preferred species consumed by deer. The biomass harvest (species productivity was 30.36 kg/ha fresh weight, while deer food productivity in the grassland was slightly lower (26.70 kg/ha than total productivity of the grassland. The major drainage area is Kasi River, but two other rivers across this valley (Api River, Apriri River are also supply water to the swampy area.

  9. Campylobacter hyointestinalis-associated enteritis in Moluccan rusa deer (Cervus timorensis subsp. Moluccensis). (United States)

    Hill, B D; Thomas, R J; Mackenzie, A R


    A morphological and bacteriological study on a Campylobacter hyointestinalis-associated enteritis in adult Moluccan rusa deer is described. Necropsied deer were 2 to 2.5 years of age and had been scouring for 1 to 2 months. There was distension of the ileum and excessive corrugation of the mucosa. Microscopic lesions in the small intestine were confined to the ileum. Stunting and fusion of villi, patchy erosion of epithelium and a predominantly neutrophilic infiltrate were features. The inflammatory reaction in caecum and colon was much less severe. Light and scanning electron-microscopical examination of small and large intestine showed large numbers of Gram-negative curved rods colonizing surface mucus and moderate numbers in close association with gland epithelium. No salmonellae or other enteropathogenic bacteria were isolated on aerobically-incubated media. C. hyointestinalis was isolated from the faeces, ileum, caecum, colon and mesenteric lymph nodes from 2 cases and one farm-collected faecal sample. PMID:3443691

  10. Evolutionary biology and life histories

    Directory of Open Access Journals (Sweden)

    Brown, C. R.


    winters that coincided with high population density (Tavecchia et al., 2005. The significant interaction between age and time may have been responsible for maintaining differences among cohorts in demographic parameters such as survival (Tavecchia et al., 2005. In turtles, Rivalan et al. (pers. comm. found evidence of a typical cost of reproduction in which the number of reproductive seasons in an individual’s lifetime was inversely related to the extent of reproductive investment in a given season. By statistically accounting for loss of tags in these turtles, which can be substantial and thus may potentially bias state–transition probabilities, the authors discovered that fitness was roughly equivalent for all females, regardless of how often they attempted to breed. The studies by Tavecchia et al. (2005 and Rivalan et al. (pers. comm. illustrate the benefits of using multi–state models in accounting for recapture/re– sighting probabilities. The pattern of senescence in wild populations was a focus of the work by Catchpole et al. (2004 and Gaillard et al. (2004. In the well–studied red deer (Cervus elaphus of Rum, senility was suggested by a survival probability that declined with age among the oldest age classes in both males and females, although there was little evidence for age–dependent survival among the younger age classes (Catchpole et al., 2004. As in many species, some animals dispersed from the study area, and notably Catchpole et al. (2004 accounted for dispersal in their estimates of age–dependent survival. In a comparative study of roe deer (Capreolus capreolus and bighorn sheep (Ovis canadensis, Gaillard et al. (2004 combined traditional mark–recapture analysis with the commonly used Gompertz and Weibull models to describe senescence patterns. They found that senescence in these species can be generally described by the Gompertz model, a result likely to be of interest to researchers working on senescence in a variety of taxa. Both studies

  11. Three finger palpation technique of vas deferens for keyhole vasectomy in spotted (Axis axis and sambar deer (Cervus unicolor

    Directory of Open Access Journals (Sweden)

    B. J. William


    Full Text Available Aim: Vasectomy is performed in deer for population control, maintain pedigreed animals and prevent inbreeding. Conventional procedure of vasectomy required a long-term anesthesia and longer duration of hospitalization, which often result in stress, morbidity and mortality. A study was conducted to capture, neuter and release the deer with minimal hospitalization and stress by adopting three finger palpation technique of vas deferens and performing vasectomy through a key-hole incision. Materials and Methods: The study was conducted on three spotted male deer and three sambar male deer, which were immobilized with a mixture of xylazine at the dose of 1.00 mg/kg and ketamine at the dose of 5.00 mg/kg. The vas deferens could be palpated as a piece of cooked spaghetti at the neck of the scrotum on the anterior aspect by three finger palpation technique and was able to fix the vas deferens between the thumb and middle finger. Through a key-hole incision of <5 mm length, the vas deferens was exteriorized and resected using electrocautery and the skin incision was sealed with methyl methacrylate. The deer were released on the same day, and no post-operative complication was noticed. Conclusion: The study revealed that three finger palpation technique of vas deferens provided guidance for easy access to vas deferens for vasectomy in deer with less hospitalization, and the deer could be released on the same day.

  12. Optimizing the conditions for in vitro maturation and artificial activation of sika deer (Cervus nippon hortulorum) oocytes. (United States)

    Yin, Y; Tang, L; Zhang, P; Kong, D; Wang, Z; Guan, J; Song, G; Tang, B; Li, Z


    With the goal of establishing experimental protocols for cloning sika deer, various conditions for in vitro maturation (IVM) and artificial activation of sika deer oocytes were examined. In vitro maturation was evaluated in seven different culture media. The highest rate of oocyte maturation was 75.4% in 10 μg/ml follicle-stimulating hormone (FSH), 1 μg/ml LH, 0.2 mm cysteamine and 50 ng/ml epidermal growth factor (EGF) after 24 h of IVM. The efficiency after 24 h of IVM did not differ significantly (p > 0.05) from that observed after 20 h. Cysteamine (0.2 mm) significantly increased the maturation rates after 20 h (from 59.1% to 67.2%, p sika deer oocytes to the blastocyst stage (32.4%). Our results indicate that in vitro matured sika deer oocytes are good candidates for parthenogenetic activation and that chemical treatment is needed for relatively efficient activation of the oocytes. These optimized conditions for IVM and parthenogenetic activation may be useful for efforts to restore populations of the endangered sika deer using the somatic cell nuclear transfer technique. PMID:22458270

  13. Serum hormone concentrations and ovarian follicular wave emergence in Jilin sika deer (Cervus nippon hortulorum) after synchronization of estrous cycles. (United States)

    Chen, X M; Wei, H J; Yang, Y F; Xue, H L; Zhao, W G; Zhao, M


    The study was conducted to investigate the serum hormone concentrations and follicular dynamics present after synchronous treatment (CIDR) in female Jilin sika deer (n = 15) of estrous cycles. Blood samples were collected to analyze the FSH, LH, estradiol and progesterone during the estrous cycles. Manual transrectal ultrasonography examination was conducted at least thrice weekly to monitor the follicular wave. Ultrasonography showed that follicle development occurred in waves, and most estrous cycles in Jilin sika deer consist of one, two, or three waves. The largest follicles of the interwaves of two- and three-wave cycles were different (P sika deer is characterized by one, two, or three waves of follicular development after synchronization. PMID:25563157

  14. Detection of Lyme disease spirochetes in the skin of naturally infected wild sika deer (Cervus nippon yesoensis) by PCR. (United States)

    Kimura, K; Isogai, E; Isogai, H; Kamewaka, Y; Nishikawa, T; Ishii, N; Fujii, N


    We demonstrated the presence of Borrelia burgdorferi sensu lato DNA in the skin tissues of naturally infected wild sika deer, using PCR. The risk of transmission of B. burgdorferi sensu lato is recognized in sika deer. PMID:7747979

  15. Caprine herpesvirus-2 in association with naturally occurring malignant catarrhal fever in captive sika deer (Cervus nippon). (United States)

    Keel, M Kevin; Patterson, J Gage; Noon, Ted H; Bradley, Gregory A; Collins, James K


    Three female sika deer from a single captive herd were submitted for postmortem examination over a 139-day period. The first 2 deer submitted were reported to have lost body mass for 20 days to 1 month before euthanasia. One of these deer had diarrhea, the other had a crusting dermatitis on the nasal planum and inner aspects of both pinnae. The third hind did not have any signs of disease before it was found seizuring and was immediately euthanatized. Microscopically, all 3 animals had a lymphocytic vasculitis typical of malignant catarrhal fever (MCF), with the most severe lesions in the brain. All 3 deer were polymerase chain reaction (PCR) positive for caprine herpesvirus 2 (CpHV-2) and were negative for ovine herpesvirus 2 (OHV-2). Two healthy goats that were housed adjacent to the deer were also PCR positive for CpHV-2 and PCR negative for OHV-2. The CpHV-2, PCR amplicons from the hinds, and the 2 healthy goats had an identical single base polymorphism. A male sika deer that was housed with the hinds and a fawn from 1 of the hinds remained asymptomatic and were PCR negative for CpHV-2. This represents the first report of mortality with MCF-like lesions in association with CpHV-2. PMID:12661731

  16. Prevalence and molecular analyses of hemotrophic Mycoplasma spp. (hemoplasmas) detected in sika deer (Cervus nippon yesoensis) in Japan. (United States)

    Tagawa, Michihito; Matsumoto, Kotaro; Yokoyama, Naoaki; Inokuma, Hisashi


    Hemotropic mycoplasmas (hemoplasmas) are cell-wall deficient, epierythrocytic bacteria that cause infectious anemia in several mammalian species. The prevalence of hemoplasma species was examined by screening and species-specific PCR using blood samples collected from 51 sika deer in Hokkaido, Japan. Molecular analyses were performed for the 16S rRNA, 23S rRNA and RNase P RNA (rnpB) gene sequences. A total of 23/51 (45%) deer DNA samples were positive for hemoplasmas in the screening PCR. Using species-specific PCR, 12 and 17 samples were positive for 'Candidatus Mycoplasma haemocervae' and 'Candidatus M. erythrocervae', respectively. Sequencing and phylogenetic trees of those three genes indicate that the 'Candidatus M. haemocervae' and 'Candidatus M. erythrocervae' detected in Japanese deer are potentially different species from the cervine hemoplasma found in deer from America and Brazil. PMID:24270803

  17. Prevalence and Molecular Analyses of Hemotrophic Mycoplasma spp. (Hemoplasmas) Detected in Sika Deer (Cervus nippon yesoensis) in Japan


    TAGAWA, Michihito; MATSUMOTO, Kotaro; Yokoyama, Naoaki; INOKUMA, Hisashi


    ABSTRACT Hemotropic mycoplasmas (hemoplasmas) are cell-wall deficient, epierythrocytic bacteria that cause infectious anemia in several mammalian species. The prevalence of hemoplasma species was examined by screening and species-specific PCR using blood samples collected from 51 sika deer in Hokkaido, Japan. Molecular analyses were performed for the 16S rRNA, 23S rRNA and RNase P RNA (rnpB) gene sequences. A total of 23/51 (45%) deer DNA samples were positive for hemoplasmas in the screening...

  18. Response of the Rumen Microbiota of Sika Deer (Cervus nippon) Fed Different Concentrations of Tannin Rich Plants. (United States)

    Li, Zhipeng; Wright, André-Denis G; Liu, Hanlu; Fan, Zhongyuan; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu


    High throughput sequencing was used to examine the rumen microbiota of sika deer fed high (OLH) and low concentration (OLL) of tannin rich oak leaves. The results showed that Prevotella spp. were the most dominant bacteria. The most predominant methanogens were the members of the order Methanoplasmatales. The dominant rumen protozoa were Entodinium longinucleatum, Eudiplodinium maggii, and Epidinium caudatum, and the fungal communities were mostly represented by Piromyces spp. Moreover, the relative abundance of Pseudobutyrivibrio spp. (P=0.026), unidentified bacteria (P=0.028), and Prevotella spp. (P=0.022) was lower in the OLH group than in the OLL group. The concentration of propionate in the OLH group was greater than in the OLL group (P=0.006). Patterns of relationships showed that methanogens belonging to the order Methanoplasmatales were negatively correlated with Treponema spp., Ent. Longinucleatum, and acetate. Methanosphaera stadtmanae was positively correlated to propionate, while Methanobrevibacter ruminantium was negatively associated with Methanobrevibacter thaueri and Methanobrevibacter millerae. Tannins altered the rumen microbes and fermentation patterns. However, the response of the entire rumen microbiota and the relationship between rumen microorganisms and the fermentation parameters were not fully understood. PMID:25955033

  19. Collagen from Tendon of Yezo Sika Deer (Cervus nippon yesoensis) as By-Product


    Takeshi Nagai; Nobutaka Suzuki; Yasuhiro Tanoue; Norihisa Kai


    Collagen from tendon of Yezo sika deer was prepared by limited pepsin digestion. The yield of collagen was very high; 35.7% on the basis of lyophilized dry weight. The secondary structure of this collagen was different from that of porcine skin by ATR-FTIR analysis, although it was the same characteristics, e.g. SDS-PAGE, subunit composition, ther-mal behavior, as porcine collagen. Since taking up a problem of bovine spongiform encephalopathy infection in land animals such as calf or bovine, ...

  20. First Evidence that Sika Deer (Cervus nippon) Velvet Antler Extract Suppresses Migration of Human Prostate Cancer Cells. (United States)

    Tang, YuJiao; Jeon, Byong-Tae; Wang, Yanmei; Choi, Eun-Ju; Kim, Yon-Suk; Hwang, Jin-Woo; Park, Pyo-Jam; Moon, Sang Ho; Kim, Eun-Kyung


    Deer velvet antler (DVA) is one of the most popular medicines in China. Numerous studies have demonstrated that velvet antler possess biological effects. However, data regarding its anti-migration activity on prostate cancer is scarce. In this study, we investigated the inhibitory effect of top DVA (T-DVA) on the expression of prostate-specific antigen (PSA) and migration-related genes in the human prostate cancer cell, LNCaP. The T-DVA down-regulated the expression of PSA. In addition, the Radius(TM) assay revealed that T-DVA inhibited the migration behavior of prostate cancer cells. Furthermore, the expression of matrix metalloproteinase (MMP)-9 and vascular endothelial growth factor (VEGF) was also decreased with T-DVA. On the contrary, T-DVA increased the tissue inhibition of metalloproteinase (TIMP)-1 and (TIMP)-2. Taken together, our findings indicate that the T-DVA possesses anti-migration activity on prostate cancer cells. This is the first study of DVA to report the anti-migration activity on prostate cancer. PMID:26761873

  1. Gastrin-Releasing Peptide (GRP) in the Uteroplacenta of the Sika Deer (Cervus nippon)


    Junpei Kimura; JoonHyuk Sohn


    The localization of GRP in the uterus and/or placenta of non-pregnant or pregnant Sika deer was studied immunohistochemically. The strong immunoreactions were identified in the supra-nuclear region of the epithelial cells of the uterine glands of the placenta, however, no reaction was observed in the uterus of non-pregnant or immature animals. GRP may play an important role as the critical signals or nutrients for the growth of fetus in the synepitheliochorial placenta.

  2. Seroprevalence and risk factors of Toxoplasma gondii infection in domestic sika deer (Cervus nippon) in northeastern China. (United States)

    Qin, Si-Yuan; Zhang, Xiao-Xuan; Cong, Wei; Zhou, Dong-Hui; Wang, Jin-Lei; Yin, Ming-Yang; Tan, Qi-Dong; Zhao, Quan; Zhu, Xing-Quan


    Toxoplasmosis is a worldwide zoonosis caused by Toxoplasma gondii, which can infect warm-blooded animals and humans. A serological survey was undertaken to examine the seroprevalence and risk factors associated with T. gondii infection in sika deer in northeastern China. 114 (13.46%, 95% CI 11.16-15.76) out of 847 serum samples were positive to T. gondii by modified agglutination test (MAT) at a 1:25 cut-off, with titers of 1:25 in 44, 1:50 in 32, 1:100 in 17, 1:500 in 11, 1:1500 or higher in 10. These samples were collected between November 2012 and October 2013 from Inner Mongolia, Jilin and Heilongjiang provinces in China. However, statistically significant differences were not observed between T. gondii seroprevalence and genders or regions of sika deer in the logistic regression analysis (P>0.05) and left out of the final model. Seroprevalence of T. gondii infection in male sika deer was 14.07% (95% CI 11.14-17.01), slightly higher than that in the female (12.38%) (95% CI 8.69-16.06) and seroprevalence of T. gondii infection in Harbin, Changchun city, Jilin city and Chifeng city were 12.02% (95% CI 7.60-16.44), 15.51% (95% CI 11.52-19.50), 12.27% (95% CI 7.23-17.31) and 12.50% (95% CI 7.38-17.63), respectively. Seasons of sampling were considered as main risk factors associated with T. gondii infection, autumn (15.32%) were more than two times (OR=1.98, 95% CI=1.18-3.33, P=0.01) at risk of acquiring T. gondii infection compared to winter (8.37%). Our results indicated a widespread exposure to T. gondii among sika deer in China. To our knowledge, this is the first report of T. gondii seroprevalence in sika deer in China. PMID:25201489

  3. Detection of Lyme disease spirochetes in the skin of naturally infected wild sika deer (Cervus nippon yesoensis) by PCR.


    Kimura, K.; Isogai, E; Isogai, H; Kamewaka, Y; Nishikawa, T.; Ishii, N; Fujii, N


    We demonstrated the presence of Borrelia burgdorferi sensu lato DNA in the skin tissues of naturally infected wild sika deer, using PCR. The risk of transmission of B. burgdorferi sensu lato is recognized in sika deer.

  4. Response of the Rumen Microbiota of Sika Deer (Cervus nippon) Fed Different Concentrations of Tannin Rich Plants


    Li, Zhipeng; Wright, André-Denis G.; Liu, Hanlu; Fan, Zhongyuan; Yang, Fuhe; Zhang, Zhigang; Li, Guangyu


    High throughput sequencing was used to examine the rumen microbiota of sika deer fed high (OLH) and low concentration (OLL) of tannin rich oak leaves. The results showed that Prevotella spp. were the most dominant bacteria. The most predominant methanogens were the members of the order Methanoplasmatales. The dominant rumen protozoa were Entodinium longinucleatum, Eudiplodinium maggii, and Epidinium caudatum, and the fungal communities were mostly represented by Piromyces spp. Moreover, the r...

  5. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.


    Roč. 51, č. 3 (2002), s. 253-256. ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002

  6. Co-phylogeography and morphological evolution of sika deer lice (Damalinia sika) with their hosts (Cervus nippon)


    Mizukoshi, Atsushi; Johnson, Kevin P.; Yoshizawa, Kazunori


    Lice are obligate parasites of mammals and birds and have become an important model for studies of host-parasite co-evolution and co-phylogenetics. Population genetic and phylogeographic studies represent an important bridge between microevolution and co-phylogenetic patterns. We examine co-phylogeographic patterns in sika deer and their parasitic lice. Co-phylogeographic patterns in deer and lice were evaluated using homologous regions of mitochondrial COI sequences. The phylogeographic brea...

  7. Co-phylogeography and morphological evolution of sika deer lice (Damalinia sika) with their hosts (Cervus nippon). (United States)

    Mizukoshi, Atsushi; Johnson, Kevin P; Yoshizawa, Kazunori


    Lice are obligate parasites of mammals and birds and have become an important model for studies of host-parasite co-evolution and co-phylogenetics. Population genetic and phylogeographic studies represent an important bridge between microevolution and co-phylogenetic patterns. We examine co-phylogeographic patterns in sika deer and their parasitic lice. Co-phylogeographic patterns in deer and lice were evaluated using homologous regions of mitochondrial COI sequences. The phylogeographic breaks recovered for deer populations matched those of previous studies. Comparisons of the phylogeographic tree topology for deer lice with that of their hosts revealed a significant level of congruence. However, comparisons of genetic distances between deer and lice suggested that one of the estimated co-divergence events is more likely a recent host switch. Taking into account genetic divergence, there is not strong evidence for complete phylogeographic co-divergence between deer and their parasitic lice. However, mitochondrial phylogenies only track genetic structure of female lineages, and the incongruence between deer and louse phylogeography may be explained by louse migration mediated by male deer. Morphological analysis of head shape variation based on an elliptic Fourier descriptor showed that overall morphological variation contained phylogenetic signal, suggesting that in general morphology of these lice evolves congruent to population history. PMID:22835817

  8. [Blood biological constants in the deer Rusa (Cervus timorensis russa) in New-Caledonia. I. Hematologic constants]. (United States)

    Audigé, L


    Since the beginning of year 1987, the deer "Rusa" breeding has been developing in New Caledonia. In 1988, during a slaughter operation amidst the herds, nearly ninety blood samples were collected in order to define the blood biological parameters (or constants) of this species. Regarding haematology, the study concerns the following parameters: erythrocyte count (9.32 x 10(12)/l), leucocyte count (4.51 x 10(9)/l), various leucocyte lines and their formula, i.e. (neutrophile polymorphonuclear: 2.08 x 10(9)/l [46.6 p. 100]; lymphocytes: 1.75 x 10(9)/l [38.4 p. 100]; monocytes: 0.33 x 10(9)/l [7.5 p. 100]; eosinophiles polymorphonuclear leucocytes: 0.4 x 10(9)/l [7.46 p. 100]; basophile polymorphonuclear leucocytes: 0.01 x 10(9)/l [0.28 p. 100]), hematocrite (36.8 l/l), hemoglobin ratio (14.1 g/dl), mean corpuscular volume (40.3 dl), mean corpuscular hemoglobin rate (15.3 pg/cell), mean corpuscular hemoglobin concentration (38.7 g/dl). In the course of the study, variations of these parameters were detected according to various physiological criteria and to the sampling conditions as deer is a stress sensitive animal. PMID:2218039

  9. [Blood biological constants in the deer Rusa (Cervus timorensis russa) in New-Caledonia. II. Biological constants]. (United States)

    Audigé, L


    Since the beginning of the year 1987, the deer "Rusa" breeding has been developing in New Caledonia. In 1988, during a slaughter operation in the herds, nearly 90 blood samples were collected in order to define the blood biological parameters (or constants) of this species. As for biochemistry, the following parameters have been search for: urea (6.8 mmol/l), creatinin rate (151.7 mmol/l), the activity of the creatin kinase (295.2 U/l), transaminase (ALAT: 60.1 UI/l; ASAT: 22.3 UI/l) and alcalin phosphatases (115.1 U/l), total bilirubin rate (2.76 mumol/l), total proteins rate (61.4 g/l) and albumin (32.6 g/l), calcium (2.42 mmol/l) and phosphorus (3.08 mmol/l). In course of the study, fluctuations of these parameters were detected, according to various criteria and to sampling conditions. PMID:2218040

  10. Role of Rusa deer Cervus timorensis russa in the cycle of the cattle tick Boophilus microplus in New Caledonia. (United States)

    Barré, N; Bianchi, M; Chardonnet, L


    Two field experiments were conducted to evaluate the efficiency of Rusa deer in the development of the cattle tick Boaphilus microplus in comparison with that of steers in the same pastures and under the same conditions of infestation. No difference was noted between a mixed steer/deer herd and a pure steer or pure deer herd in the infestation pattern of each host, suggesting that attachment to the alternative host is mechanical and not affected by the simultaneous presence of the primary host on the pasture. Deer are capable of producing engorged viable females, with weight and reproductive performances similar to or even better than females fed on steers. For moderate levels (1 million larvae per hectare) and high levels (32 million larvae per hectare) of pasture infestation, tick burdens on steers were not very different (e.g. average 1,911 and 2,681 ticks per m2 skin, respectively, on day 24). This may be because of saturation of steer skin sites at the moderate larval dose. Deer harboured 2.7-33 times fewer ticks than steers and produce no engorged females at the moderate larval level and 32 times fewer engorged females than steers at the high larval level. Infestation of deer was dose-dependent with averages of 12 and 399 ticks per m2 skin on day 25 at the moderate and high larval levels, respectively. At a high infestation level of the environment, Rusa deer may contribute, but to a limited extent, to infestation of pastures and, consequently, of cattle. However, their role in sustaining a viable tick population requires further investigation. PMID:11508531

  11. Dybowski’s sika deer (Cervus nippon hortulorum): genetic divergence between natural Primorian and introduced Czech populations

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Voloshina, I.; Myslenkov, A.; Lamka, J.; Koubek, Petr


    Roč. 104, č. 3 (2013), s. 312-326. ISSN 0022-1503 R&D Projects: GA ČR GA524/09/1569 Institutional support: RVO:68081766 Keywords : bottleneck * founder effect * genetic diversity * inbreeding * microsatellites * mtDNA Subject RIV: GI - Animal Husbandry ; Breeding Impact factor: 1.969, year: 2013

  12. 采用PCR-CE-SSCP技术快速筛查梅花鹿产品的鹿种真伪%PCR-CE-SSCP used to authenticated the origin of C.nippon products

    Institute of Scientific and Technical Information of China (English)

    吴亚君; 韩建勋; 王斌; 钟振宇; 陈颖


    By-product derived from C.nippon was applied as a kind of important material for functional food. However frequent adulteration of C.nippon products with other biological materials not only infringe consumer but also negatively affect the whole industry. At present gene detection technology has been widely used in food and drug detection. Nevertheless research on identifying different deer species was seldom found. In this article PCR-CE-SSCP was reported to detect various deer species including C.nippon, C.elaphus etc with only one primer pair, which exceeds PCR method in terms of simplicity of reaction system. The method was proved to be highly specific, sensitive and reproductive and was suitable for rapid supervision of market.%梅花鹿副产品是重要的保健品原料,但市场中造假掺假商业欺诈行为屡屡发生,损坏消费者利益的同时给产业的发展带来负面影响。目前基因检测技术在食品药品物种鉴定领域得到广泛应用,但针对不同鹿种的真伪检测报道不多。研究采用的PCR—CE—SSCP技术突破了单纯PCR方法对引物探针体系的要求,仅通过一对引物便可检测到梅花鹿、马鹿、麋鹿等不同的品种,方法特异性强,重现性好,灵敏度高,很适合市场快速筛查。

  13. [Occurrence of Giardia species and genotypes in humans and animals in Wielkopolska region, Poland]. (United States)

    Solarczyk, Piotr


    5 animal species. Giardia cysts were found only in faecal samples from humans living in Poznań and the samples obtained from animals coming from Poznań and around Puszczykowo. The highest frequency of infection was stated in domestic animals (2.5%) and in animals kept in the Zoological Garden (2.0%), whereas a slightly lower frequency was noticed in wild animals (1.5%) and in humans (1.3%). No Giardia cysts were found in the faecal samples collected from breeding animals. Two new species of Giardia hosts were identified, namely Rhinella marina and Peromyscus eremicus; however, due to a minimal amount of faecal samples supplied for the study it was impossible to define the species and genotype of this parasite. PCR products (the partial of beta-giardin gene) were obtained in seven faecal samples out of the ten studied, including three samples from people and four faecal samples derived from three animal species (i.e. dog, tamandua, red deer). Moreover, molecular characterization of seven Giardia isolates from three persons and four animal species (red-bellied monkey, silver marmoset, Thomson's gazelle, and sheep) kept in an axenic in vitro culture was performed. Based on the beta-giardin sequence fragment analysis, four assemblages of G. intestinalis genotypes were identified (A, B, C and D). In humans, A and B G. intestinalis genotypes and three subgenotypes, including a cosmopolitan subgenotype A2 and two new subgenotypes A and B were detected. Furthermore, four G. intestinalis genotypes were found in animals, including three genotypes which are non-infectious to humans, namely: genotypes C and D in dogs and a cervids-specific genotype A in red deer (Cervus elaphus), which indicate that these animals do not constitute the source of infection to humans. On the other hand, in a tamandua from the Zoological Garden in Poznań a new subgenotype B of G. intestinalis was identified, which due to a close relationship with Giardia isolates obtained from humans is

  14. Reducing Reliance on Supplemental Winter Feeding in Elk (Cervus canadensis): An Applied Management Experiment at Deseret Land and Livestock Ranch, Utah


    Mangus, Dax L


    Wildlife managers have fed elk in North America for nearly 100 years. Giving winter feed to elk can compensate for a shortage of natural winter range and may boost elk populations while also helping prevent commingling with livestock and depredation of winter feed intended for livestock. In contrast to these benefits of supplemental feeding, there are economic and environmental costs associated with feeding, and elk herds that winter on feeding grounds have a higher risk of contracting and ...

  15. Influence of human activities on the activity patterns of Japanese sika deer (Cervus nippon) and wild boar (Sus scrofa) in Central Japan

    NARCIS (Netherlands)

    Doormaal, van N.; Ohashi, H.; Koike, S.; Kaji, K.


    Human ageing and population decline in Japan are causing agricultural field abandonment and providing new habitats for Japanese sika deer and wild boar. These species have expanded their distribution and increased in abundance across Japan and are causing increased agricultural damage. Effective cou

  16. Dexamethasone-induced recrudescence of malignant catarrhal fever and associated lymphosarcoma and granulomatous disease in a Formosan sika deer (Cervus nippon taiouanus). (United States)

    Heuschele, W P; Nielsen, N O; Oosterhuis, J E; Castro, A E


    Malignant catarrhal fever (MCF) was diagnosed in a 2-week-old Formosan sika deer. The fawn had been previously exposed to a clinically normal neonatal wildebeest calf from which alcelaphine herpesvirus-1 was isolated. Alcelaphine herpesvirus-1 was isolated from buffy coat leukocytes and nasal and ocular secretions of the fawn during the acute illness. The fawn clinically recovered after 3 weeks. Virus was not recovered from blood at this time. Dexamethasone, given 4 months after clinical recovery, resulted in reisolation of MCF virus from blood and recrudescence of clinical MCF. The deer was euthanatized. At necropsy, pathognomonic lesions of MCF, granulomatous disease, and malignant lymphoma were observed. Antibodies to bovine leukosis viral antigens were not detected in the serum. The epidemiologic and pathogenetic importance of the findings are discussed. PMID:3839641

  17. Accessory corpora lutea formation in pregnant Hokkaido sika deer (Cervus nippon yesoensis) investigated by examination of ovarian dynamics and steroid hormone concentrations. (United States)

    Yanagawa, Yojiro; Matsuura, Yukiko; Suzuki, Masatsugu; Saga, Shin-Ichi; Okuyama, Hideto; Fukui, Daisuke; Bando, Gen; Nagano, Masashi; Katagiri, Seiji; Takahashi, Yoshiyuki; Tsubota, Toshio


    Generally, sika deer conceive a single fetus, but approximately 80% of pregnant females have two corpora lutea (CLs). The function of the accessory CL (ACL) is unknown; moreover, the process of ACL formation is unclear, and understanding this is necessary to know its role. To elucidate the process of ACL formation, the ovarian dynamics of six adult Hokkaido sika deer females were examined ultrasonographically together with peripheral estradiol-17β and progesterone concentrations. ACLs formed in three females that conceived at the first estrus of the breeding season, but not in those females that conceived at the second estrus. After copulation, postconception ovulation of the dominant follicle of the first wave is induced by an increase in estradiol-17β, which leads to formation of an ACL. A relatively low concentration of progesterone after the first estrus of the breeding season is considered to be responsible for the increase in estradiol-17β after copulation. PMID:25482110

  18. Accessory corpora lutea formation in pregnant Hokkaido sika deer (Cervus nippon yesoensis) investigated by examination of ovarian dynamics and steroid hormone concentrations


    YANAGAWA, Yojiro; Matsuura, Yukiko; Suzuki, Masatsugu; SAGA, Shin-ichi; OKUYAMA, Hideto; FUKUI, Daisuke; BANDO, Gen; NAGANO, Masashi; Katagiri, Seiji; Takahashi, Yoshiyuki; TSUBOTA, Toshio


    Generally, sika deer conceive a single fetus, but approximately 80% of pregnant females have two corpora lutea (CLs). The function of the accessory CL (ACL) is unknown; moreover, the process of ACL formation is unclear, and understanding this is necessary to know its role. To elucidate the process of ACL formation, the ovarian dynamics of six adult Hokkaido sika deer females were examined ultrasonographically together with peripheral estradiol-17β and progesterone concentrations. ACLs formed ...

  19. Effect of supplementation of lysine and methionine on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer (Cervus Nippon) fed protein deficient diet


    Jian Huang; Tie-Tao Zhang; Bao Kun; Guang-Yu Li; Kai-Ying Wang


    This study was conducted to investigate the effect of supplementation of lysine (Lys) and methionine (Met) on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer fed crude protein (CP) deficient diet. Sixteen 5-month-old growing male sika deer were randomly assigned to 4 groups receiving diets (n=4): i) CP-adequate (16.63%) diet; ii) CP-deficient (13.77%) diet with 3 g/kg Lys; iii) CP-deficient with 3 g/kg Lys and 1 g/kg Met; iv) CP-deficient diet w...

  20. Sex and age differences in meat composition of Yeso sika deer (Cervus nippon yesoensis) reared for a short period after capture in the wild. (United States)

    Hayashida, Maki; Souma, Kousaku; Sugo, Kazuki; Araki, Shin-Ichi; Ishizaka, Fumiaki; Ueda, Masami; Kasai, Takamasa; Masuko, Takayoshi


    Yeso sika deer captured in winter around Lake Akan in Hokkaido were reared for 8-10 months at Tokyo University of Agriculture in Abashiri. Six 1-year-old females and males and six 2-year-old or older (adult) females and males were slaughtered and their carcasses were processed. The chemical composition, mineral contents and fatty acid composition of the loin were measured. No marked influence of gender or age was noted in the chemical composition of loin. In the mineral contents, significant differences were noted. The potassium and sulfur contents were lower and the sodium content was higher in adult deer meat (P < 0.05, respectively) and the potassium content was higher in male deer meat (P < 0.05). Arsenic, cadmium or lead were not detected. In the unsaturated fatty acid, a significant interaction was detected (P < 0.05), and it was high in 1-year-old female deer meat and low in 1-year-old male deer meat. Significant gender or age differences were noted only in the mineral contents in the loin of deer reared for a short period after capture. PMID:25186458

  1. Classification and phylogeny of sika deer (Cervus nippon) subspecies based on the mitochondrial control region DNA sequence using an extended sample set. (United States)

    Ba, Hengxing; Yang, Fuhe; Xing, Xiumei; Li, Chunyi


    To further refine the classification and phylogeny of sika deer subspecies, the well-annotated sequences of the complete mitochondrial DNA (mtDNA) control region of 13 sika deer subspecies from GenBank were downloaded, aligned and analyzed in this study. By reconstructing the phylogenetic tree with an extended sample set, the results revealed a split between Northern and Southern Mainland Asia/Taiwan lineages, and moreover, two subspecies, C.n.mantchuricus and C.n.hortulorum, were existed in Northern Mainland Asia. Unexpectedly, Dybowskii's sika deer that was thought to originate from Northern Mainland Asia joins the Southern Mainland Asia/Taiwan lineage. The genetic divergences were ranged from 2.1% to 4.7% between Dybowskii's sika deer and all the other established subspecies at the mtDNA sequence level, which suggests that the maternal lineage of uncertain sika subspecies in Europe had been maintained until today. This study also provides a better understanding for the classification, phylogeny and phylogeographic history of sika deer subspecies. PMID:24063645

  2. An examination of the origin and evolution of additional tandem repeats in the mitochondrial DNA control region of Japanese sika deer (Cervus Nippon). (United States)

    Ba, Hengxing; Wu, Lang; Liu, Zongyue; Li, Chunyi


    Tandem repeat units are only detected in the left domain of the mitochondrial DNA control region in sika deer. Previous studies showed that Japanese sika deer have more tandem repeat units than its cousins from the Asian continent and Taiwan, which often have only three repeat units. To determine the origin and evolution of these additional repeat units in Japanese sika deer, we obtained the sequence of repeat units from an expanded dataset of the control region from all sika deer lineages. The functional constraint is inferred to act on the first repeat unit because this repeat has the least sequence divergence in comparison to the other units. Based on slipped-strand mispairing mechanisms, the illegitimate elongation model could account for the addition or deletion of these additional repeat units in the Japanese sika deer population. We also report that these additional repeat units could be occurring in the internal positions of tandem repeat regions, possibly via coupling with a homogenization mechanism within and among these lineages. Moreover, the increased number of repeat units in the Japanese sika deer population could reflect a balance between mutation and selection, as well as genetic drift. PMID:24621225

  3. Bioimformatic Analysis on GHR Gene of Cervus nippon%梅花鹿GHR基因完整编码区序列生物信息学分析

    Institute of Scientific and Technical Information of China (English)

    宋兴超; 杨福合; 巴恒星; 邢秀梅; 魏海军


    为了研究梅花鹿生长激素受体基因的结构和功能,从GenBank中下载梅花鹿、牛、山羊、猪、北极狐、大熊猫、人、猕猴、小鼠、大鼠、鸡、家鹅、绿头野鸭及金鱼的生长激素受体基因完整编码区及氨基酸序列,对梅花鹿与其他13个物种生长激素受体基因的完整编码区及其编码氨基酸序列进行相似性比对,并基于氨基酸序列构建系统进化树,利用BioEdit 7.0等软件对梅花鹿生长激素受体基因的碱基组成及其编码蛋白的理化性质和结构特征进行生物信息学分析.结果表明,梅花鹿与山羊、牛的生长激素受体基因氨基酸序列相似性较高,亲缘关系最近;梅花鹿生长激素受体基因完整编码区长度为1 905bp,编码634个氨基酸,A+T含量高于G+C;其编码的蛋白是一种分子质量为70.927 8ku、等电点为4.56的疏水性不稳定酸性蛋白;该蛋白含有1个信号肽,属于一种分泌型蛋白;存在1个强跨膜区、36个广泛磷酸化位点,二级结构元件以无规则卷曲为主.研究结果可为梅花鹿生长激素受体基因的进一步分析提供详细的生物信息学基础资料.%In order to study the structure and function of GHR gene of sika deer, coding sequences(CDS)of GHR gene in sika deer, cattle, goat, pig,arctic fox,giant panda,human,macaque, house mouse,norway rat,chicken,goose,mallard and goldfish were downloaded from GenBank as experimental materials. The similarity of GHR gene CDS and amino acid sequence between sika deer and other 13 species were analyzed. Phylo-genetic tree of the homologous gene based on the amino acid of GHR gene was constructed. In addition, we made bioinformatic analysis on basic information and encoding protein structure and physic - chemical property were predicted by means of biological software and online took.The results showed that the similarity comparison and phylogeneb'c tree indicated that the evolution distance of sika deer GHR gene was the most homogeneous to goat and cattle.The length of GHR gene coding sequence in sika deer is 1 905 bp, which encodes 634 amino acids.The estimated molecular weight of GHR protein is 70.927 8 ku.with an isoelectric point of 4.56 and 52.79 in instability index, belonging to the unstable acid protein with hydrophobieity. The GHR protein contained one signal peptide was probably being secreting type.The GHR protein had 1 obvious strong transmembrane region,36 phosphorylation sites.The secondary structure of GHR protein was mainly random coil.The research provides detailed bioinformatic informations for further study on GHR gene of sika deer.

  4. Effect of supplementation of lysine and methionine on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer (Cervus Nippon fed protein deficient diet

    Directory of Open Access Journals (Sweden)

    Jian Huang


    Full Text Available This study was conducted to investigate the effect of supplementation of lysine (Lys and methionine (Met on growth performance, nutrients digestibility and serum biochemical indices for growing sika deer fed crude protein (CP deficient diet. Sixteen 5-month-old growing male sika deer were randomly assigned to 4 groups receiving diets (n=4: i CP-adequate (16.63% diet; ii CP-deficient (13.77% diet with 3 g/kg Lys; iii CP-deficient with 3 g/kg Lys and 1 g/kg Met; iv CP-deficient diet with 3 g/kg Lys and 2 g/kg Met. The digestibility of dry matter P<0.01, organic matter (P<0.01, CP (P<0.01, serum albumin (P<0.01, and total protein (P<0.01 concentrations of groups receiving CP-adequate or Met supplementation were improved. The average daily gain (P=0.10, gain to feed ratio (P=0.07, the digestibility of acid (P=0.07 and neutral detergent fibre (P=0.09, and the serum globulin (P=0.08 concentrations had a tendency to increase as the Met or CP level increased. Meanwhile, blood urea nitrogen (P<0.01 and alanine aminotransferase (P<0.01 were decreased for CP-deficient, but no response to Met-added diets; aspartate aminotransferase (P=0.04 depressed for both CP-deficient and Met-added diets. Therefore, amino acids added to CP-deficient diets show high efficiency: they remain among the simplest ways for growth performance, while cutting down environmental waste and economic consumption.

  5. Viability of Timor deer stag (Cervus timorensis spermatozoa extended in tris egg yolk diluent with different sources of carbohydrate and storage at room temperature

    Directory of Open Access Journals (Sweden)

    W. Marlene Mesang-Nalley


    Full Text Available The successful sperm preservation, influenced by the capability of its extender on the maintenance the sperm quality during storage. The carbohydrate such as glucose and fructose were the common sugar added on the mammalian sperm extender to support their live and motility. The sucrose was the main carbohydrate in Timor deer stag seminal plasma. The experiment was conducted to evaluate the effect of carbohydrates in Tris egg yolk (TEY extender on the motility and viability of stag sperm, stored in room temperature (27-28 oC. The semen was collected using electro ejaculator from five Timor deer stags at hard antler stage, 3-5 years old, body weight of 64-102 kg with normal testes. The semen was than evaluated macro-and microscopically and divided into 3 aliquots. Each of them was diluted with TEY-glucose (TEYG, TEY-fructose (TEYF and TEY-Sucrose (TEYS with the concentration of spermatozoa 100 x 106 ml-1. The extended semen was than stored at room temperature. The sperm motility and viability were evaluated every 3 hours. Result of the experiment showed that the semen volume was 2.06 ± 0.63 ml, pH 7.03±0.13, yellow white until creamy in color and the consistency ranged from normal to thick. The mass movement between ++ to +++ and the sperm motility was 68.67 ± 7.4%. The average of sperm concentration was 842.35 ± 258.14x106 ml-1, the viable sperm was 78.11 ± 3.61%, the sperm abnormality was 7.31 ± 2.98%. The percentages of sperm motility on TEYG (18.00 ± 17.63% and TEYS (21.83 ± 15.92% were higher compare to TEYF (4,00 ± 0,00% extender in 24 hours observation. The percentage of sperm viability showed the same pattern. The sperm viability in TEYG (28.17 ± 20.06 and TEYS (24.00 ± 22.59% (P<0.05 were significantly higher compare to TEYF (4.00 ± 0.00%. It is concluded that the deer stag sperm can use the three sugars for their nutrition source. The diluted sperm still can be used for artificial insemination after 12 hour storage.

  6. Viability of Timor deer stag (Cervus timorensis) spermatozoa extended in tris egg yolk diluent with different sources of carbohydrate and storage at room temperature



    The successful sperm preservation, influenced by the capability of its extender on the maintenance the sperm quality during storage. The carbohydrate such as glucose and fructose were the common sugar added on the mammalian sperm extender to support their live and motility. The sucrose was the main carbohydrate in Timor deer stag seminal plasma. The experiment was conducted to evaluate the effect of carbohydrates in Tris egg yolk (TEY) extender on the motility and viability of stag sperm, ...

  7. Exploration of the taxonomy of some Pleistocene Cervini (Mammalia, Artiodactyla, Cervidae) from Java and Sumatra (Indonesia): a geometric- and linear morphometric approach (United States)

    Gruwier, Ben; de Vos, John; Kovarovic, Kris


    Third molars of extant- and fossil Southeast Asian deer were metrically compared using a linear- and geometric morphometric approach and discussed in relation to known taxonomic information from the literature. Our analysis suggests the presence of medium sized deer of the genus Axis and large sized taxa of the genus Cervus s. l. in Java. Axis lydekkeri and Axis javanicus are considered valid taxa, with A. lydekkeri probably related to the subgenus Hyelaphus. The large deer, such as Cervus kendengensis, Cervus stehlini and Cervus problematicus are most likely of the subgenus Rusa, the former two closely related to extant Cervus timorensis. The Sumatran fossils are members of the subgenus Rusa, but not necessarily conspecific with extant Cervus (Rusa) unicolor.

  8. Identification by R-banding and FISH of chromosome arms involved in Robertsonian translocations in several deer species


    Bonnet-Garnier, Amelie; Claro, F.; Thevenon, S.; Gautier, Mathieu; Hayes, Hélène


    We constructed and analyzed the RBG-banded karyotype of ¢ve deer species: Chital (Axis axis), White-lipped deer (Cervus albirostris), Rusa deer (Cervus timorensis russa), Sambar deer (Cervus unicolor) and Eld’s deer (Cervus eldi siamensis). Among these ¢ve species, only Eld’s deer had been previously karyotyped using R-banding. In order to identify all the chromosome correspondences with cattle and precisely which chromosome arms are involved in Robertsonian translocations, we compared the ka...

  9. Výskyt jelena siky (Cervus nippon) v České republice a vyhodnocení orientace škod se zaměřením na Náchodsko


    Regnerová, Kateřina


    This Bachelor degree paper deals with the occurrence of sika deer, damages that causes and magnetism problem of these animals together. It is based on the observation of the damages and the sleeping beds of the deer game. Recently questions concerning magnetism are often discussed. Are animals really sensitive to the earth´s magnetic field ? Are they able to feel and use it for their orientation for example? These and other questions are discussed based on the observations already performed a...

  10. Genetic roots of sika deer in the Czech Republic inferred from mitochondrial gene for cytochrome b

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Vallo, Peter; Prokešová, Jarmila; Koubek, Petr

    Primiero : Parco Naturale Paneveggio, 2007. s. 68. [International conference on genus Cervus 2007 /1./. 14.09.2007-17.09.2007, Primiero] R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon * cytochrome b * genetic origin Subject RIV: EB - Genetics ; Molecular Biology

  11. Lymphoproliferation in captive wild ruminants affected with malignant catarrhal fever: 25 cases (1977-1985). (United States)

    Blake, J E; Nielsen, N O; Heuschele, W P


    The severity of lymphoproliferative disease associated with malignant catarrhal fever was extremely variable among 25 animals at the San Diego Wild Animal Park. Severe lymphoproliferative disease was seen in 3 of 10 Formosan Sika deer (Cervus nippon taiouanus), 3 of 6 Indian Axis deer (Cervus a axis), 3 of 6 Barasingha deer (Cervus d duvauceli), and 1 of 3 Nilgai (Boselaphus tragocamelus). Two Sika deer and 2 Barasingha deer had lesions morphologically indistinguishable from lymphosarcoma. Our findings were consistent with the hypothesis that alcelaphine herpesvirus-1 has oncogenic potential. PMID:2329087

  12. Environ: E00319 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00319 Deer velvet Crude drug Collagen, Calcium phosphate, alcium carbonate , Prote...TAX:9865] Cervidae Cervus nippon and Manchurian wapiti velvet Crude drugs [BR:br08305] Animals Mammals E00319 Deer velvet ...

  13. Food Habits of St. Vincent Island Sambars and Hogs (United States)

    US Fish and Wildlife Service, Department of the Interior — Sambar deer Cervus unicolor and feral hogs Sus scrofs coninhabit St. Vincent Island, Florida. Rumen samples were analyzed to assess the dietary overlap of the two...

  14. 鹿瓜多肽注射液对去卵巢大鼠骨密度及松质骨中骨形态发生蛋白表达的影响%Influence of cervus and cucumis polypeptide injection on expression of bone morphogenetic proteins-2 in cancellated bone and bone mineral density of ovariectomized rats

    Institute of Scientific and Technical Information of China (English)

    段永宏; 刘建; 胡蕴玉; 郭飞; 李强; 袁志; 孟国林


    目的 探讨鹿瓜多肽(松梅乐)注射液肌肉注射对去卵巢大鼠骨密度及松质骨中骨形态发生蛋白(BMP2)表达的影响.方法 将8月龄未经产雌性二级SD大鼠30只,随机分为假手术(SHAM)组、去势(VOX)组、去势+鹿瓜多肽(VOX+SML)组.VOX+SML组大鼠术后第2天开始给药.术后20周处死各组大鼠,对各组大鼠骨密度进行检测.利用免疫组织化学染色及图像分析方法对各组大鼠松质骨切片图像进行灰度分析,观察鹿瓜多肽注射对去势大鼠腰椎松质骨中BMP2表达的影响.结果 ①去势组与SHAM组相比较,灰度值降低,而(VOX+SML)治疗组较VOX组灰度值降低,表明VOX大鼠松质骨中骨小梁周围及髓腔内BMP2表达阳性细胞数明显多于SHAM组;而(VOX+SML)治疗组骨小梁周围及髓腔内BMP2表达阳性细胞数多于VOX组,且染色加深.②与SHAM组相比,VOX组股骨近端、股骨干、腰椎的骨密度明显降低(P<0.01);(VOX+SML)治疗组各部位的骨密度高于VOX组(P<0.05),但未达到SHAM组水平(P>0.05).结论 鹿瓜多肽注射液可抑制和延缓骨质疏松形成,对雌激素缺乏引起的骨质疏松具有预防作用.

  15. Identification by R-banding and FISH of chromosome arms involved in Robertsonian translocations in several deer species. (United States)

    Bonnet-Garnier, A; Claro, F; Thévenon, S; Gautier, M; Hayes, H


    We constructed and analyzed the RBG-banded karyotype of five deer species: Chital (Axis axis), White-lipped deer (Cervus albirostris), Rusa deer (Cervus timorensis russa), Sambar deer (Cervus unicolor) and Eld's deer (Cervus eldi siamensis). Among these five species, only Eld's deer had been previously karyotyped using R-banding. In order to identify all the chromosome correspondences with cattle and precisely which chromosome arms are involved in Robertsonian translocations, we compared the karyotypes of these five species with those of the closely related and well-characterized species, cattle (Bos taurus) and Vietnamese Sika deer (Cervus nippon pseudaxis). Among these six deer species (the five above plus the Vietnamese Sika deer), we found thirteen different Robertsonian translocations involving nineteen different chromosome arms. Thirteen chromosome arms were identified by comparison of R-banding patterns only and the remaining six were either confirmed or identified by FISH-mapping of bovine or caprine probes previously localized in cattle. Finally, we observed that five of the thirteen Robertsonian translocations are shared by at least two species and that some chromosome arms are more frequently involved in Robertsonian translocations than others. PMID:14606627

  16. Development of multiplex PCR assay for authentication of Cornu Cervi Pantotrichum in traditional Chinese medicine based on cytochrome b and C oxidase subunit 1 genes. (United States)

    Gao, Lijun; Xia, Wei; Ai, Jinxia; Li, Mingcheng; Yuan, Guanxin; Niu, Jiamu; Fu, Guilian; Zhang, Lihua


    This study describes a method for discriminating the true Cervus antlers from its counterfeits using multiplex PCR. Bioinformatics were carried out to design the specific alleles primers for mitochondrial (mt) cytochrome b (Cyt b) and cytochrome C oxidase subunit 1 (Cox 1) genes. The mt DNA and genomic DNA were extracted from Cervi Cornu Pantotrichum through the modified alkaline and the salt-extracting method in addition to its counterfeits, respectively. Sufficient DNA templates were extracted from all samples used in two methods, and joint fragments of 354 bp and 543 bp that were specifically amplified from both of true Cervus antlers served as a standard control. The data revealed that the multiplex PCR-based assays using two primer sets can be used for forensic and quantitative identification of original Cervus deer products from counterfeit antlers in a single step. PMID:26287950

  17. Dry season diets of sympatric ungulates in lowland Nepal: competition and facilitation in alluvial tall grasslands

    NARCIS (Netherlands)

    Wegge, P.; Shrestha, A.K.; Moe, S.R.


    Based on microhistological analyses of faecal material, we compared the early dry season diets of greater one-horned rhinoceros Rhinoceros unicornis, swamp deer Cervus duvauceli and hog deer Axis porcinus, which inhabit the same alluvial grassland habitat complex in lowland Nepal. Their diets were q

  18. Application of mitochondrial DNA sequence analysis in the forensic identification of Chinese sika deer subspecies. (United States)

    Wu, Hua; Wan, Qiu-Hong; Fang, Sheng-Guo; Zhang, Shu-Yan


    As a direct and indirect consequence of human activities, only two subspecies, Cervus nippon sinchuanicus and Cervus nippon kopschi, currently subsist in the wild of China. However, a large population of Cervus nippon hortulorum and Cervus nippon nippon is raised in order to gain deer parts for Chinese traditional medicine. According to Chinese Wild Animal Conservation Law, hunting, capturing and trading of the wild sika deer are strictly banned, however, raising and trading of the domestic individual are permitted. Thus, it is very necessary to identify the subspecies of sika deer in China in forensic tests. In our study, we used mitochondrial DNA control region sequence analysis and phylogenetic analysis to identify the subspecies of sika deer. Mitochondrial DNA control region sequences analysis revealed that two haplotypes came from the unknown samples. One is the same as the haplotype that came from the samples of wild population of C. n. kopschi. Phylogenetic analysis indicated that the two haplotypes of unknown samples clustered with the haplotypes of C. n. kopschi, and had significant difference from the haplotypes of the other subspecies. These results together revealed that the unknown samples came from two individuals that belong to the wild population of C. n. kopschi living in the Qinglingfeng State Natural Reserve of Zhejiang province. Therefore, the results provide forensic evidence of illegal wild animal hunting. PMID:15639603

  19. The origin and genetic variability of the Czech sika deer population

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Krojerová-Prokešová, Jarmila; Voloshina, I. V.; Myslenkov, A. I.; Kawata, Y.; Oshida, T.; Lamka, J.; Koubek, Petr


    Roč. 27, č. 6 (2012), s. 991-1003. ISSN 0912-3814 R&D Projects: GA ČR GA524/09/1569 Institutional support: RVO:68081766 Keywords : Cervus nippon * Cytochrome b gene * Control region * Introduced species Subject RIV: EG - Zoology Impact factor: 1.552, year: 2012

  20. PLAG (1-Palmitoyl-2-Linoleoyl-3-Acetyl-rac-Glycerol) Modulates Eosinophil Chemotaxis by Regulating CCL26 Expression from Epithelial Cells


    Jeong, Jinseon; Kim, Young-Jun; Yoon, Sun Young; Kim, Yong-Jae; Kim, Joo Heon; Sohn, Ki-Young; Kim, Heung-Jae; Han, Yong-Hae; Chong, Saeho; Kim, Jae Wha


    Increased number of eosinophils in the circulation and sputum is associated with the severity of asthma. The respiratory epithelium produces chemokine (C-C motif) ligands (CCL) which recruits and activates eosinophils. A chemically synthesized monoacetyl-diglyceride, PLAG (1-palmitoyl-2-linoleoyl-3-acetyl-rac-glycerol) is a major constituent in the antlers of Sika deer (Cervus nippon Temminck) which has been used in oriental medicine. This study was aimed to investigate the molecular mechanis...

  1. Prevalence of parasitic infection in captive wild animals in Bir Moti Bagh mini zoo (Deer Park), Patiala, Punjab


    A. Q. Mir; Dua, K; Singla, L. D.; Sharma, S.; Singh, M.P.


    Aim: The study was conducted to know the prevalence of gastrointestinal parasites of captive wild animals at Bir Moti Bagh Mini Zoo (Deer Park), Patiala, Punjab. Materials and Methods: A total of 31 fecal samples from eight species of captive animals including Civet cat (Viverra zibetha), Porcupine (Hystrix indica), Nilgai (Boselaphus tragocamelus), Spotted deer (Axis axis), Black buck (Antelope cervicapra), Sambar deer (Cervus unicolor), Hog deer (Axis porcinus), and Barking deer (Muntiac...

  2. Using improved technology for filter paper-based blood collection to survey wild Sika deer for antibodies to hepatitis E virus


    Yu, Claro; Zimmerman, Carl; Stone, Roger; Engle, Ronald E.; Elkins, William; Nardone, Glenn A.; Emerson, Suzanne U.; Purcell, Robert H.


    Recent reports from Japan implicated wild Sika deer (Cervus nippon) in the zoonotic transmission of hepatitis E to humans. Seroprevalence studies were performed to determine if imported feral populations of Sika deer in Maryland and Virginia posed a similar risk of transmitting hepatitis E virus (HEV). Hunters collected blood on filter paper disks from freshly killed deer. The disks were desiccated and delivered to a collection point. The dried filters were weighed to estimate the amount of b...

  3. First Report of Hepatitis E Virus Infection in Sika Deer in China


    Xiao-Xuan Zhang; Si-Yuan Qin; Yuan Zhang; Qing-Feng Meng; Jing Jiang; Gui-Lian Yang; Quan Zhao; Xing-Quan Zhu


    Hepatitis E virus (HEV), a single stranded RNA, nonenveloped virus, belongs to the genus Hepevirus, in the family of Hepeviridae. In this study, 46 (5.43%) out of the 847 serum samples from sika deer (Cervus nippon) were detected as seropositive with hepatitis E virus (HEV) by enzyme linked immunosorbent assay (ELISA). These samples were collected from Inner Mongolia and Jilin and Heilongjiang provinces in China, between October 2012 and October 2013. Seroprevalence of HEV infection in male a...

  4. Distinct Distribution of Dicrocoelium dendriticum and D. chinensis in Iwate Prefecture, Japan, and a New Final Host Record for D. chinensis


    OHTORI, Maiko; Aoki, Mikiko; ITAGAKI, Tadashi


    ABSTRACT This study dealt with the morphological and molecular identification of Dicrocoelium flukes obtained from Japanese serow (Capricornis crispus) and sika deer (Cervus nippon centralis) in the twelve districts of Iwate Prefecture, Japan. Dicrocoelium dendriticum and D. chinensis were exclusively detected in the western, and coastal and eastern areas of Iwate Prefecture, respectively. This geographically distinct occurrence of the two Dicrocoelium species would be associated with the dis...

  5. Habitatové preference jelena siky v Doupovských horách


    Rohla, Jan


    This thesis focuses on habitat preferences of sika deer (Cervus nippon) in Doupov mountains. The aim was to recognise the area of residence of given individuals. This data could be used for easier reduction of sika deer population, thereby for decrease of damage in forest stands and agriculture crops. Because the population of sika deer is too high, more effective hunting practice is needed to reduce it to endurable levels. The collected data show, that although we followed three stags at ...

  6. Intraspecific evolution within an ecologically diverse species can be used to examine evolutionary trends observed in ruminant morphology: a review of case studies of the Japanese sika deer


    Kubo, Mugino Ozaki


    This review addresses the question “Are interspecific and macroevolutionary trends observed in ruminant morphology found among populations of a single species?” Several case studies of the Japanese sika deer, Cervus nippon, are discussed. The Japanese sika deer is a suitable species for this purpose because it inhabits various environments from the northern subarctic forests to the southern subtropical forests. It shows conspicuous variations in feeding habits, body size, and other morphologi...

  7. Control of mycobacterium bovis infection in two sika deer herds in Ireland


    Partridge Tom; Toolan Dónal; Egan John; More Simon


    Abstract In a number of countries, tuberculosis (due to infection with Mycobacterium bovis) is a significant health problem of captive deer. This paper describes outbreaks of bovine tuberculosis in sika deer (Cervus nippon) on two farms in Ireland and the methods used to control the disease. On Farm A, infection was first detected during 1993. The infection was eradicated using a programme of test and removal, in association with segregation of young animals. A second outbreak (also due to in...

  8. Genetic diversity of native Primorian and introduced Czech populations of Dybowski’s sika deer using microsatellite markers

    Czech Academy of Sciences Publication Activity Database

    Barančeková, Miroslava; Krojerová-Prokešová, Jarmila; Voloshina, I. V.; Lamka, J.; Koubek, Petr

    Huilo Huilo : Fundacion Huilo Huilo, 2010 - (Werner-Flueck, J.; Charrier, A.). s. 44-45 [International Deer Biology Congress /7./. 02.08.2010-07.08.2010, Huilo Huilo] R&D Projects: GA ČR GA524/09/1569 Institutional research plan: CEZ:AV0Z60930519 Keywords : Cervus nippon hortulorum * genotyping * genetic diversity * mtDNA * bottleneck Subject RIV: EG - Zoology

  9. Habitat Selection by Eld’s Deer following Relocation to a Patchy Landscape


    Duo Pan; Yan-Ling Song; Zhi-Gao Zeng; Bravery, Benjamin D.


    An emerging issue in wildlife conservation is the re-establishment of viable populations of endangered species in suitable habitats. Here, we studied habitat selection by a population of Hainan Eld's deer (Cervus eldi) relocated to a patchy landscape of farmland and forest. Hainan Eld's deer were pushed to the brink of extinction in the 1970s, but their population expanded rapidly from 26 to more than 1000 individuals by 2003 through effective reserve protection. As part of a wider relocation...

  10. REVIEW: Baluran Nasional Park Savanna




    One of the biodiversity richness in Indonesia is ecosystem of Baluran National Park savanna. This type of savanna is similar to African savanna that is included in tropical savanna. There are two types of savanna, namely flat and undulating savanna. The savanna ecosystem that covers about 40% of the total area of Baluran National Park has important role on supporting herbivore animals such as wild cattle (Bos javanicus), deer (Cervus timorensis) and wild buffalo (Bubalus bubalis). The variety...

  11. Deer Frozen Semen Quality in Tris Sucrose and Tris Glucose Extender with Different Glycerol Concentrations


    W. M. M. Nalley; R. Handarini; R.I Arifiantini; T.L. Yusuf; B. Purwantara; G. Semiadi


    In order to improve Timor deer (Cervus timorensis) frozen semen quality, the influence of sugar and glycerol concentration on semen characteristics of sperm was investigated. The semen was collected from five sexually mature Timor deer using an electroejaculator. The semen was evaluated and divided into six equal tubes and diluted with Tris sucrose glycerol 10% (TSG10); Tris sucrose glycerol 12% (TSG12); Tris sucrose glycerol 14% (TSG14); Tris glucose glycerol 10% (TGG10); Tris glucose glyce...

  12. Étude d'une grotte à Ours du Pléistocène moyen en Dordogne : la Grotte XIV.


    Guadelli, Jean-Luc


    La Grotte XIV (Dordogne, France) a livré des restes attribuables à des espèces d'âge pléistocène moyen ancien : Dinobatis, Panthera gombaszoegensis, Panthère, Felis (de grande taille) ou Lynx (de petite taille), Ursus cf. deningeri, Canis cf. etruscus, Hemitragus, Cervus, Capreolus, Dicerorhinus,... Les restes d'Ours présentent des caractères très primitifs (entoconide des M1 très simple, faible torsion de l'articulation distale des tibias, ...) ce qui pose la question de l'identification pré...

  13. Distinct distribution of Dicrocoelium dendriticum and D. chinensis in Iwate Prefecture, Japan, and a new final host record for D. chinensis. (United States)

    Ohtori, Maiko; Aoki, Mikiko; Itagaki, Tadashi


    This study dealt with the morphological and molecular identification of Dicrocoelium flukes obtained from Japanese serow (Capricornis crispus) and sika deer (Cervus nippon centralis) in the twelve districts of Iwate Prefecture, Japan. Dicrocoelium dendriticum and D. chinensis were exclusively detected in the western, and coastal and eastern areas of Iwate Prefecture, respectively. This geographically distinct occurrence of the two Dicrocoelium species would be associated with the distribution of the final hosts, sika deer for D. chinensis and Japanese serow for D. dendriticum. This study also reports that Capricornis crispus is a new final host of D. chinensis. PMID:24998394

  14. Comparative Morphology of Prickles of Rubus croceacanthus (Rosaceae) in Kashima Island and Its Neighbouring Areas


    Shogo Takei; Kazuhiro Yoshioka; Satoru Yamada; Hiroshi Hayakawa; Jun Yokoyama; Katsura Ito; Shin-ichi Tebayashi; Ryo Arakawa; Tatsuya Fukuda


    Kashima Island (32° 57? N, 132° 27? E) is a small island of southern Japan with high population density of sika deer (Cervus nippon). To ascertain whether heavy sika deer browsing has resulted in increased plant defences on the island, we conducted a morphological comparison of Rubus croceacanthus H. Lev. (Rosaceae) on Kashima Island and in the neighbouring areas on the mainland. We measured the length and density of the leaf and stem prickles. We found that the prickles of R. croceacanthus o...

  15. Historie výskytu a chovu jelena siky v České republice


    Boček, Milan


    This thesis deals with the history of the occurrence and breeding of a sika deer (Cervus nippon) in the Czech Republic. The thesis focuses on the type characteristics and the description of its life pattern and the history of a sika deer expansion within Europe and the Czech Republic primarily. The thesis contains the evaluation of populations development in the areas with the highest coincidence of a sika deer in our country as well, namely in the West Bohemia and the Bouzov Region. The ...

  16. Comparative Analysis of Prickles on Rubus sieboldii (Rosaceae) between Grazed and Ungrazed Areas in Southwestern Shikoku, Japan


    Shogo Takei; Kyohei Ohga; Hiroshi Hayakawa; Jun Yokoyama; Katsura Ito; Shin-ichi Tebayashi; Ryo Arakawa; Tatsuya Fukuda


    Kashima Island (32º57?N, 132º27?E) is a very small island (45.1 ha) in southwestern Shikoku, Japan with a high density (ca. 38.5/km2) of Sika deer (Cervus nippon). To examine induced defences of plants against the Sika deer, we conducted morphological analyses of prickles of Rubus sieboldii Blume (Rosaceae) between grazed (Kashima Island) and ungrazed areas (neighbour locations) in southwestern Shikoku. The length and density of prickles on leaves and around stems were measured. The prickles ...

  17. Historie chovu jelena siky Dybowského v Českých zemích


    Mlateček, Petr


    The history of Dybowski´s Sika deer breeding in the Czech Republic This bachelor work is dedicated to the problems of Japanese Sika deer (Cervus nippon nippon), it´s introduce to Europe and to the Czech Republic including it´s occurrence. The presence of a Sika deer population in the vast teritories of the Czech Republic causes problems from the aspect of hunting as well as forestry. The practical part of this work focuses on the observation of the influence of Earth´s magnetic field...

  18. 牧場採草地へのニホンジカ侵入に対する防護柵の影響


    高山, 耕二; 内山, 雄紀; 赤井, 克己; 花田, 博之; 伊村, 嘉美; 中西, 良孝; Takayama, Koji; UCHIYAMA, Yuki; AKAI, Katsumi; Hanada, Hiroyuki; IMURA, Yoshimi; Nakanishi, Yoshitaka; 髙山, 耕二


    The objective of this study was to obtain fundamental information regarding effective methods for reducing the damage caused to meadows by sika deer (Cervus nippon). A survey was conducted to evaluate the effect of fencing for preventing sika deer invasion of meadows A (8 ha) and B (7.4 ha) in Iriki Livestock Farm (148 ha). Fence A (175 cm in height) that was set around meadow A comprised wire net (120 cm in height) and synthetic fiber net (120-175 cm in height) fences, whereas Fence B (140cm...

  19. Mortality of domesticated java deer attributed to Surra. (United States)

    Nurulaini, R; Jamnah, O; Adnan, M; Zaini, C M; Khadijah, S; Rafiah, A; Chandrawathani, P


    This paper reports an outbreak of trypanosomiasis due to Trypanosoma evansi in Java deer (Cervus timorensis) on a government deer farm in Lenggong, Perak. Seventeen adult female Java deer were found dead within a week. Symptoms of dullness, inappetence, anaemia, anorexia, respiratory distress and recumbency were seen prior to death in the infected Java deer. Beside trypanosomiasis, other parasitic infections such as theileriosis, helminthiasis and ectoparasite infestation were also recorded. Post mortem results showed generalized anaemia in most animals with isolated cases of jaundice. There was no significant finding with respect to bacteriological and viral investigations. PMID:18209710

  20. Epidemiological Study of Animal Leptospirosis in New Caledonia


    Cédric Roqueplo; Olivier Cabre; Bernard Davoust; Angeli Kodjo


    Leptospirosis is an important zoonotic disease in the world and a real public health concern for many years in New Caledonia. A cross-sectional survey was carried out on domestic and wild animals from New Caledonia in April 2009. Blood samples were collected from 30 cattle, 29 deers, (Cervus timorensis russa), 25 horses, 51 dogs, and 8 cats and were tested for 23 serovars of pathogenic Leptospira species by the microscopic agglutination test. From the total number of 143 samples, 84 (58.7%) w...

  1. The prevalence of anti-leptospiral agglutinins in sera of wildlife in southeastern Australia. (United States)

    Milner, A R; Wilks, C R; Spratt, D M; Presidente, P J


    Anti-leptospiral agglutinins were found in the serum from 18 (7 species) of 419 (25 species) animals sampled from various areas of southeastern Australia. Positive serologic reactions were observed in 5 of 25 (20%) brush-tailed possum (Trichosurus vulpecula), 1 of 26 (3.8%) tammar wallaby (Macropus eugenii), 2 of 12 (16.7%) swamp wallaby (Wallabia bicolor), 1 of 3 (33.3%) koala (Phascolarctos cinereus), 3 of 41 (7.3%) common wombat (Vombatus ursinus), 2 of 100 (2%) bush rat (Rattus fuscipes) and 4 of 12 (25%) rusa deer (Cervus timorensis). The majority (55.5%) of serologic reactions were to serovar hardjo. No serologic reactions were observed in samples from echidna (Tachyglossus aculeatus), brown antechinus (Antechinus stuartii), swainson's antechinus (Antechinus swaisonsii), long-nosed bandicoot (Perameles nasuta), brown bandicoot(Isoodon obesulus), common ringtail (Pseudocheirus peregrinus), greater glider (Schoinobates volans), eastern grey kangaroo (Macropus giganteus), red-necked wallaby (Macropus rufogriseus), rabbit (Oryctolagus cuniculus), water rat (Hydromys chrysogaster), black rat (Rattus rattus), eastern swamp rat (Rattus lutreolus), broad-toothed rat (Mastacomys fuscus), fox (Vulpes vulpes), sambar deer (Cervus unicolor), hog deer (Axis porcinus) and fallow deer (Dama dama). PMID:7241704

  2. Parasites, diseases, and health status of sympatric populations of sika deer and white-tailed deer in Maryland and Virginia. (United States)

    Davidson, W R; Crow, C B


    In July 1981, investigations on parasites, diseases, and herd health status were conducted on sympatric populations of sika deer (Cervus nippon) and white-tailed deer (Odocoileus virginianus) from Blackwater National Wildlife Refuge (Maryland) and Chincoteague National Wildlife Refuge (Virginia) on the Delmarva Peninsula. Five adult deer of each species were collected from each location and subjected to thorough necropsy examinations and laboratory tests. White-tailed deer at both locations harbored protozoan, helminth, and arthropod parasites typically associated with this species throughout the southeastern United States. In contrast, sika deer at both locations harbored only light burdens of ticks, chiggers, and sarcocysts. Serologic tests for antibodies to seven infectious disease agents revealed evidence of exposure to bovine virus diarrhea (BVD) virus, infectious bovine rhinotracheitis virus, and parainfluenza3 virus in white-tailed deer, but only BVD virus in sika deer. At both locations the general health status of sika deer was superior to that of white-tailed deer. PMID:6644934

  3. Deer predation on leaf miners via leaf abscission (United States)

    Yamazaki, Kazuo; Sugiura, Shinji


    The evergreen oak Quercus gilva Blume sheds leaves containing mines of the leaf miner Stigmella sp. (Lepidoptera: Nepticulidae) earlier than leaves with no mines in early spring in Nara, central Japan. The eclosion rates of the leaf miner in abscised and retained leaves were compared in the laboratory to clarify the effects of leaf abscission on leaf miner survival in the absence of deer. The leaf miner eclosed successfully from both fallen leaves and leaves retained on trees. However, sika deer ( Cervus nippon centralis Kishida) feed on the fallen mined leaves. Field observations showed that deer consume many fallen leaves under Q. gilva trees, suggesting considerable mortality of leaf miners due to deer predation via leaf abscission. This is a previously unreported relationship between a leaf miner and a mammalian herbivore via leaf abscission.

  4. Targeting hunter distribution based on host resource selection and kill sites to manage disease risk

    DEFF Research Database (Denmark)

    Dugal, Cherie; van Beest, Floris; Vander Wal, Eric;


    Endemic and emerging diseases are rarely uniform in their spatial distribution or prevalence among cohorts of wildlife. Spatial models that quantify risk-driven differences in resource selection and hunter mortality of animals at fine spatial scales can assist disease management by identifying high......-risk areas and individuals. We used resource selection functions (RSFs) and selection ratios (SRs) to quantify sex- and age-specific resource selection patterns of collared (n = 67) and hunter-killed (n = 796) nonmigratory elk (Cervus canadensis manitobensis) during the hunting season between 2002 and 2012...... disease) rarely selected for sites outside of parks during the hunting season in contrast to adult females and juvenile males. The RSFs showed selection by adult females and juvenile males to be negatively associated with landscape-level forest cover, high road density, and water cover, whereas hunter...

  5. The effect of immobilizing drugs on adrenal responsiveness to ACTH in Rusa deer. (United States)

    Van Mourik, S; Stelmasiak, T


    Resting cortisol values in a fully tame Rusa deer (Cervus rusa timorensis) and the influence of two anaesthetics, Rompun and Fentaz, on cortisol levels as well as the response to synthetic ACTH were investigated. The mean level of cortisol in a completely tame Rusa deer was found to be 2.22 ng/ml (SD 1.45 ng/ml n = 36; minimal level recorded was 0.96 ng/ml, maximal level recorded was 9.21 ng/ml). No circadian rhythm of cortisol in plasma was detected. Rompun (xylazine hydrochloride) and/or Fentaz (fentanyl citrate) alone or in combination can be used for immobilization of Rusa deer. Neither Rompun nor Fentaz alone or in combination influences the cortisol response to synthetic ACTH administration. Because of the narrow range for safe dosage for Fentaz the use of Rompun for immobilizing deer is recommended. PMID:6149097


    Directory of Open Access Journals (Sweden)



    Full Text Available 135 scats of Leopards from Melghat Tiger Reserve were analyzed for any undigested remains. Theanalysis of scats of leopards revealed remains of 11 prey species with a high preponderance of smallmammals including Indian hare (Lepus nigricollis , sambar (Cervus unicolorand wild pig (Susscrofa. The prey preference on the basis of biomass was sambar > wild pig > domestic animals >chital > four horned antelope. but the order of predation on the basis of undigested remains in scatswas Indian hare > sambar > wild pig > langur > domestic animals. It is found that the leopardspreferred two different preys (55 scats, 40.47% at a time. Leopards were also found to be the hostof a number of gastrointestinal parasites. They got these infections from the herbivores on whichthey feed as well as crabs on which they preyed rarely.

  7. Reconsideration of the systematics of the Early Pleistocene Cervavitus (Cervidae, Artiodactyla, Mammalia

    Directory of Open Access Journals (Sweden)

    Dong, W.


    Full Text Available Cervavitus were usually found from the Late Miocene and Pliocene deposits in East Europe, Middle Asia and North China, but they were found recently in many Early Pleistocene localities in southern China. The latter resulted in the discussion of their systematic status between Cervavitus and Cervus. Here we show the Early Pleistocene forms from southern China are morphometrically more similar to northern China Cervavitus species, and the cladistic analysis shows that the southern China forms are closer to classic Cervavitus species than Cervus and that also proves their systematic status in Cervavitus rather than in Cervus. Cervavitus originated in Moldovan forests of East Europe in the late Vallesian (MN10 from a brachyodont and holometacarpal ancestor with two/three-tined antlers and Palaeomeryx fold and evolved into C. novorossiae. It dispersed into West Europe forests in the earliest Turolian and further west to France in the Ruscinian. It dispersed into northern China forests in the early Turolian and represented by C. shanxius. The great quantity of C. shanxius specimens with brachyodont teeth and complete lateral metacarpals implies the arid Loess Plateau of today was a humid forested region in the Late Miocene. C. shanxius migrated southwards in the Plio-Pleistocene probably due to the drying environment in northern China with uplifting of Himalayas and evolved into C. ultimus and C. fenqii, which survived in southern China until the Early Pleistocene (MNQ18.La revisión sistemática de Cervivatus sugiere que deriva del principal clado de los cérvidos posteriores a los muntiacinos, e implica que Procervulinae, Dicrocerinae y la primeras formas de Munticiacinae serían holometacarpales, como también lo es Cervivatus, originario en los bosques de Moldavia (Europa del Este durante el Vallesiense final (MN 10, a partir de un antecesor braquiodonto y holometacarpal, con astas con dos o tres candiles y pliegue paleomerícido, y que da lugar a

  8. Somatic Chromosomes of the Bornean Sambar Deer and Rusa Deer Interspecific Hybrids

    Directory of Open Access Journals (Sweden)

    Ismail Idris


    Full Text Available Problem statement: Hybridization has potential benefits to the Malaysian farmed deer industries in terms of increased growth rate and increased proportion of muscle and an improved alignment of feed supply and annual energy requirement. Species or subspecies of different chromosome constitution could mate to produce healthy hybrid offspring in a normal ratio of males and females. If any of the hybrid offspring were sterile, the sterile offspring would be the heterogametic offspring. The study investigated the use of chromosome banding method to detect chromosomal variation and to define the chromosome homology and the possibility of the Bornean Sambar deer (Cervus unicolor brookei and Rusa deer (Cervus timorensis hybrids to reproduce. Approach: Samples were collected from the Livestock Breeding Station, Sabrang, Keningau, Sabah, East Malaysia. The animals studied consisted of two deer subspecies namely the Bornean Sambar deer, Rusa deer and their hybrids. The karyotypes of the Bornean Sambar deer, Rusa deer and their F1 hybrids have been investigated by solid giemsa staining, G-banding and Ag-NOR banding techniques. Results: Rusa and Bornean Sambar have different chromosome number; 60 and 62 respectively, but share the same fundamental number of chromosome arm, 70. The hybrids have 2n = 61, consisting of 9 metacentric to submetacentric autosomes and 24 pairs of acrocentric autosomes with two acrocentrics and one submetacentric chromosome being unpaired. The morphology of the sex chromosomes in the F1 hybrids was similar to that of the parental species. The Ag-NOR pattern and the conventional Giemsa staining of chromosomes were effective as markers in the characterization of the karyotypes of the parental lines and hybrids because of the presence of active NORs on different chromosomes of different species. G-band, in contrast, showed complete homology in the presence of euchromatic bands and heterochromatin blocks respectively on each chromosome

  9. Parâmetros cinéticos da degradação in vitro de alimentos incubados com inóculo microbiano de diferentes espécies de ruminantes Kinetic parameters of the ruminal in vitro degradation of feedstuffs given to different ruminant species

    Directory of Open Access Journals (Sweden)

    A.R.G.F. Bezerra


    Full Text Available Parâmetros cinéticos da degradação ruminal de alguns alimentos utilizados para ruminantes de zoológicos foram estimados mediante incubação in vitro com líquido ruminal de audade (Ammotragus lervia, cervo sambar (Cervus unicolor, elande (Taurotragus oryx, bovino (Bos taurus, bubalino (Bubalus bubalis, caprino (Capra hircus e ovino (Ovis aries. Os parâmetros cinéticos foram estimados pela técnica da produção de gás, cujos dados foram ajustados pelos modelos de um e de duplo compartimento. Não foram detectadas diferenças nos parâmetros cinéticos que permitissem agrupar os alimentos (fibrosos × não fibrosos e os animais (domésticos × silvestres. O modelo de duplo compartimento foi o mais adequado para a estimação dos parâmetros cinéticos da degradação ruminal. Inóculo microbiano oriundo de ruminantes domésticos não é recomendado para estimar parâmetros cinéticos da degradação ruminal de alimentos utilizados para ruminantes silvestres de zoológicos.The estimation of the ruminal kinetic parameters of pumpkin, potato-sweet, beet, broccoli, carrot, alfalfa hay, alfalfa pellet and bean, currently used for feeding wild and domestic ruminants raised in the Rio de Janeiro Zoo, was made through in vitro incubation of the feedstuffs together with ruminal fluid obtained from aoudad (Ammotragus lervia, sambar deer (Cervus unicolor, eland (Taurotragus oryx, cattle (Bos taurus, buffalo (Bubalus bubalis, goat (Capra hircus and sheep (Ovis aries. The gas production technique was used to obtain gas profiles, and the data were fitted by the mono or double compartmental model. The kinetic parameters were discrepant among both, animals and feedstuffs, and the double compartmental model gave the best estimation. Ruminal inocula from domestic ruminants can not be used to estimate the kinetic parameters of ruminal degradation of feedstuffs for wild ruminants.

  10. Gamma herpesvirus carrier status of captive artiodactyls. (United States)

    Flach, E J; Reid, H; Pow, I; Klemt, A


    Between 1998 and 2000, 103 individuals of 19 species of the order Artiodactyla at Whipsnade Wild Animal Park were tested for evidence of infection with gamma herpesviruses in order to distinguish between species which are susceptible to malignant catarrhal fever (MCF), caused by alcelaphine herpesvirus-1 (AlHV-1) of wildebeest (Connochaetes sp.) or ovine herpesvirus-2 (OvHV-2) of domestic sheep, and species which carry related viruses sub-clinically. Gamma herpesvirus DNA was detected in the known, or suspected, carrier species: roan antelope (Hippotragus equinus), scimitar-horned oryx (Oryx dammah), gemsbok (Oryx gazella), musk ox (Ovibos muschatus) and mouflon (Ovis musimon). In six other species: lowland anoa (Bubalus depressicornis) yak (Bos grunniens), sitatunga (Tragelaphus spekei), greater kudu (Tragelaphus strepsiceros), waterbuck (Kobus ellipsiprymnus) and Nile lechwe (Kobus megaceros), DNA was present in some newborn calves and over 30% of adults, strongly suggesting a carrier state. In contrast five Père David's deer (Elaphurus davidianus) and two swamp deer (Cervus duvauceli) died of MCF during the study. A virus isolated from scimitar-horned oryx calves produced cytopathic effects in scimitar-horned oryx kidney cell-culture and caused MCF in a rabbit. PMID:12208112

  11. Control of mycobacterium bovis infection in two sika deer herds in ireland

    Directory of Open Access Journals (Sweden)

    Partridge Tom


    Full Text Available Abstract In a number of countries, tuberculosis (due to infection with Mycobacterium bovis is a significant health problem of captive deer. This paper describes outbreaks of bovine tuberculosis in sika deer (Cervus nippon on two farms in Ireland and the methods used to control the disease. On Farm A, infection was first detected during 1993. The infection was eradicated using a programme of test and removal, in association with segregation of young animals. A second outbreak (also due to infection with M. bovis, but a different RFLP profile was detected in 2002. In the latter outbreak, infection was particularly prevalent in two groups of young deer. M. bovis with the same RFLP profile was also isolated in a badger found dead on the farm. Control was achieved by test and removal in association with herd management changes. In Herd B, infection was first detected in 1995, and subsequently eradicated using test and removal alone. In Herd A, re-infection remains an ongoing risk. Control rather than eradication of infection may more realistic in the short-to medium-term.

  12. A likelihood-based approach for assessment of extra-pair paternity and conspecific brood parasitism in natural populations (United States)

    Lemons, Patrick R.; Marshall, T.C.; McCloskey, Sarah E.; Sethi, S.A.; Schmutz, Joel A.; Sedinger, James S.


    Genotypes are frequently used to assess alternative reproductive strategies such as extra-pair paternity and conspecific brood parasitism in wild populations. However, such analyses are vulnerable to genotyping error or molecular artifacts that can bias results. For example, when using multilocus microsatellite data, a mismatch at a single locus, suggesting the offspring was not directly related to its putative parents, can occur quite commonly even when the offspring is truly related. Some recent studies have advocated an ad-hoc rule that offspring must differ at more than one locus in order to conclude that they are not directly related. While this reduces the frequency with which true offspring are identified as not directly related young, it also introduces bias in the opposite direction, wherein not directly related young are categorized as true offspring. More importantly, it ignores the additional information on allele frequencies which would reduce overall bias. In this study, we present a novel technique for assessing extra-pair paternity and conspecific brood parasitism using a likelihood-based approach in a new version of program cervus. We test the suitability of the technique by applying it to a simulated data set and then present an example to demonstrate its influence on the estimation of alternative reproductive strategies.

  13. Radiocesium Concentration Change in Game Animals: Use of Food Monitoring Data - 13168

    Energy Technology Data Exchange (ETDEWEB)

    Tagami, Keiko; Uchida, Shigeo [Office of Biospheric Assessment for Waste Disposal, National Institute of Radiological Sciences, Anagawa 4-9-1, Inage-ku, Chiba 263-8555 (Japan)


    Radionuclides were released into the environment in the Fukushima Daiichi Nuclear Power Plant (FDNPP) accident. Radiocesium (Cs-134+137) concentrations in most agricultural products became lower than the detection limit (∼10 Bq kg{sup -1}) from June 2011, and the concentrations have remained low. However, some wild food materials such as meat of game animals (e.g., bear and wild boar) caught in Fukushima and surrounding areas some times showed higher values than the detection limits. In this study, monitoring data on game animal meat were summarized to understand the amount of activities found in wild animals and the activity distribution in the contaminated areas. Concentration data are available from monthly reports issued by the Ministry of Health, Labour and Welfare. Data were collected on wild boar (Sus scrofa), deer (Cervus nippon), Asian black bear (Ursus thibetanus), Japanese pheasant (Phasianus versicolor), and duck (e.g. Anas poecilorhynch). There is a tendency that the concentration decreases with distance from the FDNPP; in order to compare the Cs-137 concentrations among animals, one collection site was selected. The results showed that the concentration was in the following order within one year: Asian black bear>wild boar> deer >duck and Japanese pheasant. Bear and boar are omnivorous animals and their feeding pattern would affect the concentrations in their meats. (authors)

  14. Growth and reproductive performance of sambar deer in Sabal Forest Reserve of Sarawak, Malaysia. (United States)

    Dahlan, Ismail; Dawend, Jiwan


    We examined the growth, reproduction, rutting behavior, and health status of sambar deer (Cervus unicolor brookei) in secondary Acacia mangium plantation. The data were collected over 11 years from a breeding herd of 21 stags and 33 hinds in Sabal Forest Reserve, Sarawak, Malaysia. Brody's growth model of the pooled data is Y t  = 148.56 (1 - 0.98e(-0.023t)), which estimates that maximum weights of adults are 184 and 115 kg for males and females respectively. Sambar deer are nonseasonal breeders with the breeding peak in February. Although the earliest age at which a female reached sexual maturity was 11 months, the mean age was 23 ± 7 months. Mean age of first fawning was 32 ± 8 months. Mean gestation period was 259 ± 12 days (n = 82). Stags shed antlers mostly between March and July. Velvet hardens at 103 ± 27 days (n = 23), and velvet harvesting is best at 7-9 weeks when antler length is 25-30 cm. Sambar deer are suitable as a farm species in forest plantations and have a vast potential to uplift rural living standards. PMID:23475732

  15. Spatially distinct responses within willow to bark stripping by deer: effects on insect herbivory (United States)

    Tanaka, Motonobu; Nakamura, Masahiro


    Within individual plants, cervid herbivory may cause positive or negative plant-mediated effects on insect herbivores, depending on where it occurs. Using a combination of field observations and artificial bark-stripping experiments in Hokkaido, Japan, we examined the plant-mediated effects of bark stripping by sika deer ( Cervus nippon yesoensis) on insect herbivory in two spatially distinct parts of willow ( Salix udensis) trees: resprouting leaves below bark-stripping wounds and canopy leaves above. Natural and artificial bark stripping stimulated resprouting from trunks below wounds. Resprouting leaves on bark-stripped trees had lower total phenolics, condensed tannin, and C/N ratios than did canopy leaves on control trees. Herbivory rates were higher in resprouting leaves on bark-stripped trees than in canopy leaves on controls. Conversely, above-wound canopy leaves on bark-stripped trees had higher total phenolics than did those on controls, while herbivory rates were lower in the canopy leaves of bark-stripped trees than in those on controls. These results demonstrate that plant-mediated effects of bark stripping diverge between plant tissues below and above wounds in individual willow trees. We submit that focusing on multiple plant parts can elucidate plant-mediated effects at the whole-plant scale.

  16. Complement-mediated killing of Borrelia burgdorferi by nonimmune sera from sika deer. (United States)

    Nelson, D R; Rooney, S; Miller, N J; Mather, T N


    Various species of cervid deer are the preferred hosts for adult, black-legged ticks (Ixodes scapularis and Ixodes pacificus) in the United States. Although frequently exposed to the agent of Lyme disease (Borrelia burgdorferi), these animals, for the most part, are incompetent as transmission reservoirs. We examined the borreliacidal activity of normal and B. burgdorferi-immune sera from sika deer (Cervus nippon) maintained in a laboratory setting and compared it to that of similar sera from reservoir-competent mice and rabbits. All normal deer sera (NDS) tested killed > 90% of B. burgdorferi cells. In contrast, normal mouse and rabbit sera killed 1:1,024. Heat treatment (56 C, 30 min) of NDS reduced borreliacidal activity, with 90% of the cells killed. Addition of 10 mM EDTA reduced the killing to approximately 30%, whereas the addition of Mg2+ (10 mM) restored borreliacidal activity to NDS. The addition of zymosan A, an activator of the alternative pathway, increased the survival of B. burgdorferi cells to approximately 80% in NDS. These data suggest that the alternative complement activation pathway plays a major role in the borreliacidal activity of NDS. Additionally, 10 mM EGTA had almost no effect on the killing activity of B. burgdorferi-exposed deer sera, suggesting that the classical pathway is not involved in Borrelia killing, even in sera from B. burgdorferi-exposed deer. PMID:11191897

  17. Protective effect of EC-18, a synthetic monoacetyldiglyceride on lung inflammation in a murine model induced by cigarette smoke and lipopolysaccharide. (United States)

    Shin, In-Sik; Ahn, Kyung-Seop; Shin, Na-Rae; Lee, Hyun-Jun; Ryu, Hyung Won; Kim, Jae Wha; Sohn, Ki-Young; Kim, Heung Jae; Han, Yong-Hae; Oh, Sei-Ryang


    The antler of Sika deer (Cervus nippon Temminck) has been used a natural medicine in Korea, China and Japan, and a monoacetyldiaglyceride (1-palmitoyl-2-linoleoyl-3-acetylglycerol, PLAG) was found in the antler of Sika deer as a constituent for immunomodulation. In this study, we investigated protective effects of EC-18 (a synthetic copy of PLAG) on inflammatory responses using a cigarette smoke with lipopolysaccharide (LPS)-induced airway inflammation model. Mice were exposed to cigarette smoke for 1h per day for 3days. Ten micrograms of LPS dissolved in 50μL of PBS was administered intra nasally 1h after the final cigarette smoke exposure. EC-18 was administered by oral gavage at doses of 30 and 60mg/kg for 3days. EC-18 significantly reduced the number of neutrophils, reactive oxygen species production, cytokines and elastase activity in bronchoalveolar lavage fluid (BALF) compared with the cigarette smoke and LPS induced mice. Histologically, EC-18 attenuated airway inflammation with a reduction in myeloperoxidase expression in lung tissue. Additionally, EC-18 inhibited the phosphorylation of NF-κB and IκB induced by cigarette smoke and LPS exposure. Our results show that EC-18 effectively suppresses neutrophilic inflammation induced by cigarette smoke and LPS exposure. In conclusion, this study suggests that EC-18 has therapeutic potential for the treatment of chronic obstructive pulmonary disease. PMID:26655742

  18. Caballos y ciervos : Una aproximación a la evolución climática y económica del Paleolítico superior en el Mediterráneo peninsular

    Directory of Open Access Journals (Sweden)

    Xavier Esteve


    Full Text Available Caballos y ciervos son las principales presas de caza mayor en los yacimientos del Paleolítico superior en la cuenca mediterranea de la Península Ibérica. Sólo las cabras monteses pueden llegar a tener mayor importancia en yacimientos situados en áreas abruptas o montañosas. A pesar de los pocos requerimientos climáticos de ambas especies, podemos comprobar una clara relación entre los episodios más fríos del final del Pleistoceno y la caza del caballo y la presencia de los restos de ciervo en los yacimientos arqueológicos durante los momentos más templados. Nuestros resultados indican la existencia de una especie de frontera bioclimática Equus/Cervus que se desplazó de sur a norte en la cuenca medietrranea de la peninsula Ibérica a lo largo del Paleolítico superior.

  19. Competition favors elk over beaver in a riparian willow ecosystem (United States)

    Baker, B.W.; Peinetti, H.R.; Coughenour, M.C.; Johnson, T.L.


    Beaver (Castor spp.) conservation requires an understanding of their complex interactions with competing herbivores. Simulation modeling offers a controlled environment to examine long-term dynamics in ecosystems driven by uncontrollable variables. We used a new version of the SAVANNA ecosystem model to investigate beaver (C. Canadensis) and elk (Cervus elapses) competition for willow (Salix spp.). We initialized the model with field data from Rocky Mountain National Park, Colorado, USA, to simulate a 4-ha riparian ecosystem containing beaver, elk, and willow. We found beaver persisted indefinitely when elk density was or = 30 elk km_2. The loss of tall willow preceded rapid beaver declines, thus willow condition may predict beaver population trajectory in natural environments. Beaver were able to persist with slightly higher elk densities if beaver alternated their use of foraging sites in a rest-rotation pattern rather than maintained continuous use. Thus, we found asymmetrical competition for willow strongly favored elk over beaver in a simulated montane ecosystem. Finally, we discuss application of the SAVANNA model and mechanisms of competition relative to beaver persistence as metapopulations, ecological resistance and alternative state models, and ecosystem regulation.

  20. Traditional knowledge on zootherapeutic uses by the Saharia tribe of Rajasthan, India

    Directory of Open Access Journals (Sweden)

    Jaroli DP


    Full Text Available Abstract The present zootherapeutic study describes the traditional knowledge related to the use of different animals and animal-derived products as medicines by the Saharia tribe reside in the Shahabad and Kishanganj Panchayat Samiti's of Baran district of Rajasthan, India. A field survey was conducted from April to June 2006 by performing interview through structured questionnaire with 21 selected respondents, who provided information regarding use of animals and their products in folk medicine. A total of 15 animal species were recorded and they are used for different ethnomedical purposes, including cough, asthma, tuberculosis, paralysis, earache, herpes, weakness, muscular pain etc. The zootherapeutic knowledge was mostly based on domestic animals, but some protected species like the peacock (Pavo cristatus,, hard shelled turtle (Kachuga tentoria, sambhar (Cervus unicolor were also mentioned as medicinal resources. We would suggest that this kind of neglected traditional knowledge should be included into the strategies of conservation and management of faunistic resources. Further studies are required for experimental validation to confirm the presence of bioactive compounds in these traditional remedies and also to emphasize more sustainable use of these resources.

  1. Zoonotic onchocerciasis caused by a parasite from wild boar in Oita, Japan

    Directory of Open Access Journals (Sweden)

    Takaoka H.


    Full Text Available Histological examination of a nodule removed from the back of the hand of a 58-year-old woman from Oita, Kyushu, Japan showed an Onchocerca female sectioned through the posterior region of the worm (ovaries identifiable and young (thin cuticle. Six Onchocerca species are enzootic in that area: O. gutturosa and O. lienalis in cattle, O. suzukii in serows (Capricornis crispus, O. skrjabini and an Onchocerca sp. in Cervus nippon nippon, and O. dewittei japonica in wild boar (Sus scrofa leucomystax. Diagnostic charactets of female Onchocerca species, such as the cuticle and its ridges, change along the body length. Tables of the histologic morphology of the mid- and posterior body-regions of the local species are presented. In addition, it was observed that transverse ridges arose and thickened during the adult stage (examination of fourth stage and juvenile females of O. volvulus. The specimen described in this report, with its prominent and widely spaced ridges, was identified as O. d. japonica. Four of the 10 zoonotic cases of onchocerciasis reported worldwide were from Oita, three of them being caused by O. d. japonica, the prevalence of which in local wild boar was 22 of 24 (92 %.

  2. Using improved technology for filter paper-based blood collection to survey wild Sika deer for antibodies to hepatitis E virus. (United States)

    Yu, Claro; Zimmerman, Carl; Stone, Roger; Engle, Ronald E; Elkins, William; Nardone, Glenn A; Emerson, Suzanne U; Purcell, Robert H


    Recent reports from Japan implicated wild Sika deer (Cervus nippon) in the zoonotic transmission of hepatitis E to humans. Seroprevalence studies were performed to determine if imported feral populations of Sika deer in Maryland and Virginia posed a similar risk of transmitting hepatitis E virus (HEV). Hunters collected blood on filter paper discs from freshly killed deer. The discs were desiccated and delivered to a collection point. The dried filters were weighed to estimate the amount of blood absorbed and were eluted and collected in one tube via a novel extraction system. The procedure was quantified and validated with negative and positive serum and blood samples obtained from domestic Sika deer before and after immunization with HEV recombinant capsid protein, respectively. None of the 155 tested samples contained antibody to HEV, suggesting that Sika deer in these populations, unlike those in Japan, do not pose a significant zoonotic threat for hepatitis E. However, the new method developed for collecting and eluting the samples should prove useful for field studies of many other pathogens. PMID:17336401

  3. First report of hepatitis E virus infection in sika deer in China. (United States)

    Zhang, Xiao-Xuan; Qin, Si-Yuan; Zhang, Yuan; Meng, Qing-Feng; Jiang, Jing; Yang, Gui-Lian; Zhao, Quan; Zhu, Xing-Quan


    Hepatitis E virus (HEV), a single stranded RNA, nonenveloped virus, belongs to the genus Hepevirus, in the family of Hepeviridae. In this study, 46 (5.43%) out of the 847 serum samples from sika deer (Cervus nippon) were detected as seropositive with hepatitis E virus (HEV) by enzyme linked immunosorbent assay (ELISA). These samples were collected from Inner Mongolia and Jilin and Heilongjiang provinces in China, between October 2012 and October 2013. Seroprevalence of HEV infection in male and female deer was 4.82% and 6.52%, respectively. HEV seroprevalence in sika deer from different geographical locations varied from 3.13% to 6.73%. There was no significant difference in HEV seroprevalence between sika deer collected in autumn (5.65%) and winter (4.85%). This is the first report of HEV seroprevalence in sika deer in China, which will provide foundation information for estimating the effectiveness of future measures to control HEV infection in sika deer in China and assessing the potential risk of humans infected with HEV after consumption of undercooked or raw meat from infected sika deer. PMID:25949999

  4. Allelic discrimination in naturalized ovine from Pantanal Sul-Matogrossense by means of microsatellite markers

    Directory of Open Access Journals (Sweden)

    Crispim Bruno do Amaral


    Full Text Available The molecular biology techniques that are used in allelic discrimination for individual and sheep breeds characterization are important tools in breeding programs and conservation of genetic resources. The use of microsatellite markers allows allelic differentiation, which in turn allows us to infer the genetic variability of sample populations. The study aimed to test the sensitivity and efficiency of fluorescent capillary electrophoresis, using microsatellite primers, for allelic discrimination of the Crioulo breed from Pantanal sul-matogrossense, as well as verify the possibility of using the products of sequencing in genetic variability analysis. For this test, were used blood samples from Pantaneira breed sheep. The allelic discrimination of eight microsatellites was determined by capillary electrophoresis in automatic sequencer and the results analyses were performed on the programs CERVUS and Dendro-UPGMA. The results indicated the possibility of using this technique for the individual genotyping of all loci tested in electrophoretic analysis and its potential to allelic discrimination even in case of difference between two pairs of bases between the alleles. The resulting dendrogram based on the distance matrix by the UPGMA assembly method, indicated medium similarity coefficient of 0.72 in the group of animals. It was concluded that there is the viability and efficiency of the microsatellite molecular markers technique using capillary electrophoresis for allelic discrimination and the utility of results for studies of genetic variability, paternity diagnosis and characterization of the Crioulo sheep herd from Pantanal sul-matogrossense.

  5. Serum biochemical and electrophoretic values from four deer species and from pronghorn antelope. (United States)

    Dhindsa, D S; Cochran, T H; Castro, A; Swanson, J R; Metcalfe, J


    Serums from 4 species of deer and 1 species of antelope were analyzed for various components in order to define an animal disease model for sickle cell disease in people. Animal species included black-tailed deer (Odocoileus hemionus columbianus), mule deer (Odocoileus hemionus), sika deer (Cervus nippon nippon), fallow deer (Dama dama), and pronghorn antelope (Antilocapra americana). The mean serum values for total bilirubin, total protein, albumin, creatinine, urea nitrogen, and electrolytes were similar in all species and were in the normal range for human beings. Cholesterol and uric acid values for all animals were lower than those for people. Alkaline phosphatase values in the 4 cervid species were higher than in the pronghorn antelope. Values for glutamic oxalacetic transaminase were lower in the cervids than in the pronghorn antelope. Lactic dehydrogenase values were similar in the 5 species. High activities for glutamic oxalacetic transaminase and lactic dehydrogenase in the 5 species probably related to muscle mass and great muscular activity. PMID:1190586

  6. Higher sika deer density is associated with higher local abundance of Haemaphysalis longicornis nymphs and adults but not larvae in central Japan. (United States)

    Tsukada, Hideharu; Nakamura, Yoshio; Kamio, Tsugihiko; Inokuma, Hisashi; Hanafusa, Yasuko; Matsuda, Naoko; Maruyama, Tetsuya; Ohba, Takahiro; Nagata, Koji


    Haemaphysalis longicornis (Acari: Ixodidae) is one of the most common and important arthropod disease vectors in Japan, carrying Japanese spotted fever and bovine theileriosis. The recent expansion of sika deer (Cervus nippon, Artiodactyla: Cervidae) populations, the most common wild host of H. longicornis, has also caused concern about increasing the risk of vector-borne diseases in Japan. We used generalized linear mixed model analysis to determine the relative contribution of deer density and other biological and abiotic factors on the abundance of H. longicornis ticks questing at each developmental stage. A total of 6223 H. longicornis adults, nymphs, and larvae were collected from 70 sites in three regions of central Japan. The abundance of questing adult and nymphal ticks was associated with deer density and other biotic and abiotic factors. However, the abundance of questing larvae showed no association with deer density but did show an association with other biotic and abiotic factors. These findings show that a high density of deer along with other biotic and abiotic factors is associated with increased risk of vector-borne diseases through amplified local abundance of questing nymphal and adult H. longicornis. Further, questing larvae abundance is likely regulated by environmental conditions and is likely correlated with survival potential or the distribution of other host species. PMID:23702338

  7. Control of Mycobacterium bovis infection in two sika deer herds in Ireland. (United States)

    Partridge, Tom; Toolan, Dónal; Egan, John; More, Simon


    In a number of countries, tuberculosis (due to infection with Mycobacterium bovis) is a significant health problem of captive deer. This paper describes outbreaks of bovine tuberculosis in sika deer (Cervus nippon) on two farms in Ireland and the methods used to control the disease. On Farm A, infection was first detected during 1993. The infection was eradicated using a programme of test and removal, in association with segregation of young animals. A second outbreak (also due to infection with M. bovis, but a different RFLP profile) was detected in 2002. In the latter outbreak, infection was particularly prevalent in two groups of young deer. M. bovis with the same RFLP profile was also isolated in a badger found dead on the farm. Control was achieved by test and removal in association with herd management changes. In Herd B, infection was first detected in 1995, and subsequently eradicated using test and removal alone. In Herd A, re-infection remains an ongoing risk. Control rather than eradication of infection may more realistic in the short-to medium-term. PMID:21851700

  8. Evaluation of microelement contents in Clethra barbinervis as food for human and animals in contrasting geological areas. (United States)

    Azuma, Asako K; Tomioka, Rie; Takenaka, Chisato


    The young leaves of Clethra barbinervis Sieb. et Zucc, which is a deciduous tree species found in secondary forests widely in Japan, are used in spring as a local traditional food by local populations, and the bark of this plant is also preferred by sika deer, Cervus nippon. However, C. barbinervis has been known to accumulate heavy metals in its leaves. Then, we aimed to clarify the characteristics of microelement contents in C. barbinervis and to discuss the value of this species as food for humans and animals through the analysis of seasonal changes and distribution in various organs of C. barbinervis growing under two different geological conditions. We found that C. barbinervis is an accumulating and tolerant plant for Ni, Co and Mn. It accumulates Ni from serpentine soil containing Ni at high concentration, and Co and Mn from acidic soils based on crystalline schist. The seasonal variation in element concentrations in leaves indicates that the young leaves contain Cu at high concentration and that eating them in spring season may be advantageous to humans, due to the associated increase in Cu intake. The high concentrations of Cu and Zn in the bark of C. barbinervis might explain why deer prefer to eat the bark of this species. PMID:26119806

  9. A novel and rapid diagnostic method for discriminating between feces of sika deer and Japanese serow by loop-mediated isothermal amplification. (United States)

    Aikawa, T; Horino, S; Ichihara, Y


    Severe damages to natural vegetation, agriculture, and forestry caused by overpopulation of sika deer (Cervus nippon) have markedly increased in Japan in recent years. To devise a population management plan of sika deer, information on the distribution and population size of the animal in each region is indispensable. An easy and effective method to obtain this information is to count the fecal pellets in the field. However, the habitat of sika deer in Japan overlaps that of Japanese serow (Capricornis crispus). Additionally, it is difficult to discriminate between the feces of both animals. Here, we present a rapid and precise diagnostic method for discriminating between the feces of sika deer and Japanese serow using loop-mediated isothermal amplification (LAMP) targeting cytochrome b gene in the mitochondrial DNA. Our results showed that the LAMP can discriminate between the feces of sika deer and Japanese serow, and the method is simpler and more sensitive than the conventional molecular diagnostic method. Since LAMP method does not require special skills for molecular biology techniques, even the field researchers who have never done a molecular experiment can easily carry out the protocol. In addition, the entire protocol, from DNA extraction from fecal pellet to identification of species, takes only about 75 min and does not require expensive equipment. Hence, this diagnostic method is simple, fast, and accessible to anyone. As such, the method can be a useful tool to estimate distribution and population size of sika deer. PMID:26084704

  10. Animals and their products utilized as medicines by the inhabitants surrounding the Ranthambhore National Park, India

    Directory of Open Access Journals (Sweden)

    Jaroli DP


    Full Text Available Abstract The present ethnozoological study describes the traditional knowledge related to the use of different animals and animal-derived products as medicines by the inhabitants of villages surrounding the Ranthambhore National Park of India (Bawaria, Mogya, Meena, which is well known for its very rich biodiversity. The field survey was conducted from May to July 2005 by performing interviews through structured questionnaires with 24 informants (16 men and 8 women, who provided information regarding therapeutic uses of animals. A total of 15 animals and animal products were recorded and they are used for different ethnomedical purposes, including tuberculosis, asthma, paralysis, jaundice, earache, constipation, weakness, snake poisoning. The zootherapeutic knowledge was mostly based on domestic animals, but some protected species like the collared dove (Streptopelia sp., hard shelled turtle (Kachuga tentoria, sambhar (Cervus unicolor were also mentioned as important medicinal resources. We would suggest that this kind of neglected traditional knowledge should be included into the strategies of conservation and management of faunistic resources in the investigated area.

  11. Climate impacts on bird and plant communities from altered animal-plant interactions (United States)

    Martin, Thomas E.; Maron, John L.


    The contribution of climate change to declining populations of organisms remains a question of outstanding concern. Much attention to declining populations has focused on how changing climate drives phenological mismatches between animals and their food. Effects of climate on plant communities may provide an alternative, but particularly powerful, influence on animal populations because plants provide their habitats. Here, we show that abundances of deciduous trees and associated songbirds have declined with decreasing snowfall over 22 years of study in montane Arizona, USA. We experimentally tested the hypothesis that declining snowfall indirectly influences plants and associated birds by allowing greater over-winter herbivory by elk (Cervus canadensis). We excluded elk from one of two paired snowmelt drainages (10 ha per drainage), and replicated this paired experiment across three distant canyons. Over six years, we reversed multi-decade declines in plant and bird populations by experimentally inhibiting heavy winter herbivory associated with declining snowfall. Moreover, predation rates on songbird nests decreased in exclosures, despite higher abundances of nest predators, demonstrating the over-riding importance of habitat quality to avian recruitment. Thus, our results suggest that climate impacts on plant-animal interactions can have forceful ramifying effects on plants, birds, and ecological interactions.

  12. Epidemiological Study of Animal Leptospirosis in New Caledonia

    Directory of Open Access Journals (Sweden)

    Cédric Roqueplo


    Full Text Available Leptospirosis is an important zoonotic disease in the world and a real public health concern for many years in New Caledonia. A cross-sectional survey was carried out on domestic and wild animals from New Caledonia in April 2009. Blood samples were collected from 30 cattle, 29 deers, (Cervus timorensis russa, 25 horses, 51 dogs, and 8 cats and were tested for 23 serovars of pathogenic Leptospira species by the microscopic agglutination test. From the total number of 143 samples, 84 (58.7% were found to be positive towards one or several serovars of pathogenic leptospires. According to the species, the positive sera were obtained from 43% of 30 cattle, 72% of 29 Rusa deer, 80% of 25 horses, and 43% of 51 dogs, and fromall of the 8 cats tested. This study shows the broad dispersion and the high prevalence of the different serogroups of pathogenic Leptospira species tested, particularly among deer and horses. The disease is endemic in domestic animals and concerns all the species.

  13. Illegitimacy and sibship assignments in oil palm (Elaeis guineensis Jacq.) half-sib families using single locus DNA microsatellite markers. (United States)

    Hama-Ali, Emad Omer; Alwee, Sharifah Shahrul Rabiah Syed; Tan, Soon Guan; Panandam, Jothi Malar; Ling, Ho Chai; Namasivayam, Parameswari; Peng, Hoh Boon


    Oil palm breeding has been progressing very well in Southeast Asia, especially in Malaysia and Indonesia. Despite this progress, there are still problems due to the difficulty of controlled crossing in oil palm. Contaminated/illegitimate progeny has appeared in some breeding programs; late and failure of detection by the traditional method causes a waste of time and labor. The use of molecular markers improves the integrity of breeding programs in perennial crops such as oil palm. Four half-sib families with a total of 200 progeny were used in this study. Thirty polymorphic single locus DNA microsatellites markers were typed to identify the illegitimate individuals and to obtain the correct parental and progeny assignments by using the CERVUS and COLONY programs. Three illegitimate palms (1.5%) were found, and 16 loci proved to be sufficient for sibship assignments without parental genotypes by using the COLONY program. The pairwise-likelihood score (PLS) method was better for half-sib family assignments than the full likelihood (FL) method. PMID:25399079

  14. Prevalence of parasitic infection in captive wild animals in Bir Moti Bagh mini zoo (Deer Park, Patiala, Punjab

    Directory of Open Access Journals (Sweden)

    A. Q. Mir


    Full Text Available Aim: The study was conducted to know the prevalence of gastrointestinal parasites of captive wild animals at Bir Moti Bagh Mini Zoo (Deer Park, Patiala, Punjab. Materials and Methods: A total of 31 fecal samples from eight species of captive animals including Civet cat (Viverra zibetha, Porcupine (Hystrix indica, Nilgai (Boselaphus tragocamelus, Spotted deer (Axis axis, Black buck (Antelope cervicapra, Sambar deer (Cervus unicolor, Hog deer (Axis porcinus, and Barking deer (Muntiacus muntjak were screened using classical parasitological techniques including sedimentation and floatation technique. Results: Out of 31 fecal samples examined, 20 were positive for parasitic ova/oocysts of different species indicating an overall prevalence of 68.0%. The six different types of parasites observed in the study included strongyle (67%, Strongyloides spp. (14%, coccidia (38%, Trichuris spp. (19%, ascarid (10%, and Capillaria spp. (10%. Strongyles were the most common parasites observed (67% followed by coccidia (38%. Mixed helminth and protozoan infection were observed in 48% of animals. No cestode or trematodes were detected during the study. Conclusion: The high prevalence of gastrointestinal parasites without overt clinical signs of disease or mortality as observed in this study is suggestive of subclinical infection. The findings will help in formulating the appropriate deworming protocol for parasitic control in these captive animals.

  15. Genetic structure and conservation of Mountain Lions in the South-Brazilian Atlantic Rain Forest. (United States)

    Castilho, Camila S; Marins-Sá, Luiz G; Benedet, Rodrigo C; Freitas, Thales R O


    The Brazilian Atlantic Rain Forest, one of the most endangered ecosystems worldwide, is also among the most important hotspots as regards biodiversity. Through intensive logging, the initial area has been reduced to around 12% of its original size. In this study we investigated the genetic variability and structure of the mountain lion, Puma concolor. Using 18 microsatellite loci we analyzed evidence of allele dropout, null alleles and stuttering, calculated the number of allele/locus, PIC, observed and expected heterozygosity, linkage disequilibrium, Hardy-Weinberg equilibrium, F(IS), effective population size and genetic structure (MICROCHECKER, CERVUS, GENEPOP, FSTAT, ARLEQUIN, ONESAMP, LDNe, PCAGEN, GENECLASS software), we also determine whether there was evidence of a bottleneck (HYBRIDLAB, BOTTLENECK software) that might influence the future viability of the population in south Brazil. 106 alleles were identified, with the number of alleles/locus ranging from 2 to 11. Mean observed heterozygosity, mean number of alleles and polymorphism information content were 0.609, 5.89, and 0.6255, respectively. This population presented evidence of a recent bottleneck and loss of genetic variation. Persistent regional poaching constitutes an increasing in the extinction risk. PMID:22481876

  16. Genetic structure and conservation of Mountain Lions in the South-Brazilian Atlantic Rain Forest

    Directory of Open Access Journals (Sweden)

    Camila S. Castilho


    Full Text Available The Brazilian Atlantic Rain Forest, one of the most endangered ecosystems worldwide, is also among the most important hotspots as regards biodiversity. Through intensive logging, the initial area has been reduced to around 12% of its original size. In this study we investigated the genetic variability and structure of the mountain lion, Puma concolor. Using 18 microsatellite loci we analyzed evidence of allele dropout, null alleles and stuttering, calculated the number of allele/locus, PIC, observed and expected heterozygosity, linkage disequilibrium, Hardy-Weinberg equilibrium, F IS, effective population size and genetic structure (MICROCHECKER, CERVUS, GENEPOP, FSTAT, ARLEQUIN, ONESAMP, LDNe, PCAGEN, GENECLASS software,we also determine whether there was evidence of a bottleneck (HYBRIDLAB, BOTTLENECK software that might influence the future viability of the population in south Brazil. 106 alleles were identified, with the number of alleles/locus ranging from 2 to 11. Mean observed heterozygosity, mean number of alleles and polymorphism information content were 0.609, 5.89, and 0.6255, respectively. This population presented evidence of a recent bottleneck and loss of genetic variation. Persistent regional poaching constitutes an increasing in the extinction risk.

  17. Rut-induced changes in the activity budgets of male tropical ungulates: Eld’s deer on Hainan Island

    Directory of Open Access Journals (Sweden)

    Jianhua DING, Zhitao LIU, Yanling SONG, Zhigao ZENG, Qiong ZHANG, Benjamin D. BRAVERY


    Full Text Available Aspects of time budgets, activity patterns and rut-related changes in behavior are well documented in temperate ungulates; however, the application of this understanding to tropical and sub-tropical ungulate species has attracted less attention and remains an area that may re-shape our knowledge of ungulate behavior. Eld’s deer Cervus eldi hainanus has a tropical and sub-tropical distribution on Hainan Island, China, and males have an extended rut exceeding five months during which they do not maintain harems or defend resources. We studied males from the only remaining population on Hainan Island, and describe rut-related changes in behavior by collecting data on time budgets and activity patterns. We show that male Eld’s deer do not follow a strict crepuscular activity pattern, do not spend the majority of their time foraging and do not increase foraging nor display rut-induced hypophagia during rut, in obvious contrast to temperate ungulates. These results are discussed in light of current hypotheses explaining the proximate mechanisms governing feeding time in ungulates, while appreciating the need for further research [Current Zoology 58 (4: 536–540, 2012].

  18. Infective larvae of five Onchocerca species from experimentally infected Simulium species in an area of zoonotic onchocerciasis in Japan

    Directory of Open Access Journals (Sweden)

    Fukuda M.


    Full Text Available Microfilariae of five Onchocerca species, O. dewittei japonica (the causative agent of zoonotic onchocerciasis in Oita, Kyushu, Japan from wild boar (Sus scrofa, O. skrjabini and O. eberhardi from sika deer (Cervus nippon, O. lienalis from cattle, and an as yet unnamed Onchocerca sp. from wild boar, were injected intrathoracically into newly-emerged black flies of several species from Oita to search the potential vector(s of these parasites and identify their infective larvae. Development of O. dewittei japonica microfilariae to the infective larvae occurred in Simulium aokii, S. arakawae, S. bidentatum, S. japonicum, S. quinquestriatum, and S. rufibasis while development of infective larvae of O. skrjabini, O. eberhardi, and the unnamed Onchocerca sp. was observed in S. aokii, S. arakawae, and S. bidentatum. Development of O. lienalis microfilaria to infective larvae occurred in S. arakawae. Based on the morphology of infective larvae obtained, we proposed a key of identification of Onchocerca infective larvae found in Oita. We also reconsider the identification of three types of infective larvae previously recovered from Simulium species captured at cattle sheds: the large type I larvae that may be an undescribed species; the small type III identified as O. lienalis may include O. skrjabini too; the intermediary type II that may be O. gutturosa, or O. dewittei japonica, or the unnamed Onchocerca sp. of wild boar.

  19. Onchocerca eberhardi n. sp. (Nematoda: Filarioidea from sika deer in Japan; relationships between species parasitic in cervids and bovids in the Holarctic region

    Directory of Open Access Journals (Sweden)

    Uni S.


    Full Text Available Onchocerca eberhardi n. sp. from the sika deer, Cervus nippon, in Japan is described. Adult worms lived in the carpal ligament; infection reached high levels (up to 25 female and 16 male worms in a single carpal limb. Skin dwelling microfilariae were mainly found in the ears. Prevalence of infection was 81 % at the type locality, Mt. Sobo, in Kyushu. The new material was compared to the 31 species of Onchocerca presently known. Onchocerca eberhardi n. sp. females were characterized by a long slender anterior end and a thin esophagus ≤ 1 mm long with no or only a slight glandular region. The vulva was located near the level of the mid-esophagus and the cuticle had transverse external ridges and internal striae (two striae between adjoining ridges. The most similar species were O. stilesi (re-examined, O. lienalis, and to a lesser extent O. gutturosa, all from bovids (cattle. Two main lineages of Onchocerca are recognized in cervids with either primitive or with derived characteristics (as exemplified by the new species. The species in both lineages are not restricted to cervids but are also found in bovids in the Holarctic region, suggesting that the species diversified in the two host groups simultaneously, when these host groups lived in the same geographic area.

  20. Climate impacts on bird and plant communities from altered animal-plant interactions (United States)

    Martin, Thomas E.; Maron, John L.


    The contribution of climate change to declining populations of organisms remains a question of outstanding concern. Much attention to declining populations has focused on how changing climate drives phenological mismatches between animals and their food. Effects of climate on plant communities may provide an alternative, but particularly powerful, influence on animal populations because plants provide their habitats. Here, we show that abundances of deciduous trees and associated songbirds have declined with decreasing snowfall over 22 years of study in montane Arizona, USA. We experimentally tested the hypothesis that declining snowfall indirectly influences plants and associated birds by allowing greater over-winter herbivory by elk (Cervus canadensis). We excluded elk from one of two paired snowmelt drainages (10 ha per drainage), and replicated this paired experiment across three distant canyons. Over six years, we reversed multi-decade declines in plant and bird populations by experimentally inhibiting heavy winter herbivory associated with declining snowfall. Moreover, predation rates on songbird nests decreased in exclosures, despite higher abundances of nest predators, demonstrating the over-riding importance of habitat quality to avian recruitment. Thus, our results suggest that climate impacts on plant–animal interactions can have forceful ramifying effects on plants, birds, and ecological interactions.

  1. Rut-induced changes in the activity budgets of male tropical ungulates: Eld's deer on Hainan Island

    Institute of Scientific and Technical Information of China (English)

    Jianhua DING; Zhitao LIU; Yanling SONG; Zhigao ZENG; Qiong ZHANG; Benjamin D.BRAVERY


    Aspects of time budgets,activity patterns and rut-related changes in behavior are well documented in temperate ungulates; however,the application of this understanding to tropical and sub-tropical ungulate species has attracted less attention and remains an area that may re-shape our knowledge of ungulate behavior.Eld's deer Cervus eldi hainanus has a tropical and sub-tropical distribution on Hainan Island,China,and males have an extended rut exceeding five months during which they do not maintain harems or defend resources.We studied males from the only remaining population on Hainan Island,and describe rut-related changes in behavior by collecting data on time budgets and activity patterns.We show that male Eld's deer do not follow a strict crepuscular activity pattern,do not spend the majority of their time foraging and do not increase foraging nor display rut-induced hypophagia during rut,in obvious contrast to temperate ungulates.These results are discussed in light of current hypotheses explaining the proximate mechanisms governing feeding time in ungulates,while appreciating the need for further research.

  2. Toxoplasma gondii in wild and domestic animals from New Caledonia. (United States)

    Roqueplo, C; Halos, L; Cabre, O; Davoust, B


    Samples (serum or meat juice) collected from 205 animals in New Caledonia in April 2009 were tested for antibodies against Toxoplasma gondii by ELISA using the multi-species ID Screen® Toxoplasmosis Indirect kit (IDVET, Montpellier). Antibodies to T. gondii were detected in 2% (1/49) of the pigs, in 3.3% (1/30) of the cattle, in 13.8% (4/29) of Rusa deers, in 16% (4/25) of the horses, in 32.8% (21/64) of the dogs, and in 50% (4/8) of cats. Statistically, no significant difference was observed between T. gondii seroprevalence and age or sex. No survey on the prevalence of T. gondii in animals has ever been conducted in New Caledonia and this is the first serological evidence of T. gondii in Rusa deer (Cervus timorensis russa). These results indicate an important circulation of T. gondii exists in the animal populations of New Caledonia. In view of humans being exposed, it is advisable to insist on sanitary education and on respect for good hygienic and food practice. PMID:22091467

  3. Monoterpene effect on feeding choice by deer. (United States)

    Vourc'h, Gwenaël; De Garine-Wichatitsky, Michel; Labbé, Alice; Rosolowski, Dimitri; Martin, Jean-Louis; Fritz, Hervé


    A previous study showed that Sitka black-tailed deer (Odocoileus hemionus sitkensis) consumption was negatively correlated with monoterpene content in western redcedar (Thuja plicata). To test whether these monoterpenes were deterrent to Sitka black-tailed deer, we performed feeding choice experiments with four hydrocarbon (sabinene, myrcene, alpha-pinene, and d + l-limonene) and one oxygenated (alpha,beta-thujone) monoterpene solution at their highest natural concentration in western redcedar foliage. To test whether deer response was species specific, we ran similar experiments on European roe deer (Capreolus capreolus) and rusa deer (Cervus timorensis russa). In all experiments, monoterpenes were repellent. Solutions with alpha,beta-thujone, the major monoterpene in redcedar leaves, were the most repellent of the solutions tested. We then analyzed how black-tailed and roe deer responded to (1) an increase in concentration of the monoterpenes with the weakest repellent effects (hydrocarbon monoterpenes) and (2) a decrease in concentration of the monoterpene with strongest effect (alpha,beta-thujone). Repellency tended to increase with concentration for hydrocarbon monoterpenes, but remained strong for alpha,beta-thujone. As wild deer regularly feed on plants containing monoterpenes, this raises the question as to how the animals deal with these molecules. PMID:12564790

  4. REVIEW: Baluran Nasional Park Savanna

    Directory of Open Access Journals (Sweden)



    Full Text Available One of the biodiversity richness in Indonesia is ecosystem of Baluran National Park savanna. This type of savanna is similar to African savanna that is included in tropical savanna. There are two types of savanna, namely flat and undulating savanna. The savanna ecosystem that covers about 40% of the total area of Baluran National Park has important role on supporting herbivore animals such as wild cattle (Bos javanicus, deer (Cervus timorensis and wild buffalo (Bubalus bubalis. The variety of grasses and other vegetation provide food for those animals, therefore, the reduction of the reduction of quality and quantity of the savanna would reduce in the population of the herbivores. The savanna in the Baluran National Park is about 10.000 ha, however, due to invasion of Acacia nilotica has resulted in the reduction of the savanna reaching about 50%. Moreover, illegal grassing inside the Park has brought negative impact to the quality of the area and the wild fauna. Overgrazing may influence on the reduction of the population of wild fauna. Pressure to the savanna has a great impact on the balance and preservation of whole ecosystem in Baluran. Efforts have been made in order to restore the Baluran ecosystem such as preventing the expansion of A. nilotica as well as preventing illegal grazing. The Baluran National Park is still looking for the most effective and efficient way of preserving savanna ecosystem in Baluran.

  5. Deer Frozen Semen Quality in Tris Sucrose and Tris Glucose Extender with Different Glycerol Concentrations

    Directory of Open Access Journals (Sweden)

    W. M. M. Nalley


    Full Text Available In order to improve Timor deer (Cervus timorensis frozen semen quality, the influence of sugar and glycerol concentration on semen characteristics of sperm was investigated. The semen was collected from five sexually mature Timor deer using an electroejaculator. The semen was evaluated and divided into six equal tubes and diluted with Tris sucrose glycerol 10% (TSG10; Tris sucrose glycerol 12% (TSG12; Tris sucrose glycerol 14% (TSG14; Tris glucose glycerol 10% (TGG10; Tris glucose glycerol 12% (TGG12; and Tris glucose glycerol 14% (TGG14. The diluted semen was packed in 0.3 ml minitub straw, equilibrated at 5 oC for 4 hours and frozen on liquid nitrogen vapor for 10 minutes. The total of forward motility, viability, acrosome integrity and membrane integrity were assessed in fresh, after equilibration and after thawing. Results demonstrated that the percentage of sperm motility in TSG10 was higher (P<0.05 than those diluted in other extenders. The highest viability of sperm was demonstrated in TSG10 (63.93±7.23%. The sperm in TSG10 and TSG14 extender were superior in acrosome as well as in membrane integrity. It was concluded that Tris Sucrose with 10% glycerol protected Timor deer sperm better than other combinations.

  6. Rapid Leptospira identification by direct sequencing of the diagnostic PCR products in New Caledonia

    Directory of Open Access Journals (Sweden)

    Goarant Cyrille


    Full Text Available Abstract Background Most of the current knowledge of leptospirosis epidemiology originates from serological results obtained with the reference Microscopic Agglutination Test (MAT. However, inconsistencies and weaknesses of this diagnostic technique are evident. A growing use of PCR has improved the early diagnosis of leptospirosis but a drawback is that it cannot provide information on the infecting Leptospira strain which provides important epidemiologic data. Our work is aimed at evaluating if the sequence polymorphism of diagnostic PCR products could be used to identify the infecting Leptospira strains in the New Caledonian environment. Results Both the lfb1 and secY diagnostic PCR products displayed a sequence polymorphism that could prove useful in presumptively identifying the infecting leptospire. Using both this polymorphism and MLST results with New Caledonian isolates and clinical samples, we confirmed the epidemiological relevance of the sequence-based identification of Leptospira strains. Additionally, we identified one cluster of L. interrogans that contained no reference strain and one cluster of L. borgpetersenii found only in the introduced Rusa deer Cervus timorensis russa that is its probable reservoir. Conclusions The sequence polymorphism of diagnostic PCR products proved useful in presumptively identifying the infecting Leptospira strains. This could contribute to a better understanding of leptospirosis epidemiology by providing epidemiological information that cannot be directly attained from the use of PCR as an early diagnostic test for leptospirosis.

  7. Epidemiological study of animal leptospirosis in new caledonia. (United States)

    Roqueplo, Cédric; Cabre, Olivier; Davoust, Bernard; Kodjo, Angeli


    Leptospirosis is an important zoonotic disease in the world and a real public health concern for many years in New Caledonia. A cross-sectional survey was carried out on domestic and wild animals from New Caledonia in April 2009. Blood samples were collected from 30 cattle, 29 deers, (Cervus timorensis russa), 25 horses, 51 dogs, and 8 cats and were tested for 23 serovars of pathogenic Leptospira species by the microscopic agglutination test. From the total number of 143 samples, 84 (58.7%) were found to be positive towards one or several serovars of pathogenic leptospires. According to the species, the positive sera were obtained from 43% of 30 cattle, 72% of 29 Rusa deer, 80% of 25 horses, and 43% of 51 dogs, and fromall of the 8 cats tested. This study shows the broad dispersion and the high prevalence of the different serogroups of pathogenic Leptospira species tested, particularly among deer and horses. The disease is endemic in domestic animals and concerns all the species. PMID:23533965

  8. Bartonellae in animals and vectors in New Caledonia. (United States)

    Mediannikov, Oleg; Davoust, Bernard; Cabre, Olivier; Rolain, Jean-Marc; Raoult, Didier


    Bartonellae are gram-negative facultative intracellular alpha-proteobacteria from the family Bartonellaceae. The natural history of bartonellae consists of a reservoir/host, which is a vertebrate with chronic intravascular infection with sustained bacteremia, and a vector (usually an arthropod) that transfers the bacteria from the reservoir to a susceptible yet uninfected host. In order to reveal the sources and reservoirs of Bartonella infection in animals and vectors in New Caledonia, we collected the blood samples of 64 dogs, 8 cats, 30 bovines, 25 horses and 29 wild deer Cervus timorensis russa and 308 associated blood-sucking parasites (14 keds Hippobosca equina, 258 ticks (22 Rhipicephalus microplus, 235 Rhipicephalus sanguineus, and 1 Haemaphysalis longicornis), 12 fleas Ctenocephalides felis and 24 dog lice Trichodectes canis). We isolated ten strains of Bartonella: four Bartonella henselae from cats and six Bartonella chomelii from cattle. The strains were characterized by sequencing of five genes (16S, ITS, rpoB, gltA and ftsZ). The six strains isolated from cattle were close to the reference strain of B. chomelii and were, probably, imported from France with cattle of Limousin race. PCR showed that 35% of keds collected from deer and 31% of deer were infected by B. aff. schoenbuchensis; all other samples were negative. Our data confirmed that in New Caledonia, as in other regions of the world, cats are the major reservoirs of B. henselae. We also confirmed that Hippoboscidae flies may serve as the vectors of ruminant-associated bartonellae. PMID:22018646

  9. Toxoplasma gondii in wild and domestic animals from New Caledonia

    Directory of Open Access Journals (Sweden)

    Roqueplo C.


    Full Text Available Samples (serum or meat juice collected from 205 animals in New Caledonia in April 2009 were tested for antibodies against Toxoplasma gondii by ELISA using the multi-species ID Screen® Toxoplasmosis Indirect kit (IDVET, Montpellier. Antibodies to T. gondii were detected in 2% (1/49 of the pigs, in 3.3% (1/30 of the cattle, in 13.8% (4/29 of Rusa deers, in 16% (4/25 of the horses, in 32.8% (21/64 of the dogs, and in 50% (4/8 of cats. Statistically, no significant difference was observed between T. gondii seroprevalence and age or sex. No survey on the prevalence of T. gondii in animals has ever been conducted in New Caledonia and this is the first serological evidence of T. gondii in Rusa deer (Cervus timorensis russa. These results indicate an important circulation of T. gondii exists in the animal populations of New Caledonia. In view of humans being exposed, it is advisable to insist on sanitary education and on respect for good hygienic and food practice.

  10. Full length cDNA cloning and expression analysis of annexinA2 gene from deer antler tissue

    Institute of Scientific and Technical Information of China (English)

    Li Hao; Xianghong Xiao; Heping Li


    ANXA2(AnnexinA2), a calcium-dependent phospholipid bind-ing protein, is involved in various Ca2+-related biological activities. In the present study, full-length cDNA of ANXA2 was isolated from the velvet antler tip tissue of sika deer (Cervus nippon hortulorum);the amino acid sequence and gene expression was analyzed by using bioinformatics and real-time reverse transcriptase polymerase chain reaction (RT-PCR) techniques. Nucleotide sequence analysis reveals that the full-length cDNA of the ANXA2 gene was 1372 bp, of which 1020 bp was in the open-reading frame (ORF) encoding 339 amino acids; its relative mo-lecular weight was 38.3 kDa; and isoelectric point was 6.72. Sequence analysis indicates that the protein includes four conserved tan-dem-duplication ANX domains. The gene-accession nucleotide sequence number in GenBank is JX315571. Expression analysis by RT-PCR re-veals that ANXA2 gene expression has a significant positive correlation with the antler-tissue mineralization process, indicating that this gene may play an important role in the regulation of antler-tissue mineraliza-tion.

  11. Radiocesium Concentration Change in Game Animals: Use of Food Monitoring Data - 13168

    International Nuclear Information System (INIS)

    Radionuclides were released into the environment in the Fukushima Daiichi Nuclear Power Plant (FDNPP) accident. Radiocesium (Cs-134+137) concentrations in most agricultural products became lower than the detection limit (∼10 Bq kg-1) from June 2011, and the concentrations have remained low. However, some wild food materials such as meat of game animals (e.g., bear and wild boar) caught in Fukushima and surrounding areas some times showed higher values than the detection limits. In this study, monitoring data on game animal meat were summarized to understand the amount of activities found in wild animals and the activity distribution in the contaminated areas. Concentration data are available from monthly reports issued by the Ministry of Health, Labour and Welfare. Data were collected on wild boar (Sus scrofa), deer (Cervus nippon), Asian black bear (Ursus thibetanus), Japanese pheasant (Phasianus versicolor), and duck (e.g. Anas poecilorhynch). There is a tendency that the concentration decreases with distance from the FDNPP; in order to compare the Cs-137 concentrations among animals, one collection site was selected. The results showed that the concentration was in the following order within one year: Asian black bear>wild boar> deer >duck and Japanese pheasant. Bear and boar are omnivorous animals and their feeding pattern would affect the concentrations in their meats. (authors)

  12. Effect of Predation Risk on Prey Population Dynamics and Its Mechanisms%捕食风险的种群动态效应及其作用机理研究进展

    Institute of Scientific and Technical Information of China (English)



    Predators can not only control population size of prey through direct killing, but also influence reproductive outputs and population dynamics of prey through predation risk effects, which are the costs incurred by prey' s anti-predator behavioral change. Predation risk effects can have even stronger influences on prey population dynamics than direct killing of prey, but there have been relatively smaller number of field studies about the impacts of predation risk effects on population dynamics of preys during the past decades. This paper reviews the progress of researches about predation risk effects on population dynamics of preys with emphasis on introduction of several classical case studies involving Wolf ( Canis lupus) -Elk ( Cervus elephus) system in Yellowstone National Park of USA and Predator-snowshoe Hare (Lepus americanus) system in Yukon of Canada. This paper elaborates two hypotheses ( predator-sensitive-food hypothesis and predation stress hypothesis) that have been proposed to illustrate the mechanisms underlying the impacts of predation risk on nutrition, reproduction and population dynamics of preys. There is evidence to support both hypotheses, but more researches are needed to further verify them. Considering that there have been few field studies about predation risk effects on prey population dynamics in China and the fact that many endangered species are facing increasing natural and anthropogenic stresses in China, I put forward recommendations and urge to conduct researches on predation risk effects ( in addition to direct predation effects) on population dynamics of endangered ungulate preys in China.%捕食者不但可以通过直接捕杀猎物而控制猎物的种群数量,还可以通过捕食风险效应影响猎物种群的繁殖和动态,并且在某些情况下,捕食风险效应对猎物种群动态的控制作用甚至大于捕食者的直接捕杀.关于捕食风险效应对猎物动物繁殖产出和种群动态变化的作用

  13. Stable isotope records of inland California megafauna - new insights into Pleistocene paleoecology and paleoenvironmental conditions (United States)

    Trayler, R. B.; Dundas, R. G.; Van De Water, P. K.; Fox-Dobbs, K.


    Paleodietary studies of California megafauna have focused primarily on the coastal late Pleistocene Rancho La Brea tar seeps (RLB) in Los Angeles, while other sites remain understudied. We examined two Pleistocene fossil localities from inland California (San Joaquin Valley) and report δ13C and δ18O values measured from tooth enamel of mammalian megafauna at both sites. The late Pleistocene McKittrick tar seeps in Kern County has a similar fauna to RLB. The middle Irvingtonian (~700,000 year old) Fairmead Landfill site, near Chowchilla, contains a megafaunal assemblage dominated by Equus, Camelops and Mammuthus. We used stable isotope values measured in carnivore and herbivore tooth enamel to investigate paleodietary and paleoecological patterns at both sites. δ13C values of tooth enamel is controlled by diet and can be used to investigate resource usage and partitioning among and between taxa. In large mammals δ18O ratios are controlled by drinking water, and by proxy, climate. Ontogenetic serial tooth δ18O and δ13C reveal seasonal trends in resource usage, from which we can infer patterns of forage availability. We sampled 85 individuals from 16 taxa; Arctodus, Bison, Camelops, Canis, Capromeryx, Cervus, Equus, Hemiauchenia, Homotherium, Mammut, Mammuthus, Miracinonyx, Panthera, Platygonus, Smilodon and Tetrameryx. Faunal δ13C differ significantly (pherbivores, though several other taxa are represented by single individuals, thus lacking dietary ranges. Among carnivores, Smilodon had the lowest δ13C values (-13.4‰) and Canis latrans the highest (-10.7‰). Carnivore δ13C values only partially overlap the observed range of herbivore values suggesting that not all herbivores were consumed with the same frequency. In comparison to Fairmead, δ13C values from McKittrick show a significant shift in isotopic values suggesting greater C4 plant availability from middle to late Pleistocene. Camelops showed the greatest shift towards C4 plants values, while

  14. Genetic Polymorphisms of 21 Non-CODIS STR Loci%21个非CODIS STR基因座的遗传多态性

    Institute of Scientific and Technical Information of China (English)

    邵伟波; 张素华; 李莉


    Objective To investigate genetic polymorphisms of 21 non-CODIS STR loci in Han population from the east of China and to explore their forensic application value. Methods Twenty-one non-CODIS STR loci, were amplified with AGCU 21+1 STR kit and DNA samples were obtained from 225 unrelated individuals of the Hah population from the east of China. The PCR products were analyzed with 3130 Genetic Analyzer and genotyped with GeneMapper ID v3.2 software. The genetic data were statistically analyzed with PowerStats vl2.xls and Cervus 2.0 software. Results The distributions of 21 non-CODIS STR loci satisfied the Hardy-Weinberg equilibration. The heterozygosity (H) distributions were 0.596-0.804, the diserimination power (DP) were 0.764-0.948, the probability of exclusion of duo-testing (PEduo) were 0.1760.492, the probability of exclusion of trios-testing (PEso) were 0.334-0.663, and the polymorphic information content (PIC) were 0.522-0.807. The cumulative probability of exclusion (CPE) of duo-testing was 0.999 707, the CPE of trios-testing was 0.999 9994, and the cumulated discrimination power (CDP) was 0.99999999999999999994. Conclusion Twenty-one non-CODIS STR loci are highly polymorphie. They can be effectively used in personal identification and paternity testing in trios cases. They can also be used as supplement in the difficult cases of diad paternity testing.%目的 调查华东汉族人群21个非CODIS STR基因座的遗传多态性并评价其法医学应用价值.方法 用AGCU 21+1 STR试剂盒,对华东地区汉族225个无关个体的21个非CODIS STR基因座进行扩增,用3130遗传分析仪检测扩增产物,GeneMapper ID v3.2软件进行分型,采用PowerStats v12.xls和Cervus 2.0分析软件计算常用法医遗传学参数.结果 21个非CODIS STR基因座的频率分布在本组人群中均符合Hardy-Weinberg平衡.杂合度分布为0.596~0.804,个体识别率为0.764~0.948,二联体非父排除率(PEduo)为0.176~0.492,三

  15. Paternity analysis in Excel. (United States)

    Rocheta, Margarida; Dionísio, F Miguel; Fonseca, Luís; Pires, Ana M


    Paternity analysis using microsatellite information is a well-studied subject. These markers are ideal for parentage studies and fingerprinting, due to their high-discrimination power. This type of data is used to assign paternity, to compute the average selfing and outcrossing rates and to estimate the biparental inbreeding. There are several public domain programs that compute all this information from data. Most of the time, it is necessary to export data to some sort of format, feed it to the program and import the output to an Excel book for further processing. In this article we briefly describe a program referred from now on as Paternity Analysis in Excel (PAE), developed at IST and IBET (see the acknowledgments) that computes paternity candidates from data, and other information, from within Excel. In practice this means that the end user provides the data in an Excel sheet and, by pressing an appropriate button, obtains the results in another Excel sheet. For convenience PAE is divided into two modules. The first one is a filtering module that selects data from the sequencer and reorganizes it in a format appropriate to process paternity analysis, assuming certain conventions for the names of parents and offspring from the sequencer. The second module carries out the paternity analysis assuming that one parent is known. Both modules are written in Excel-VBA and can be obtained at the address ( They are free for non-commercial purposes and have been tested with different data and against different software (Cervus, FaMoz, and MLTR). PMID:17928093

  16. Sperm dispersal distances estimated by parentage analysis in a brooding scleractinian coral. (United States)

    Warner, Patricia A; Willis, Bette L; van Oppen, Madeleine J H


    Within populations of brooding sessile corals, sperm dispersal constitutes the mechanism by which gametes interact and mating occurs, and forms the first link in the network of processes that determine specieswide connectivity patterns. However, almost nothing is known about sperm dispersal for any internally fertilizing coral. In this study, we conducted a parentage analysis on coral larvae collected from an area of mapped colonies, to measure the distance sperm disperses for the first time in a reef-building coral and estimated the mating system characteristics of a recently identified putative cryptic species within the Seriatopora hystrix complex (ShA; Warner et al. 2015). We defined consensus criteria among several replicated methods (COLONY 2.0, CERVUS 3.0, MLTR v3.2) to maximize accuracy in paternity assignments. Thirteen progeny arrays indicated that this putative species produces exclusively sexually derived, primarily outcrossed larvae (mean t(m) = 0.999) in multiple paternity broods (mean r(p) = 0.119). Self-fertilization was directly detected at low frequency for all broods combined (2.8%), but comprised 23% of matings in one brood. Although over 82% of mating occurred between colonies within 10 m of each other (mean sperm dispersal = 5.5 m ± 4.37 SD), we found no evidence of inbreeding in the established population. Restricted dispersal of sperm compared to slightly greater larval dispersal appears to limit inbreeding among close relatives in this cryptic species. Our findings establish a good basis for further work on sperm dispersal in brooding corals and provide the first information about the mating system of a newly identified and abundant cryptic species. PMID:26818771

  17. Susceptible conditions for debarking by deer in subalpine coniferous forests in central Japan

    Institute of Scientific and Technical Information of China (English)

    Hayato Iijima; Takuo Nagaike


    Background:Recently, deer have expanded their distribution to higher altitude ranges including subalpine forests. However, culling deer and construction of deer fence in subalpine forests are difficult because of steep slopes and complex topography. Thus it is necessary to clarify the factors which are associated with debarking by deer for the effective protection of subalpine forests. In this study, we examined which factors are associated with debarking by sika deer (Cervus nippon) in subalpine coniferous forests. Methods:We conducted our survey in Minami-Alps National Park, central Japan. We established 24 10 m × 40 m plots and surveyed the occurrence of debarking on saplings>30 cm in height and3 cm in DBH, as well as sapling density within each plot. Minimum distances to nearest grassland of plots were calculated (tentatively assuming grassland would attract deer and would cause high debarking pressure in the surrounding subalpine forests). Results:The mean percentage of debarked live saplings was higher than that of live trees. The mean percentage of debarked saplings which had already died was 81.6 %. Debarking of saplings increased with lower elevation, taller sapling size, and marginally increased near grassland. Sapling density was lower in plots with low basal area of conspecific trees near grassland and differed among species. Sapling density marginally decreased with decreasing elevation and increasing stand tree density. Debarking of trees was positively related to small DBH and low elevation, and marginally increased near grassland and differed among species. Conclusions:Our results suggest that tall saplings in subalpine forests of low elevation or near subalpine grassland were susceptible to debarking by deer and monitoring of these areas may permit the early detection of the impacts of deer in subalpine coniferous forests.

  18. Habitat selection by Eld's deer following relocation to a patchy landscape.

    Directory of Open Access Journals (Sweden)

    Duo Pan

    Full Text Available An emerging issue in wildlife conservation is the re-establishment of viable populations of endangered species in suitable habitats. Here, we studied habitat selection by a population of Hainan Eld's deer (Cervus eldi relocated to a patchy landscape of farmland and forest. Hainan Eld's deer were pushed to the brink of extinction in the 1970s, but their population expanded rapidly from 26 to more than 1000 individuals by 2003 through effective reserve protection. As part of a wider relocation and population management strategy, 131 deer were removed from the reserve and reintroduced into a farmland-forest landscape in 2005. Habitat use under a context of human disturbance was surveyed by monitoring 19 radio-collared animals. The majority of deer locations (77% were within 0.6-2 km of villages. Annual home ranges of these collared deer averaged 725 ha (SD 436, which was 55% of the size of the reserve from which they had originated. The annual home ranges contained 54% shrub-grassland, 26% forest and 15% farmland. The relocated deer population selected landscape comprising slash-and-burn agriculture and forest, and avoided both intensively farmed areas and areas containing only forest. Within the selected landscape, deer preferred swiddens and shrub-grasslands. Forests above 300 m in elevation were avoided, whereas forests below 300 m in elevation were overrepresented during the dry season and randomly used during the wet season. Our findings show that reintroduced deer can utilize disturbed habitats, and further demonstrate that subsistence agroforest ecosystems have the capacity to sustain endangered ungulates.

  19. PLAG (1-Palmitoyl-2-Linoleoyl-3-Acetyl-rac-Glycerol) Modulates Eosinophil Chemotaxis by Regulating CCL26 Expression from Epithelial Cells. (United States)

    Jeong, Jinseon; Kim, Young-Jun; Yoon, Sun Young; Kim, Yong-Jae; Kim, Joo Heon; Sohn, Ki-Young; Kim, Heung-Jae; Han, Yong-Hae; Chong, Saeho; Kim, Jae Wha


    Increased number of eosinophils in the circulation and sputum is associated with the severity of asthma. The respiratory epithelium produces chemokine (C-C motif) ligands (CCL) which recruits and activates eosinophils. A chemically synthesized monoacetyl-diglyceride, PLAG (1-palmitoyl-2-linoleoyl-3-acetyl-rac-glycerol) is a major constituent in the antlers of Sika deer (Cervus nippon Temminck) which has been used in oriental medicine. This study was aimed to investigate the molecular mechanism of PLAG effect on the alleviation of asthma phenotypes. A549, a human alveolar basal epithelial cell, and HaCaT, a human keratinocyte, were activated by the treatment of interleukin-4 (IL-4), and the expression of chemokines, known to be effective on the induction of eosinophil migration was analyzed by RT-PCR. The expression of IL-4 induced genes was modulated by the co-treatment of PLAG. Especially, CCL26 expression from the stimulated epithelial cells was significantly blocked by PLAG, which was confirmed by ELISA. The transcriptional activity of signal transducer and activator of transcription 6 (STAT6), activated by IL-4 mediated phosphorylation and nuclear translocation, was down-regulated by PLAG in a concentration-dependent manner. In ovalbumin-induced mouse model, the infiltration of immune cells into the respiratory tract was decreased by PLAG administration. Cytological analysis of the isolated bronchoalveolar lavage fluid (BALF) cells proved the infiltration of eosinophils was significantly reduced by PLAG. In addition, PLAG inhibited the migration of murine bone marrow-derived eosinophils, and human eosinophil cell line, EoL-1, which was induced by the addition of A549 culture medium. PMID:27010397

  20. The presence of a mycangium in European Sinodendron cylindricum (Coleoptera: Lucanidae) and the associated yeast symbionts (United States)

    Tanahashi, Masahiko; Hawes, Colin J.


    Part of the exoskeleton of some wood-inhabiting insects is modified to form a mycangium, which is a specialized organ used to convey fungal spores or yeasts to their offspring. Although most stag beetles (Coleoptera: Lucanidae) are known to have female-specific mycangia and associated yeast symbionts, the evolutionary origin of the mycangium in this group remains unresolved. Here, we report the presence of a mycangium and associated yeast symbionts in the European horned stag beetle Sinodendron cylindricum (L.), which belongs to an ancestral clade of the Lucanidae. The mycangium of S. cylindricum is shown to be female-specific and have the same developmental origin as that of other stag beetles. A total of five yeast strains were isolated from adult mycangia and larval gut of S. cylindricum. Of these, we suggest that SICYAM1 is an undescribed yeast with taxonomic novelty, and have identified SICYLG3 as the xylose-fermenting yeast Scheffersomyces insectosa using nuclear ribosomal RNA and ITS sequences. The remaining three yeast strains, SICYAM2, SICYLG1, and SICYLG2, were assigned to the genus Sugiyamaella. Yeast density in the adult mycangium was lower than that of the more evolutionarily advanced stag beetles, the European Lucanus cervus (L.) and Dorcus parallelipipedus (L.), which were also examined in this study. No living yeasts were isolated from the adult guts. However, a third instar larva of S. cylindricum harbored 104–106 living yeasts in each gut region, which suggests that gut yeasts play an important role in these wood-feeding larvae. PMID:27432353

  1. Copulatory pattern and behavior in a semi-captive population of Eld's deer

    Institute of Scientific and Technical Information of China (English)

    Zhigao ZENG; Yan-Ling SONG; Qiong ZHANG


    Male copulatory patterns, female multiple copulation and male post-copulatory guarding were studied in Eld's deer Cervus eldi in Datian National Nature Reserve, China. Mating behavior in 18 females and 11 males from a group of 61 semi-captive Eld's deer were observed. The majority (55.8%) of copulations occurred between 15:00-19:00 h. The ejaculatory mount was preceded by an average of 5.1 prior mounts. Successful copulation consisted of a single thrust with ejaculation during one intromission, with no lock. This copulatory pattern is classified as pattern No. 15 (no lock, no intravaginal thrusting, single intromission, and multiple ejaculation) and No. 16 (no lock, no intravaginal thrusting, single intromission, and single ejaculation) under Dewsbury's scheme (1972) and as No. 16 (no lock, no thrusting, single and brief intromission) under Dixson's classification (1998). Copulation frequency was 1.5 0.9 times for males/ females with the same female/male per day. The duration of the final mount, which included ejaculation, was brief (3.4±1.3 s), and ejaculation usually terminated copulation. Eleven females copulated more than once in this study: three of them copulated with several males (multi-male copulations) and the remainder copulated with a single male (repeated copulations). Our results indicate that some female Eld's deer may seek multiple copulations to be a strategy to improve the genetic quality of their offspring or to avoid harassment. Post-copulatory guarding of females by males followed all copulations, with dominant males guarding for significantly longer than subordinate males. Dominant males appear to be more effective at post-copulatory guarding than subordinate males. Subordinate males engaged in a quicker pre-copulatory phase to improve their chances of finishing copulation before being forced to accede to dominant males.

  2. A generic impact-scoring system applied to alien mammals in Europe. (United States)

    Nentwig, Wolfgang; Kühnel, Elfi; Bacher, Sven


    We present a generic scoring system that compares the impact of alien species among members of large taxonomic groups. This scoring can be used to identify the most harmful alien species so that conservation measures to ameliorate their negative effects can be prioritized. For all alien mammals in Europe, we assessed impact reports as completely as possible. Impact was classified as either environmental or economic. We subdivided each of these categories into five subcategories (environmental: impact through competition, predation, hybridization, transmission of disease, and herbivory; economic: impact on agriculture, livestock, forestry, human health, and infrastructure). We assigned all impact reports to one of these 10 categories. All categories had impact scores that ranged from zero (minimal) to five (maximal possible impact at a location). We summed all impact scores for a species to calculate "potential impact" scores. We obtained "actual impact" scores by multiplying potential impact scores by the percentage of area occupied by the respective species in Europe. Finally, we correlated species' ecological traits with the derived impact scores. Alien mammals from the orders Rodentia, Artiodactyla, and Carnivora caused the highest impact. In particular, the brown rat (Rattus norvegicus), muskrat (Ondathra zibethicus), and sika deer (Cervus nippon) had the highest overall scores. Species with a high potential environmental impact also had a strong potential economic impact. Potential impact also correlated with the distribution of a species in Europe. Ecological flexibility (measured as number of different habitats a species occupies) was strongly related to impact. The scoring system was robust to uncertainty in knowledge of impact and could be adjusted with weight scores to account for specific value systems of particular stakeholder groups (e.g., agronomists or environmentalists). Finally, the scoring system is easily applicable and adaptable to other

  3. Cloven-hoofed animals spatial activity evaluation methods in Doupov Mountains in the Czech Republic

    Directory of Open Access Journals (Sweden)

    J. Jarolímek, J. Masner, M. Ulman, S. Dvořák


    Full Text Available The focus of the project „Collection and interpretation of positional data“ is placed on the use of positional data (or the information about a moving object in the scientific research and educational activities in various fields such as environmental science, logistics, spatial data infrastructure, information management, and others. The objective of this effort is to create an universal model for collection and presentation of moving objects data retrieved through GPS (Global Positioning System, and to verify the model in practice.Several different approaches to process and visualize data about sika deer (Cervus nippon spatial movements in Doupov Mountains are described in the paper. The data base is represented with large data files created through the cooperation of the Faculty of Forestry and Wood Sciences at the Czech University of Life Sciences in Prague and the Military Forests and Estates of the Czech Republic, a state-owned enterprise.Pieces of knowledge introduced in this paper resulted from solution of an institutional research intention. Internal grant agency of the Faculty of Economics and Management, Czech University of Life Sciences in Prague, grant no. 20121043, „Sběr a interpretace pozičních dat“.The results of the cloven-hoofed animals spatial activity evaluation methods will be available for Research Program titled “Economy of the Czech Agriculture Resources and Their Efficient Use within the Framework of the Multifunctional Agri-food Systems” of the Czech Ministry of Education, Youth and Sports number VZ MSM 6046070906.

  4. Molecular genetic conspecificity of Spiculopteragia houdemeri (Schwartz, 1926) and S. andreevae (Dróżdż, 1965) (Nematoda: Ostertagiinae) from wild ruminants in Japan. (United States)

    Sultan, K; Omar, M; Makouloutou, P; Kaneshiro, Y; Saita, E; Yokoyama, M; Suzuki, K; Hosoi, E; Sato, H


    Male dimorphism of the subfamily Ostertagiinae (Nematoda: Trichostrongylidae) is a well-known phenomenon, and two or more morphotypes of a single species have previously been described as different species. Two Spiculopteragia spp., S. houdemeri (syn. S. yamashitai) and S. andreevae (syn. Rinadia andreevae) recorded in Asian cervids and wild bovids, are considered to represent major and minor morphs of S. houdemeri, respectively, based solely on their co-occurrence in the same host individual along with monomorphic females. In this study, males of morph houdemeri ( = S. houdemeri) and morph andreevae ( = S. andreevae) as well as females with three different vulval ornamentations were collected from sika deer (Cervus nippon) and Japanese serows (Capricornis crispus) distributed on the mainland of Japan. Morphologically characterized worms were subjected to molecular genetic analyses based on the internal transcribed spacer region of the ribosomal RNA gene and a partial region of the cytochrome c oxidase subunit I gene of mitochondrial DNA. Of 181 collected sika deer, 177 (97.8%) and 73 (40.3%) deer harboured males of morphs houdemeri and andreevae, respectively. Worm numbers of the former morph were found to range between 1 and 444 per individual, whereas only 1-25 worms per individual were detected for the latter morph. Five out of six serows harboured 47-71 or 2-9 males of morphs houdemeri and andreevae per individual, respectively. Females with one or two vulval flaps were predominant, but there was a substantial presence of flapless females in both host species. All the morphs of male and female adults had an identical genetic background, thus directly confirming the morphological polymorphism of S. houdemeri. PMID:23168162

  5. Temporal variation in site fidelity: scale-dependent effects of forage abundance and predation risk in a non-migratory large herbivore. (United States)

    van Beest, F M; Vander Wal, E; Stronen, A V; Paquet, P C; Brook, R K


    Large herbivores are typically confronted by considerable spatial and temporal variation in forage abundance and predation risk. Although animals can employ a range of behaviours to balance these limiting factors, scale-dependent movement patterns are expected to be an effective strategy to reduce predation risk and optimise foraging opportunities. We tested this prediction by quantifying site fidelity of global positioning system-collared, non-migratory female elk (Cervus canadensis manitobensis) across multiple nested temporal scales using a long-established elk-wolf (Canis lupus) system in Manitoba, Canada. Using a hierarchical analytical approach, we determined the combined effect of forage abundance and predation risk on variation in site fidelity within four seasons across four nested temporal scales: monthly, biweekly, weekly, daily. Site fidelity of female elk was positively related to forage-rich habitat across all seasons and most temporal scales. At the biweekly, weekly and daily scales, elk became increasingly attached to low forage habitat when risk was high (e.g. when wolves were close or pack sizes were large), which supports the notion that predator-avoidance movements lead to a trade-off between energetic requirements and safety. Unexpectedly, predation risk at the monthly scale increased fidelity, which may indicate that elk use multiple behavioural responses (e.g. movement, vigilance, and aggregation) simultaneously to dilute predation risk, especially at longer temporal scales. Our study clearly shows that forage abundance and predation risk are important scale-dependent determinants of variation in site fidelity of non-migratory female elk and that their combined effect is most apparent at short temporal scales. Insight into the scale-dependent behavioural responses of ungulate populations to limiting factors such as predation risk and forage variability is essential to infer the fitness costs incurred. PMID:23552985

  6. Distribution of wild mammal assemblages along an urban-rural-forest landscape gradient in warm-temperate East Asia. (United States)

    Saito, Masayuki; Koike, Fumito


    Urbanization may alter mammal assemblages via habitat loss, food subsidies, and other factors related to human activities. The general distribution patterns of wild mammal assemblages along urban-rural-forest landscape gradients have not been studied, although many studies have focused on a single species or taxon, such as rodents. We quantitatively evaluated the effects of the urban-rural-forest gradient and spatial scale on the distributions of large and mid-sized mammals in the world's largest metropolitan area in warm-temperate Asia using nonspecific camera-trapping along two linear transects spanning from the urban zone in the Tokyo metropolitan area to surrounding rural and forest landscapes. Many large and mid-sized species generally decreased from forest landscapes to urban cores, although some species preferred anthropogenic landscapes. Sika deer (Cervus nippon), Reeves' muntjac (Muntiacus reevesi), Japanese macaque (Macaca fuscata), Japanese squirrel (Sciurus lis), Japanese marten (Martes melampus), Japanese badger (Meles anakuma), and wild boar (Sus scrofa) generally dominated the mammal assemblage of the forest landscape. Raccoon (Procyon lotor), raccoon dog (Nyctereutes procyonoides), and Japanese hare (Lepus brachyurus) dominated the mammal assemblage in the intermediate zone (i.e., rural and suburban landscape). Cats (feral and free-roaming housecats; Felis catus) were common in the urban assemblage. The key spatial scales for forest species were more than 4000-m radius, indicating that conservation and management plans for these mammal assemblages should be considered on large spatial scales. However, small green spaces will also be important for mammal conservation in the urban landscape, because an indigenous omnivore (raccoon dog) had a smaller key spatial scale (500-m radius) than those of forest mammals. Urbanization was generally the most important factor in the distributions of mammals, and it is necessary to consider the spatial scale of

  7. Genetic Diversity of Bali Cattle Based on Microsatellite Marker in Indonesian Breeding Centre

    Directory of Open Access Journals (Sweden)

    W. A. Septian


    Full Text Available Genetics characterization in livestock based on microsatellite has been widely implemented including for Bali cattle in three different breeding centres in Indonesia. This study aimed to determine diversity of Bali cattle microsatellites in three breeding centers namely BPTU Bali cattle in Bali, BPT-HMT Serading Sumbawa in West Nusa Tenggara, and Village Breeding Center in South Sulawesi. The number of animals used in this study was 95 head of cattle consisted of 32 heads from BPTU Bali Province, 32 heads from BPT-HMT Serading Sumbawa, and 31 heads from Village Barru Breeding Center Barru distric. Microsatellite loci used to determine the diversity was the locus SPS115, INRA037, MM12, and ETH185 based on flourescently labeled fragment method. Data analysis of microsatellite in Bali cattle at three different locations was performed by using POPGEN 1.2, Cervus, and POPTREE2 programs. The results showed that microsatellite diversity in Bali cattle detected 32 alleles from three different locations, and there were specific alleles at each location. Average values of observed heterozygosity (Ho and expected heterozygosity (He were 0.418 and 0.604 respectively, while the average value of polymorphism informative content (PIC was 0.579. The Hardy-Weinberg equilibrium in general suggested that the loci used in the Bali cattle in three populations were in equilibrium, except INRA037 and ETH185. The genetic diversity between populations of Bali cattle was 0.033 (3%, while the inbreeding coefficient index in all populations was 0.296 (29.6 %. Bali cattle phylogeny tree with three populations showed that the populations of Bali cattle in BPTU Bali and VBC Barru had close genetic distance compared to the population of Bali cattle in BPT-HMT Serading Sumbawa. The results of this study provide information that the characteristics of Bali cattle breeding centers in three locations are different, so we need a directed breeding program in each population.

  8. Nuclear microsatellite markers for population genetic studies in sugar maple (Acer saccharum Marsh.

    Directory of Open Access Journals (Sweden)

    Sudhir Khodwekar


    Full Text Available A set of seven new nuclear microsatellite markers (nSSRs was developedfor sugar maple (Acer saccharum Marsh. using paired-end Illumina sequencing. Out of 96 primers screened in a panel of six unrelated individuals, seven markers amplified polymorphic products. The utility of these markers, in addition to six already published microsatellites, for genetic variation and gene flow studies was assessed. Out of the seven newly developed markers, three amplified multiple fragments and were interpreted as dominant (absence/presence markers, while four markers amplified a maximum of two amplification products per sample. The six published microsatellites and three of the four newly developed markers showed regular segregation in an open-pollinated single tree progeny. Observed heterozygosity (Ho and expected heterozygosity (He in 48 individuals from one population ranged from 0.436 to 0.917 and from 0.726 to 0.894, respectively. Dominant markers revealed 64 variable positions and moderate genetic variation within the population (He = 0.102, Shannon’s I = 0.193. Paternity analyses in the program CERVUS at co-dominant markers showed effective dispersal of pollen in the sugar maple population both at 95% and 80% confidence levels. Dependent on the confidence level, the mean pollen dispersal distance within the population ranged from 33.25 m to 38.75 m and gene flow from utside the stand from 78% to 82%. The absence of fine-scale Spatial Genetic Structure (SGS suggested effective dispersal of both seeds and pollen.

  9. Distribution of wild mammal assemblages along an urban-rural-forest landscape gradient in warm-temperate East Asia.

    Directory of Open Access Journals (Sweden)

    Masayuki Saito

    Full Text Available Urbanization may alter mammal assemblages via habitat loss, food subsidies, and other factors related to human activities. The general distribution patterns of wild mammal assemblages along urban-rural-forest landscape gradients have not been studied, although many studies have focused on a single species or taxon, such as rodents. We quantitatively evaluated the effects of the urban-rural-forest gradient and spatial scale on the distributions of large and mid-sized mammals in the world's largest metropolitan area in warm-temperate Asia using nonspecific camera-trapping along two linear transects spanning from the urban zone in the Tokyo metropolitan area to surrounding rural and forest landscapes. Many large and mid-sized species generally decreased from forest landscapes to urban cores, although some species preferred anthropogenic landscapes. Sika deer (Cervus nippon, Reeves' muntjac (Muntiacus reevesi, Japanese macaque (Macaca fuscata, Japanese squirrel (Sciurus lis, Japanese marten (Martes melampus, Japanese badger (Meles anakuma, and wild boar (Sus scrofa generally dominated the mammal assemblage of the forest landscape. Raccoon (Procyon lotor, raccoon dog (Nyctereutes procyonoides, and Japanese hare (Lepus brachyurus dominated the mammal assemblage in the intermediate zone (i.e., rural and suburban landscape. Cats (feral and free-roaming housecats; Felis catus were common in the urban assemblage. The key spatial scales for forest species were more than 4000-m radius, indicating that conservation and management plans for these mammal assemblages should be considered on large spatial scales. However, small green spaces will also be important for mammal conservation in the urban landscape, because an indigenous omnivore (raccoon dog had a smaller key spatial scale (500-m radius than those of forest mammals. Urbanization was generally the most important factor in the distributions of mammals, and it is necessary to consider the spatial scale

  10. Genetic diversity of bovine papillomavirus types, including two putative new types, in teat warts from dairy cattle herds. (United States)

    Lunardi, Michele; de Camargo Tozato, Claudia; Alfieri, Alice Fernandes; de Alcântara, Brígida Kussumoto; Vilas-Boas, Laurival Antonio; Otonel, Rodrigo Alejandro Arellano; Headley, Selwyn Arlington; Alfieri, Amauri Alcindo


    Teat papillomatosis affects dairy cows worldwide. Milking can become difficult due to teat warts, and maintaining affected cows in the herds may diminish economic profit in the dairy industry. Currently, 13 bovine papillomavirus (BPV) types have been fully characterized, and numerous putative BPV types have been identified through partial L1 gene PCR. In order to identify the viral types present in warts on the udders of dairy cows, 40 teat lesions from 24 cows from 13 cattle farms in three States of Brazil were evaluated by PV L1 gene PCR. The warts that were evaluated contained sequences from BPVs 6-10, the putative BPV types BAPV9 and BAPV4, and two unreported putative papillomavirus (PV) types, named BPV/BR-UEL6 and BPV/BR-UEL7. In addition, mixed infections and coinfections were identified, since more than one lesion was observed on the udders of 13 cows. Phylogenetic analysis showed that BPV/BR-UEL6 is closely related to BPVs belonging to the genus Xipapillomavirus, while BPV/BR-UEL7 clustered with the previously reported strains Cervus timorensis and Pudu puda PVs, which represent a putative new PV type, and it was only distantly related to xi-, epsilon-, delta- and dyoxi-PVs. These results provide information that will assist in the understanding of the association of BPVs 6, 7, 8, 9, and 10, as well as putative BPV types BAPV4 and BAPV9, with mammary papillomatosis. This is the first characterization of putative novel PV types BPV/BR-UEL6 and BPV/BR-UEL7 in teat warts of dairy cows, highlighting the high genetic diversity of BPVs associated with teat papillomatosis. PMID:26997614

  11. 红外相机技术在珍稀兽类活动模式研究中的应用%Application of Infrared Camera Technology in Studies of Mammal Activity Patterns

    Institute of Scientific and Technical Information of China (English)

    张晋东; 李玉杰; 李仁贵


    2011年11月-2013年3月,使用40台红外相机调查卧龙自然保护区核桃坪区域的兽类物种组成及相对丰富度.重点分析相对丰富度前4位的珍稀野生兽类:水鹿Cervus unicolor、大熊猫Ailuropoda melanoleuca、小熊猫Ailurus fulgens、金丝猴Rhinopithecus roxellanae的昼夜活动规律、季节活动模式及不同生境类型的出现频率特征.通过红外相机监测数据分析发现,4种兽类昼夜活动规律特征与先前的研究结果基本一致.冬季,大熊猫和小熊猫在溪谷生境的出现频率很高,表明它们对水源的依赖程度强,而水鹿和金丝猴在冬季未表现出对水源地明显的依赖.根据具体研究目的来设置红外相机位点,可以更有效地进行相关的野生动物行为生态和保护生物学研究.

  12. Diversification of Cercopithifilaria species (Nematoda: Filarioidea in Japanese wild ruminants with description of two new species

    Directory of Open Access Journals (Sweden)

    Uni S.


    Full Text Available Twelve of the 17 Cervus nippon nippon deer from Kyushu Island, Japan, that we examined were infected with one or two Cercopithifilaria species. C. longa n. sp. adults were in the subcutaneous tissues of limbs and the abdomen, and C. crassa n. sp. adults were in the skin, mainly in the anterior part of the back ; the distribution of the dermal microfilariae generally matched that of the adult worms. The two new species were assigned to the group of primitive Cercopithifilaria species that parasitize ruminants (bovids and cervids, but the new species could readily be distinguished from others morphologically. C. longa was more primitive and resembled C. bulboidea, one of the five species from the serow Capricornis crispus, a Japanese member of the Caprinae, and species from Bovidae in Africa. C. crassa had a thick body and large spicules like C. rugosicauda from Capreolus capreolus in Europe, the only previously known Cercopithifilaria species from cervids, but it also had one or two hypertrophied pairs of caudal papillae, an unusual character found so far only in Japanese parasites. Among the 12 species known from ruminants, four are African, one is European and more highly evolved, and seven are Japanese, with some being primitive and some more evolved. The great diversity of Cercopithifilaria species in the two wild ruminants that live in Japan seems to have resulted from local speciation, which occurred during the Pleistocene, from a primitive form of the C. longa type derived from Eurasiatic ancestors, which has disappeared or, more probably, not yet been discovered.

  13. Human Activity Differentially Redistributes Large Mammals in the Canadian Rockies National Parks

    Directory of Open Access Journals (Sweden)

    Jenny Coleshill


    Full Text Available National parks are important for conservation of species such as wolves (Canis lupus and elk (Cervus canadensis. However, topography, vegetation conditions, and anthropogenic infrastructure within parks may limit available habitat. Human activity on trails and roads may lead to indirect habitat loss, further limiting available habitat. Predators and prey may respond differentially to human activity, potentially disrupting ecological processes. However, research on such impacts to wildlife is incomplete, especially at fine spatial and temporal scales. Our research investigated the relationship between wolf and elk distribution and human activity using fine-scale Global Positioning System (GPS wildlife telemetry locations and hourly human activity measures on trails and roads in Banff, Kootenay, and Yoho National Parks, Canada. We observed a complex interaction between the distance animals were located from trails and human activity level resulting in species adopting both mutual avoidance and differential response behaviors. In areas < 50 m from trails human activity led to a mutual avoidance response by both wolves and elk. In areas 50 - 400 m from trails low levels of human activity led to differential responses; wolves avoided these areas, whereas elk appeared to use these areas as a predation refugia. These differential impacts on elk and wolves may have important implications for trophic dynamics. As human activity increased above two people/hour, areas 50 - 400 m from trails were mutually avoided by both species, resulting in the indirect loss of important montane habitat. If park managers are concerned with human impacts on wolves and elk, or on these species' trophic interactions with other species, they can monitor locations near trails and roads and consider hourly changes of human activity levels in areas important to wildlife.

  14. Infection of C57BL/6 mice by Trypanosoma musculi modulates host immune responses during Brucella abortus cocolonization. (United States)

    Lowry, Jake E; Leonhardt, Jack A; Yao, Chaoqun; Belden, E Lee; Andrews, Gerard P


    Brucellosis, which results in fetal abortions in domestic and wildlife animal populations, is of major concern in the US and throughout much of the world. The disease, caused by Brucella abortus, poses an economic threat to agriculture-based communities. A moderately efficacious live attenuated vaccine (B. abortus strain RB51) exists. However, even with vaccine use, outbreaks occur. Evidence suggests that elk (Cervus canadensis), a wild host reservoir, are the source of recent outbreaks in domestic cattle herds in Wyoming, USA. Brucella abortus establishes a chronic, persistent infection in elk. The molecular mechanisms allowing the establishment of this persistent infective state are currently unknown. A potential mechanism could be that concurrent pathogen burdens contribute to persistence. In Wyoming, elk are chronically infected with Trypanosoma cervi, which may modulate host responses in a similar manner to that documented for other trypanosomes. To identify any synergistic relationship between the two pathogens, we simulated coinfection in the well-established murine brucellosis model using Trypanosoma musculi and B. abortus S19. Groups of C57BL/6 mice (Mus musculus) were infected with either B. abortus strain 19 (S19) or T. musculi or both. Sera were collected weekly; spleens from euthanized mice were tested to determine bacterial load near the end of normal brucellosis infection. Although changes in bacterial load were observed during the later stages of brucellosis in those mice coinfected with T. musculi, the most significant finding was the suppression of gamma interferon early during the infection along with an increase in interleukin-10 secretion compared with mice infected with either pathogen alone. These results suggest that immune modulatory events occur in the mouse during coinfection and that further experiments are warranted to determine if T. cervi impacts Brucella infection in elk. PMID:24171573

  15. Habitat selection by Eld's deer following relocation to a patchy landscape. (United States)

    Pan, Duo; Song, Yan-Ling; Zeng, Zhi-Gao; Bravery, Benjamin D


    An emerging issue in wildlife conservation is the re-establishment of viable populations of endangered species in suitable habitats. Here, we studied habitat selection by a population of Hainan Eld's deer (Cervus eldi) relocated to a patchy landscape of farmland and forest. Hainan Eld's deer were pushed to the brink of extinction in the 1970s, but their population expanded rapidly from 26 to more than 1000 individuals by 2003 through effective reserve protection. As part of a wider relocation and population management strategy, 131 deer were removed from the reserve and reintroduced into a farmland-forest landscape in 2005. Habitat use under a context of human disturbance was surveyed by monitoring 19 radio-collared animals. The majority of deer locations (77%) were within 0.6-2 km of villages. Annual home ranges of these collared deer averaged 725 ha (SD 436), which was 55% of the size of the reserve from which they had originated. The annual home ranges contained 54% shrub-grassland, 26% forest and 15% farmland. The relocated deer population selected landscape comprising slash-and-burn agriculture and forest, and avoided both intensively farmed areas and areas containing only forest. Within the selected landscape, deer preferred swiddens and shrub-grasslands. Forests above 300 m in elevation were avoided, whereas forests below 300 m in elevation were overrepresented during the dry season and randomly used during the wet season. Our findings show that reintroduced deer can utilize disturbed habitats, and further demonstrate that subsistence agroforest ecosystems have the capacity to sustain endangered ungulates. PMID:24614039

  16. [Non-indigenous and non-specific parasitic nematodes--the background and the consequences]. (United States)

    Okulewicz, Anna


    Introduction of the host is the main reason behind introduction of the parasite, e. g., nematodes. The introduction of the Japanese eel (Anguilla japonica) in Europe in the 1980s resulted in expansion of the swimbladder nematode Anguillicola crassus which soon invaded not only populations of the European eel (A. anguilla), but also other local fish. The raccoon (Procyon lotor) is native to North America. It is the specific host of Strongyloides procyonis and Baylisascaris procyonis. More than 90 species of wild and domestical bird and mammal species, including humans, have been infected with B. procyonis larvae. The larvae enter various organs of paratenic hosts, particularly the central nervous system and eye, causing severe diseases and death. Asthworthius sidemi--a blood-succking, abomasal nematode, a specific parasite of the Asiatic sika deer (Cervus nippon) and sambar deer (C. unicolor)--was first introduced with its hosts into countries adjacent to Poland. A. sidemi is especially dangerous to the European bison (Bison bonasus) which is its new host. The bison populations, in both Białowieza Primaeval Forest and the Bieszczady Mts, sometimes show a 100% prevalence and mass infection intensity. Imported animals, sold in pet shops or available from private breeding firms, often carry non-native parasites. For example, the red-eared tortoise (Trachemys scripta elegans) and Afgan tortoise (Agrionemys horsfieldii) carry nematodes Angusticaecum holopterum, Tachygonetria lobata and T. robusta. Migratory birds in their wintering grounds are often infected with parasites which are usually not constant components of the native fauna, but sometimes nematodes could find a suitable conditions to complete their life cycle. E.g. Cyathosoma microspiculum, species specific to cormorants (Phalacrocorax carbo) and previously recorded only from Asia and the Asian-European boudary, was able complete the life cycle in Poland. The increasingly frequent travels to countries with

  17. A serological survey of Australian wildlife for antibodies to Leptospires of the Hebdomadis serogroup. (United States)

    Durfee, P T; Presidente, P J


    A serological survey for antibodies to Leptospira interrograns serovar hardjo was conducted on 574 serum samples from 10 native and 4 introduced wildlife species in south-eastern Australia. The microscopic agglutination (MA) test was used, and titres to hardjo antigen were detected in 33.5% of 352 brushtailed possums (Trichosurus vulpecula) sampled in several areas of Victoria. Prevalence of reactors ranged from 14 to 66% in 4 populations examined intensively. Serovar balcanica was isolated from possums with hardjo antibodies from two different areas. Of 20 wombats Vombatus ursinus) examined in Victoria, antibodies to hardjo were found in sera from 4 and titres to Pyrogenes and Pomona serogroups were detected in another. Hardjo antibodies were demonstrated in sera from 13 of 19 rusa deer (Cervus timorensis). Negative MA test results to hardjo antigens were recorded in 55 mountain possums (T. caninus), 63 macropods (Macropus spp.), 17 water rats (Hydrmys chrysogaster), 39 fallow deer (Dama dama), 2 hog deer (Axis porcinus) and 2 water buffalo (Bubalus bubalus). No MA antibodies to any of 16 leptospiral serogroups were detected in 17 water rats tested. Kidneys were examined from 330 of these animals and focal interstitial nephritis suggestive of leptospirosis was found in kidneys of 63 of 169 T. vulpecula, 3 of 55 T. caninus, 12 of 18 V. ursinus, 6 of 22 Macropus spp., 9 of 16 H. chrysogaster, 5 of 11 C. timorensis and 3 of 39 D. dama. A statistical association between focal interstitial nephritis and MA antibodies to hardjo was found in T. vulpecula. PMID:485984

  18. Applying clinically proven human techniques for contraception and fertility to endangered species and zoo animals: a review. (United States)

    Silber, Sherman J; Barbey, Natalie; Lenahan, Kathy; Silber, David Z


    Reversible contraception that does not alter natural behavior is a critical need for managing zoo populations. In addition to reversible contraception, other fertility techniques perfected in humans may be useful, such as in vitro fertilization (IVF) or oocyte and embryo banking for endangered species like amphibians and Mexican wolves (Canis lupus baileyi). Furthermore, the genetics of human fertility can give a better understanding of fertility in more exotic species. Collaborations were established to apply human fertility techniques to the captive population. Reversible vasectomy might be one solution for reversible contraception that does not alter behavior. Reversible approaches to vasectomy, avoiding secondary epididymal disruption, were attempted in South American bush dogs (Speothos venaticus), chimpanzees (Pan troglodytes), gorillas (Gorilla gorilla), Przewalski's horse (Equus przewalski poliakov), and Sika deer (Cervus nippon) in a variety of zoos around the world. These techniques were first perfected in > 4,000 humans before attempting them in zoo animals. In vitro fertilization with gestational surrogacy was used to attempt to break the vicious cycle of hand rearing of purebred orangutans, and egg and ovary vitrification in humans have led to successful gamete banking for Mexican wolves and disappearing amphibians. The study of the human Y chromosome has even explained a mechanism of extinction related to global climate change. The best results with vasectomy reversal (normal sperm counts, pregnancy, and live offspring) were obtained when the original vasectomy was performed "open-ended," so as to avoid pressure-induced epididymal disruption. The attempt at gestational surrogacy for orangutans failed because of severe male infertility and the lack of success with human ovarian hyperstimulation protocols. Vitrification of oocytes is already being employed for the Amphibian Ark Project and for Mexican wolves. Vasectomy can be a reversible contraception


    Institute of Scientific and Technical Information of China (English)

    于汇历; 董为


    The Jaiojie Paleolithic Site is located in a karstic cave at Acheng, Haerbin Municipality in Heilongjiang Province. It is regarded as the oldest Paleolithic site in the province and also the northernmost one in China up to today. The geographic coordination at the cave entrance measured with the Global Positioning System ( GPS) is 45°21'07. 7"N and 127°05'16. 8"E, with an altitude of 183m. The cave deposits can be divided into 6 layers. Mammalian fossils were unearthed mainly from Layers 5 and 6 in the lower part of the cave deposits. As a Quaternary mammalian fauna,it is chronologically the earliest one in Heilongjiang Province and geographically the northernmost and easternmost in China. Layer 5 is composed of grayish green clay with some yellow clods, and the underlying Layer 6 composed of reddish yellow clay with breccia. Although the site was discovered in 1996 and systematically excavated in 1997,the fossils were never systematically described before 12 taxa were identified as follow; Mar mot a sp., Myospalax cf. Prosilurus, Ochotona sp., Lepus ( Eulagos) mandshuricus ( = Lepus wongi) , Mattes sp., Meles meles, Mustela sibirica, Ursus sp, Crocuta sp., Stephanorhinus kirchbergensis ( = Dicerorhinus mercki) ,Cervus(S. )nippon hortulorum,Capreolus capreolus manehuricus. The fossils from Layer 5 are mostly smaller forms such as Marmota sp.,Myospalax cf.prosilurus,Lepus(Eulagos) mandshuricus( = Lepus wongi) ,etc. ,and those from Layer 6 are mostly larger forms such as Stephanorhinus kirchbergensis, Cervus ( Sika) hortulorum, Crocuta etc. They are mostly northern forms. The fauna lacks typical cold forms such as Coelodonta and Mammuthus, and it was regarded as a fauna exsiting during the transition from temperate period to cold one in North Region. The comparison of fauna compositions shows that the Jiaojie fauna is close to that of the Middle Pleistocene Jinniushan and Miaohoushan faunas in Liaoning Province, the Late Pleistocene Xiaogushan and Gulongshan faunas

  20. Weather and Prey Predict Mammals' Visitation to Water.

    Directory of Open Access Journals (Sweden)

    Grant Harris

    Full Text Available Throughout many arid lands of Africa, Australia and the United States, wildlife agencies provide water year-round for increasing game populations and enhancing biodiversity, despite concerns that water provisioning may favor species more dependent on water, increase predation, and reduce biodiversity. In part, understanding the effects of water provisioning requires identifying why and when animals visit water. Employing this information, by matching water provisioning with use by target species, could assist wildlife management objectives while mitigating unintended consequences of year-round watering regimes. Therefore, we examined if weather variables (maximum temperature, relative humidity [RH], vapor pressure deficit [VPD], long and short-term precipitation and predator-prey relationships (i.e., prey presence predicted water visitation by 9 mammals. We modeled visitation as recorded by trail cameras at Sevilleta National Wildlife Refuge, New Mexico, USA (June 2009 to September 2014 using generalized linear modeling. For 3 native ungulates, elk (Cervus Canadensis, mule deer (Odocoileus hemionus, and pronghorn (Antilocapra americana, less long-term precipitation and higher maximum temperatures increased visitation, including RH for mule deer. Less long-term precipitation and higher VPD increased oryx (Oryx gazella and desert cottontail rabbits (Sylvilagus audubonii visitation. Long-term precipitation, with RH or VPD, predicted visitation for black-tailed jackrabbits (Lepus californicus. Standardized model coefficients demonstrated that the amount of long-term precipitation influenced herbivore visitation most. Weather (especially maximum temperature and prey (cottontails and jackrabbits predicted bobcat (Lynx rufus visitation. Mule deer visitation had the largest influence on coyote (Canis latrans visitation. Puma (Puma concolor visitation was solely predicted by prey visitation (elk, mule deer, oryx. Most ungulate visitation peaked during